Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2010 Feb 7.
Published in final edited form as: J Proteome Res. 2009 Feb 6;8(2):620–630. doi: 10.1021/pr8007545

Glycomic Characterization of Prostate Specific Antigen and Prostatic Acid Phosphatase in Prostate Cancer and Benign Disease Seminal Plasma Fluids

Krista Y White 1, Lucy Rodemich 2, Julius O Nyalwidhe 1, Mary Ann Comunale 2, Mary Ann Clements 1, Raymond S Lance 1,3, Paul F Schellhammer 1,3, Anand Mehta 2, O John Semmes 1, Richard R Drake 1,*
PMCID: PMC2651839  NIHMSID: NIHMS91585  PMID: 19128049

Abstract

Prostate-specific antigen (PSA) and prostatic acid phosphatase (PAP) are glycoproteins secreted by prostate epithelial cells, and have a long clinical history of use as serum biomarkers of prostate cancers. These two proteins are present at significantly higher concentrations in seminal plasma, making this proximal fluid of the prostate a good source for purifying enough protein for characterization of prostate disease associated changes in glycan structures. Using seminal fluid samples representative of normal control, benign prostatic disease and prostate cancers, PAP and PSA were enriched by thiophilic absorption chromatography. Released N-linked glycan constituents from both proteins were analyzed by a combination of normal phase HPLC and MALDI-TOF spectrometry. For PSA, 40 putative glycoforms were determined, and 21 glycoforms were determined for PAP. PAP glycans were further analyzed with a hybrid triple quadrupole/linear ion trap mass spectrometer to assign specific glycoform classes to each of the three N-linked sites. The glycans identified in these studies will allow for more defined targeting of prostate disease-specific changes for PAP, PSA and other secreted prostatic glycoproteins.

Keywords: prostate specific antigen, prostatic acid phosphatase, glycomics, mass spectrometry, biomarker

INTRODUCTION

The clinical measurement of the concentration and activities of two prostate derived glycoproteins, prostate specific antigen (PSA) and prostatic acid phosphatase (PAP), in serum has been assessed for decades in attempts to detect prostate cancers. Concentrations of PSA in serum above 10 ng/ml reliably indicate the presence of cancers, yet PSA testing is limited in its ability to differentiate prostate cancer from benign prostate hyperplasia (BPH), and specificity of the test diminishes significantly at lower PSA values below 10 ng/ml1–3. Digital rectal exams (DRE) and determination of serum prostatic acid phosphatase (PAP) were the principal method for prostate cancer detection and staging before the advent of PSA testing, and they too have many limitations4, 5. Serum PAP levels can still be used as an indicator of metastatic disease and possibly recurrence prediction6, 7, but it has proven to have low specificities and sensitivities as a detection biomarker as compared to PSA8. While X-ray crystal structures have been reported for both human PSA and PAP9, 10, there was little resolution of the glycan constituents of these proteins. Because of the known associations of changes in glycosylation associated with cancer progression11–14, characterization of the glycan constituents of PSA and PAP derived from clinical samples representing healthy and different prostatic disease states could identify knew biomarker candidates for prostate cancer detection.

PSA contains 8% carbohydrate by mass15, and has one glycosylation site at asparagine (Asn)-4516. Previous studies on PSA glycosylation have compared seminal plasma from healthy donors to prostate tumor metastatic cell line LNCaP17–19. PSA purified from the seminal fluid of healthy subjects have been characterized as having sialylated complex biantennary glycans, frequent core fucose modifications, high mannose glycans, and some terminal N-acetylgalactosamines19, 20. PSA glycans isolated from LNCaP cell lines have also been characterized as having some triantennary structures18, as well as decreased sialic acid content and the presence of increased fucose and GalNAc content17. A recent comparison of the sialic acid content of free PSA and proPSA isolated from serum, seminal plasma and tissues from non-cancer control subjects and prostate cancer subjects was reported21. Essentially no differences in sialylation content for the different forms of PSA were detected for any condition or sample21. A separate study of serum PSA derived glycans compared structural differences between free and complexed PSA22. Both forms of PSA were found to have mostly sialylated and fucosylated biantennary structures, while a few multiantennary complex structures were also identified22. These previous studies did not evaluate the specific structural configurations for each oligosaccharide isolated, and very few numbers of clinical samples were used. PAP has three glycosylation sites at Asn-62, Asn-188, and Asn-3019, 23, making it a more difficult target for site specific structural characterization, yet one that may be a suitable complement to PSA. An X-ray crystal structure of PAP from normal seminal plasma had reported that Asn-301 had glycan modifications consisting of primarily high mannose oligosaccharides, while glycans at Asn-188 were less resolved, but consistent with complex structures containing sialic acid and fucose9. In relation to prostate cancer, a previous serial lectin analysis of PAP isolated from tissue in BPH and cancer subjects reported a decrease in high-mannose and hybrid glycans with core fucoses in cancer relative to BPH, and an increase of non-fucosylated hybrids in PCa as compared to BPH23.

The objective of our study described herein was to obtain purified forms of both PSA and PAP from a clinical cohort of seminal plasma from healthy, BPH and prostate cancer subjects for further glycan structural analyses. We hypothesized that characterization of these PSA and PAP glycoforms across specified clinical sample sets would identify a subset of glycan constituents as biomarker candidates for the detection of prostate cancers. Following a purification step using thiophilic chromatography, the released glycans from PSA and PAP were characterized using HPLC separation of aminobenozate derivatives, permethylation and MALDI-TOF/TOF profiling, and glycopeptide analysis on a hybrid triple quadrupole/linear ion trap mass spectrometer. The cumulative structures obtained for both PSA and PAP are reported and potential disease specific classes of glycoforms are identified. Specific assignments of glycan structural subtypes have also been determined for each of the three glycosylation sites on PAP. The glycan structures reported for PAP represent the first description of its glycan constituents using mass spectrometry based methods.

EXPERIMENTAL

Seminal plasma samples

Seminal fluid was obtained from men seen at the EVMS Department of Urology/Divine Tidewater Urology clinic for prostate cancer screening from 1989–2003. A semen collection kit was provided for each donor. Following semen collection, an instant freeze pack was applied to each tube for storage, and brought with the donor to the urology clinic. Following transport to the Virginia Prostate Center biorepository at EVMS, each sample was thawed, centrifuged to remove sperm, and stored in 0.5 ml aliquots. Initially, Normal (n=65), BPH (n=59), and PCa (n=92) pools (8–10 mls total/pool) were compiled from samples previously aliquoted for expression profiling studies (0.05 to 0.2 ml per sample), and matched for age. Each aliquot went through less than 2 freeze/thaw cycles, and average serum PSA values were 10.4 ng/ml (range 0.01 – 225.8 ) for PCa, 3.6 ng/ml (range 0.15 – 13.9) for BPH, and 1.5 ng/ml (range 0.3 – 4.8) for normal. The pooled samples were then subjected to a low-speed spin (4°C, 12k RPM, 20 minutes) to remove any cellular contaminants, followed by ultracentrifugation (4°C, 37K RPM, 1 hour) to pellet out the prostasomes. The supernatant was collected and 400ul aliquots were stored at −80°C. A more defined subset of seminal plasma pools were created for each clinical group, with each cohort having defined serum PSA values in the 2–7 ng/ml range. Nine samples, 500 μl per sample, were used to make each seminal plasma pool, and the samples used were collected between 1997 and 2003. The mean serum PSA values were 3.58 ng/ml for normal, 2.64 ng/ml for BPH, and 5.83 ng/ml for prostate cancer. BPH cases were defined as being biopsy negative, and the cancer samples were predominantly Gleason grade 6 (3+3). These pools were processed as previously described. The final supernatant of approximately 4.5 ml was aliquoted and stored at −80°C until needed. Protein concentrations were determined for all seminal plasma pools.

Thiophilic adsorption chromatography (TAC)

PSA and PAP were purified from seminal plasma pools using thiophilic adsorption chromatography (TAC) following the methods outlined by Kawiniski et al.24. Briefly, seminal plasma pools were applied to Fractogel® EMD TA “T-gel” (Merck KGaG, Darmstadt, Germany) columns (2 cm × 0.5 cm) equilibrated in 1M sodium sulfate, and eluted in decreasing salt fractions. Protein content of each pool was normalized to 3.0 mg, with the samples in a final volume of 1ml in 25mM HEPES/1M sodium sulfate. Next, the sample was applied to the column, followed by 2ml of column buffer, and allowed to flow through by gravity; this three milliliter fraction collected is named “unbound”. The column was washed with 8 bed volumes of column buffer. Batch elution with decreasing sodium sulfate molarities (0.8M, 0.6M, 0.4M, 0.2M, and 0.0M) was performed using a low-pressure peristaltic pump. For each concentration, approximately 3ml fractions were collected, aliquoted, and stored at −80°C. The presence of PSA and PAP were confirmed by Western blot, and MALDI peptide mass fingerprinting of the corresponding excised gel bands was done to assess relative purity. MASCOT scores of greater than 100 (significance threshold of 54) and sequence coverage of greater than 45% were routinely obtained for both PAP and PSA bands.

Normal Phase HPLC

Rapid glycan sequencing of both PSA and PAP was performed by using previously optimized procedures25. Briefly, PSA and PAP gel slices were digested with PNGase F, then the released free glycans were labeled with 2-aminobenzamide (2-AB) for subsequent normal phase HPLC analysis26. A subset of samples were treated with Arthrobacter ureafaciens sialidase as previously described by Guile et al.27. The resulting peaks, separated by time of appearance, correspond to specific glycan structures on the basis of glucose unit values (data not shown)27. All HPLC analyses were performed using a Waters Alliance HPLC System and quantified using the Millennium Chromatography Manager (Waters Corporation, Milford, MA).

N-glycan permethylation

TAC-purified PSA and PAP gel bands derived from seminal plasma pools were permethylated28 following trypsin digestion. Gel bands were first reduced and alkylated, and then dried in vacuo prior to proteolytic digestion. Trypsin digestions were performed at 37°C for 18 hours, followed by peptide extraction with 50% acetonitrile/0.1% TFA and dried in vacuo. Next, trypsin was denatured by heating the sample at 100°C for 5 minutes, and 1500 units of PNGase F (New England Biolabs, Ipswich, MA) was added to the peptide mixture and incubated at 37°C for 18 hours. The final digested product was purified using Resprep™ C18 cartridges (Restek Corporation, Bellefonte, PA). The N-glycan fraction was collected in 5% acetic acid, and subsequently dried under reduced pressure. Dried N-glycans were permethylated following the protocol described by Ciucanu and Kerek28. The permethylated N-glycans were purified using C18 columns, eluted in 85% acetonitrile, and then dried under a nitrogen stream.

MALDI-TOF/TOF

The dried permethylated N-glycans were reconstituted in 20 μl of 100% methanol. Sample was mixed 1:1 with 2,5-Dihydroxybenzoic acid (DHB) matrix (20mg/ml in 50% methanol) and spotted on a polished steel MALDI-TOF target plate and allowed to crystallize at room temperature in the dark. Each sample was analyzed in positive ion mode using an UltraFlex III MALDI-TOF/TOF instrument (Bruker Daltonics, Germany). FlexControl and FlexAnalysis software (Bruker Daltonics, Germany) were used for spectra processing. Additionally, the glycan database offered by the Consortium for Functional Glycomics (http://www.functionalglycomics.org) was used to search permethylated glycan masses correlating to peaks of interest in MALDI-TOF spectra. Glycan “cartoons” representing mass peaks were built using GlycanBuilder ver 1.2 build 335329.

Hybrid triple quadrupole/linear ion trap mass spectrometry

A hybrid triple quadrupole/linear ion trap mass spectrometer 4000 (QTRAP® LC/MS/MS system, Applied Biosystems, Foster City, CA) coupled to a Tempo NanoLC system (Eksigent Technologies, Dublin, CA) was used to determine the structures of the glycans attached to each of the three PAP linkage sites: Asn-62, Asn-188, and Asn-301. The methods described by Sandra et al.30 were used with minor modifications to optimize for our samples and instrumentation. Briefly, TAC-purified PAP gel slices derived from seminal plasma were reduced, alkylated, and digested with a saturated solution (in 50mM ammonium bicarbonate) of either 750 ng of trypsin or 950 ng of chymotrypsin. After an overnight digestion, the resultant peptides were extracted from the gel slice using 50% acetonitrile/0.1% TFA in water and dried in vacuo. The digested product was reconstituted in 20 μl of Buffer A (5% acetonitrile/0.1% formic acid/0.005% heptafluorobutyric acid in water) and 8 μl was injected into the nanoLC system for fractionation and analysis. Both the linear ion trap and the triple quadrupole capabilities of the QTRAP were utilized in these analyses. Glycopeptides were identified in the digestion mixtures by monitoring for unique marker oxonium ions such as m/z 163 (Hex+), 204 (HexNAc+), 292/274/256 (NeuAc+1), and 366 (HexHexNAc+) that originate from fragmented glycopeptides30, 31. In this approach the peptides are scanned in quadrupole 1 (Q1) to determine their masses and retention times. The peptides are then transmitted to quadrupole 2 (Q2) which acts as a collision cell where fragmentation occurs. Quadrupole 3 (Q3) is set to transmit only the mass of the diagnostic oxonium ions. Upon their detection, an enhanced product ion scan (EPI) of the precursor ion is triggered where fragmentation occurs in Q2, the fragmented ions are captured in the ion trap and then scanned out generating an MS/MS spectrum containing the ions from the both the peptide and the linked carbohydrate structures.

RESULTS

Purification of PSA and PAP from seminal plasma pools

A large repository of seminal plasma fluids collected over the last 18 years were used to create pooled sample cohorts representative of normal control, benign prostatic hyperplasia (BPH) and prostate cancer conditions. A thiophilic adsorption chromatography (TAC) approach adapted from Kawiniski et al.24 was used to purify PSA and PAP from the prostasome depleted, pooled seminal plasma fluids. Following sequential batch elution, the resulting protein fractions were separated by SDS-PAGE, as shown in Figure 1. Under the conditions used, PAP did not bind to the TAC resin, and PSA eluted in both the 0.6M and 0.4M sodium sulfate fractions. Both PSA and PAP were readily detected by Coomassie staining, and their identities were confirmed in their respective fractions by western blotting and peptide mass fingerprinting. For both PSA and PAP isolated from gel slices, MASCOT scores of over 100 and sequence coverage of at least 45% were obtained. There was no indication of other protein sequences present with significant scores.

Figure 1. Seminal plasma fractionation by thiophilic adsorption chromatography.

Figure 1

Seminal plasma protein fractions purified by thiophilic adsorption chromatography (TAC) were separated on a 12% Bis-Tris NuPAGE SDS-gel (Invitrogen) and stained with Coomassies blue. Unbound proteins are shown in Lane 1, with protein from the 0.8M NaSO4 elution in Lane 2, 0.6M (Lane 3), 0.4M (Lane 4), 0.2M (Lane 5) and 0 M/25mM HEPES (Lane 6). This gel shows the proteins from normal seminal plasma, and is representative of the purifications of the benign and cancer samples. PAP and PSA identities were confirmed in the above fractions by staining, western blots and MALDI-TOF analysis.

Rapid glycan sequencing analysis of PAP and PSA glycans

The TAC fractions containing PSA and PAP were used for preparative SDS-PAGE separations, stained with Coomassie blue, and gel slices corresponding to PSA or PAP excised. Each gel band was digested with trypsin, followed by PNGaseF digestion and 2-aminobenzamide derivatization of the released glycans as previously described26. Glycans from PSA and PAP for each of the three clinical groups were then separated by normal phase HPLC and their elution positions used to define structural classes27. The elution profile of PAP derived 2AB modified glycans from each pool is shown in Figure 2. It is clear that there are major differences in glycosylation patterns detected for PAP, particularly in the comparison of healthy and benign relative to the cancer samples. Because of the known instabilities of terminal sialic acid residues during processing and HPLC analysis26, digestion with Arthrobacter ureafaciens sialidase was also done prior to normal phase HPLC separation to compare the non-sialylated structures. As summarized in Figure 3, there were still significant decreases in the fucosylated bi- and tetraantennary classes, FcA2G2 and FcA4G4, in the cancer samples. Either with or without sialidase treatment, there was also an apparent decrease in high mannose (Man6) structures in the cancer samples, and dramatic increases in cancer for truncated A1G1 structures. A similar analysis for 2-AB labeled PSA glycans was done, as summarized in Figure 4 (no sialidase) and Figure 5 (with sialidase). Cumulatively, the types of glycan structures detected in these HPLC separations are consistent with previously reported structures for PSA17–19. There were no dramatic differences in expression of sub-types across the three clinical conditions, with the exception of the A2G2 structures in BPH in the non-sialidase treated preparation. Because this difference was not detected in the sialidase treated samples, this could reflect differential stabilities or sample processing differences. This will need to be further investigated in follow up studies.

Figure 2. Normal phase HPLC separation of 2-AB derivatized N-linked glycans from PAP.

Figure 2

The relative levels of N-linked glycans from PAP isolated from normal control, benign (BPH) and prostate cancer (PCa) conditions separated by normal phase HPLC. Structural designation are as follows: A1G1, hybrid glycan with a single galactose residue on the 1,6 arm; FcA2, core fucosylated (1,6) agalactosylated biantennary glycan; Man6, High mannose glycan with 6 mannose residues, A2G2, biantennary N-glycan; Man7, High mannose glycan with 7 mannose residues; A3G3, triantennary N-linked glycan; FcA3G3, core fucosylated (1,6) triantennary N-linked glycan; A4G3, tetraantennary N-linked glycan with 3 galatose residues; A4G4, tetraantennary N-linked glycan; FcA4G4, core fucosylated (1,6) tetraantennary N-linked glycan. B indicates bisecting GlcNAc residues.

Figure 3. Normal phase HPLC separation of 2-AB derivatized N-linked glycans from PAP treated with sialidase.

Figure 3

N-linked glycans from PAP isolated from normal control, benign (BPH) and prostate cancer (PCa) were treated with sialidase prior to normal phase HPLC separation. Shown are the relative intensities of each indicated structure per condition, normal (Gray bars); BPH (Black bars); PCa (White bars). Structural abbreviations are described in the legend for Figure 2.

Figure 4. Normal phase HPLC separation of 2-AB derivatized N-linked glycans from PSA.

Figure 4

N-linked glycans from PSA isolated from normal control, benign (BPH) and prostate cancer (PCa) were separated by normal phase HPLC. Shown are the relative intensities of each indicated structure per condition, normal (Gray bars); BPH (Black bars); PCa (White bars). Structural abbreviations are described in the legend for Figure 2

Figure 5. Normal phase HPLC separation of 2-AB derivatized N-linked glycans from PSA treated with sialidase.

Figure 5

N-linked glycans from PSA isolated from normal control, benign (BPH) and prostate cancer (PCa) were treated with sialidase prior to normal phase HPLC separation. Shown are the relative intensities of each indicated structure per condition, normal (Gray bars); BPH (Black bars); PCa (White bars). Structural abbreviations are described in the legend for Figure 2

The seminal plasma pools used for these initial analyses represent a broad range of clinical samples reflecting the disease severity spectrum of prostate cancers and benign conditions collected from 1990 to 2003, a time frame that spans the pre-PSA testing era to current clinical practice. Using the PSA levels for each individual in the pool of these samples, a refined pooled subset of 9 samples per condition was generated based on dates of collection after 1997 and serum PSA levels between 2–7 ng/ml. This PSA range better reflects the majority of benign and prostate cancer subjects detected in the PSA screening/testing era, and hence results from these samples should be more reflective of current urological practice. The same sample preparation and TAC purification was done for each new pool. PAP and PSA eluted in their respective fractions as described in Figure 1 (data not shown). As shown in Figure 6 for PAP, similar results to the larger pool data were obtained. There continued to be a larger proportion of fragmented glycans (A1G1, FcA2, A2G1, FcA2) in the prostate cancer samples relative to the healthy and BPH cohorts. The results for PSA were essentially the same as shown in Figure 4 (data not shown). PSA and PAP purified from this new cohort was used for all subsequent analyses.

Figure 6. Normal phase HPLC separation of 2-AB derivatized N-linked glycans from PAP from the refined second sample pool.

Figure 6

N-linked glycans from PAP isolated from the second pool of normal control, benign (BPH) and prostate cancer (PCa) seminal fluids stratified to PSA levels and other clinical parameters. Shown are the relative intensities of each indicated structure per condition following normal phase HPLC separation: normal (Gray bars); BPH (Black bars); PCa (White bars). Structural abbreviations are described in the legend for Figure 2

MALDI-TOF analysis of permethylated PSA and PAP glycans

In order to further define the structural repertoire of PSA and PAP glycans, permethylation28 of the PNGaseF released glycans was done for each clinical cohort, followed by MALDI-TOF/TOF analysis. Because of the broad diversity of the indicated structural classes from the HPLC analyses, the goal was not to identify disease specific changes, but to better define all of the possible glycan structures detected on seminal plasma PSA and PAP. Permethylation of glycans aids in the stability of the terminal sialylated residues for detection by MALDI-TOF/TOF, and simplifies the spectra to primarily Na+ adducts, allowing for less complex annotation of mass peaks. From the permethylation experiments, we were able to detect multiple glycoforms for both PAP and PSA (Tables 1 and 2). A representative MALDI-TOF spectra of PAP derived permethylated glycans from prostate cancer samples are shown in Figure 7. Cumulatively, 21 structural classes of PAP glycans were detected representing primarily high-mannose and complex subtypes, with a few potential hybrid sub-types represented as well (Table 1). Permethylated glycans cleaved from PSA seemed to be mostly bi- and tri-antennary structures of the complex sub-type, but represented 40 potential classes, including high mannose and hybrid sub-types detected as well (Table 2). These results are consistent with structures previously reported for PSA glycans from serum and seminal fluids17–19, 21.

Table 1. Permethylated MALDI-TOF m/z and corresponding N-glycan structures for PAP.

Permethylated PAP glycans from normal, BPH, and PCa seminal plasma pools were analyzed by MALDI-TOF. Identified m/z values were used for database searches, and corresponding masses that could be assigned to a biologically relevant N-glycan structure are listed. An asterisk denotes structures that are one representation of multiple possible glycoforms for a given mass. The shown structure in these cases was chosen based on its apparent prevalence in mammalian species. Cartoon representations are as follows: Inline graphic=GlcNAc, Inline graphic=Mannose, Inline graphic=Galactose, Inline graphic=Fucose, Inline graphic=NeuAc, Inline graphic=GalNAc

Number m/z Proposed Glycan Structure Sub-Type
1 1784.016 M6N2 graphic file with name nihms91585t1.jpg High Mannose
2 1987.958 M7N2 graphic file with name nihms91585t2.jpg High Mannose
3 2070.189 Gal2N2M3N2 graphic file with name nihms91585t3.jpg Complex
4 2244.268 Gal2N2M3N2F graphic file with name nihms91585t4.jpg Complex
5 2314.091 Hex5HexNAc5 graphic file with name nihms91585t5.jpg Complex
6 2432.339 NeuAc1Gal2N2M3N2 graphic file with name nihms91585t6.jpg Complex
7 2606.425 NeuAc1Gal2N2M3N2 graphic file with name nihms91585t7.jpg Complex
8 2793.503 NeuAc2Gal2N2M3N2 graphic file with name nihms91585t8.jpg Complex
9 2881.559 NeuAc1Gal3N3M3N2 graphic file with name nihms91585t9.jpg Complex
10 2967.587 NeuAc2Gal2N2M3N2F graphic file with name nihms91585t10.jpg Complex
11 3055.647 NeuAc1Gal3N3M3N2F graphic file with name nihms91585t11.jpg Complex
12 3242.719 NeuAc2Gal3N3M3N2 graphic file with name nihms91585t12.jpg Complex
13 3416.793 NeuAc2Gal3N3M3N2F graphic file with name nihms91585t13.jpg Complex
14 3504.838 NeuAc1Gal4N4M3N2F graphic file with name nihms91585t14.jpg Complex
15 3603.894 NeuAc3Gal3N3M3N2 graphic file with name nihms91585t15.jpg Complex
16 3777.971 NeuAc3Gal3N3M3N2F graphic file with name nihms91585t16.jpg Complex
17 3867.027 NeuAc2Gal4N4M3N2F graphic file with name nihms91585t17.jpg Complex
18 3963.779 Hex6HexNAc5NeuAc4 graphic file with name nihms91585t18.jpg Complex
19 4053.873 NeuAc3Gal4N4M3N2 graphic file with name nihms91585t19.jpg Complex
20 4227.294 NeuAc3Gal4N4M3N2F graphic file with name nihms91585t20.jpg Complex
21 4588.57 NeuAc4Gal4N4M3N2F graphic file with name nihms91585t21.jpg Complex

Table 2. Permethylated MALDI-TOF m/z and corresponding N-glycan structures for PSA.

Permethylated PSA glycans from normal, BPH, and PCa seminal plasma pools were analyzed by MALDI-TOF. Identified m/z values were used for database searches, and corresponding masses that could be assigned to a biologically relevant N-glycan structure are listed. An asterisk denotes structures that are one representation of multiple possible glycoforms for a given mass. The shown structure in these cases was chosen based on its apparent prevalence in mammalian species. Cartoon representations are as follows: Inline graphic =GlcNAc, Inline graphic =Mannose, Inline graphic =Galactose, Inline graphic =Fucose, Inline graphic =NeuAc, Inline graphic =GalNAc

Number m/z Proposed Glycan Structure Sub-Type Number m/z Proposed Glycan Structure Sub-Type
1 1344.917 M3N2F graphic file with name nihms91585t22.jpg Complex 21 2767.61 Hex5dHex4HexNAc4 graphic file with name nihms91585t23.jpg Complex
2 1580.069 M5N2 graphic file with name nihms91585t24.jpg High Mannose 22 2779.64 NeuAc1Gal2N2M3N2F2 graphic file with name nihms91585t25.jpg Complex
3 1590.051 NM3N2F graphic file with name nihms91585t26.jpg Complex 23 2793.652 NeuAc2Gal2N2M3N2 graphic file with name nihms91585t27.jpg Complex
4 1784.208 M6N2 graphic file with name nihms91585t28.jpg High Mannose 24 2880.654 NeuAc1Gal3N3M3N2 graphic file with name nihms91585t29.jpg Complex
5 1907.156 N3M3N2 graphic file with name nihms91585t30.jpg Complex 25 2893.731 Hex4dHex1HexNAc6NeuAc1 graphic file with name nihms91585t31.jpg Complex
6 2111.231 Hex4HexNAc5 graphic file with name nihms91585t32.jpg Complex 26 2967.686 NeuAc2Gal2N2M3N2F graphic file with name nihms91585t33.jpg Complex
7 2244.425 Gal2N2M3N2F graphic file with name nihms91585t34.jpg Complex 27 3024.789 NeuAc1Gal2N3M3N2F2 graphic file with name nihms91585t35.jpg N/A
8 2315.331 Hex5HexNAc5 graphic file with name nihms91585t36.jpg Complex 28 3132.772 Gal6N3M3N2 graphic file with name nihms91585t37.jpg Complex
9 2356.526 Hex4HexNAc6 graphic file with name nihms91585t38.jpg Complex 29 3142.734 Gal4N4M3N2F graphic file with name nihms91585t39.jpg Complex
10 2377.534 Hex6dHex2HexNAc3 graphic file with name nihms91585t40.jpg Hybrid 30 3211.806 NeuAc2Gal2N3M3N2F graphic file with name nihms91585t41.jpg Complex
11 2419.445 Hex5dHex2HexNAc4 graphic file with name nihms91585t42.jpg Complex 31 3242.891 NeuAc2Gal3N3M3N2 graphic file with name nihms91585t43.jpg Complex
12 2432.413 NeuAc1Gal2N2M3N2 graphic file with name nihms91585t44.jpg Complex 32 3345.936 Hex8dHex1HexNAc5 graphic file with name nihms91585t45.jpg Complex
13 2472.384 NeuAc1GalN3M3N2 graphic file with name nihms91585t46.jpg Complex 33 3416.859 NeuAc2Gal3N3M3N2F graphic file with name nihms91585t47.jpg Complex
14 2518.443 Gal3N3M3N2 graphic file with name nihms91585t48.jpg Complex 34 3593.05 Hex8dHex1HexNAc7 graphic file with name nihms91585t49.jpg Complex
15 2549.473 Hex6dHex3HexNAc3 graphic file with name nihms91585t50.jpg Hybrid 35 3605.045 NeuAc3Gal3N3M3N2 graphic file with name nihms91585t51.jpg Complex
16 2561.577 Hex5HexNAc6 graphic file with name nihms91585t52.jpg Complex 36 3777.062 NeuAc3Gal3N3M3N2F graphic file with name nihms91585t53.jpg Complex
17 2593.532 Hex5dHex3HexNAc4 graphic file with name nihms91585t54.jpg Complex 37 3866.523 NeuAc2Gal4N4M3N2F graphic file with name nihms91585t55.jpg Complex
18 2606.502 NeuAc1Gal2N2M3N2F graphic file with name nihms91585t56.jpg Complex 38 3912.098 Hex9dHex1HexNAc6NeuAc graphic file with name nihms91585t57.jpg Complex
19 2677.545 NeuAc1Gal2N3M3N2 graphic file with name nihms91585t58.jpg Complex 39 3965.198 Hex6HexNAc5NeuAc4 graphic file with name nihms91585t59.jpg Complex
20 2694.765 Gal3N3M3N2F graphic file with name nihms91585t60.jpg Complex 40 4416.599 NeuAc4Gal4N4M3N2 graphic file with name nihms91585t61.jpg Complex

Figure 7. MALDI-TOF analysis of permethylated PAP glycans from prostate cancer seminal plasma.

Figure 7

A representative MALDI spectra for permethylated PAP is shown. Combined with the structures determined in the control and BPH permethylated PAP samples, glycan structures corresponding to detected m/z peaks are listed in Table 1.

Triple-quadrupole mass spectrometry analysis of PAP glycopeptides

Because PAP has three distinct glycan sites, and the previously reported crystal structure was only able to definitively assign one high-mannose containing site, individual glycopeptide analysis of the three sites was initiated. SDS-PAGE separated PAP was proteolytically digested with trypsin or chymotrypsin, and peptides fractionated by nanoLC system in-line with triple quadrupole mass spectrometer. The instrument was operated in the precursor ion (PI) scan mode for individual sugar molecules at specific m/z values of either 163 for Hexose+1(Hex), 204 for N-acetylhexoseamine+1 (HexNAc), 292/274/256 for N-acetylneuraminic acid+1 (NeuAc), or 366 for Hex-HexNAc+1. An enhanced product ion scan is triggered upon detection of the specified diagnostic ion, generating information on the sugar composition and the amino acid sequence of the glycopeptides in a single assay. An example is shown in Figure 8 for the tryptic peptide with one missed cleavage encompassing the high mannose site at Asn 301 (GEYFVEMYYRNETQHEPYPLMLPGCSPSCPLER), as determined by the precursor ion scan for oxonium ion 163. Knowing the parent mass allows for annotation of the remaining triply charged ion peaks in the third quadrupole (Q3) for identification of sugar constituents and fragments. The annotation of these glycans was greatly simplified as this site contains only high mannose structures, with Man6 being the major constituent, and Man7 a minor one, which is consistent with the PAP crystal structure9. As listed in Table 3, this approach has been useful for identifying complex biantennary and triantennary glycans at Asn 62. This site had previously been poorly resolved in the PAP crystal structure, such that complex glycan structures were proposed to be unlikely constituents9. Like in the crystal structure, the site at Asn 188 has proven elusive to glycan analysis, particularly when trypsin was used for digestion, which we believe was due to a combination of missed tryptic cleavages combined with large tetra-antennary glycans. However, use of chymotrypsin allowed detection of Asn 188 containing glycopeptides, consistent with attached tetraantennary glycan structures (Table 3).

Figure 8. Precursor ion scan for 163 m/z hexose of tryptic PAP peptides.

Figure 8

A) Enhanced Product Ion (EPI) scan of a quadrupole-charged PAP glycopeptide with parent mass of 5449.0. B) Expanded window of above EPI scan showing fragmentation of the parent ion that corresponds to the tryptic peptide GEYFVEMYYRNETQHEPYPLMLPGCSPSCPLER containing the glycosylation site Asn-301 and a Man6 N-glycan.

Table 3. PAP glycopeptides with corresponding N-glycan structures identified by QTRAP.

Both tryptic and chymotryptic PAP digests were analyzed by the QTRAP as described in the experimental section. PI scans for oxonium ions 163, 366, and 292 are represented in the above table. Certain EPI scans revealed glycopeptide information that allowed for the assignment of both peptide and glycan

N-linked Glycosylation site Peptides generated by enzymatic digestion Structures Identified
Asn-62 Trypsin Digestion
FLNESYKHEQVYIR 1825.9
KFLNESYKHEQVYIR 1954.0
graphic file with name nihms91585t62.jpg
Chymotrypsin Digestion
RKFLNESYKHEQVY 1840.9
Asn-188 Trypsin Digestion
N/A
graphic file with name nihms91585t63.jpg
Chymotrypsin Digestion
CESVHNFTLPSW 1476.7
DPLYCESVHNFTLPSW 1964.9
YCESVHNFTLPSWATEDTM 2304.0
Asn-301 Trypsin Digestion
NETQHEPYPLMLPGCSPSCPLER 2712.2
GEYFVEMYYRNETQHEPYPLMLPGCSPSCPLER 4049.9
graphic file with name nihms91585t64.jpg
Chymotrypsin Digestion
RNETQHEPYPLM 1530.7
RNETQHEPYPLMLPGCSPSCPLERF 2974.3

DISCUSSION

The need for improved prostate cancer biomarkers beyond the serum PSA test is increasingly evident. Because this test is applied to population screening, there is a wealth of data that indicates its strength in increasing detection of prostate cancers, but its use has also led to increased over-treatment and unnecessary surgeries for indolent disease. Despite its widespread use, there is still much characterization of PSA to be done, particularly in regards to its structural glycosylation properties and physiological function. Proximal fluids of the prostate like seminal fluid that are enriched for prostate derived secreted glycoproteins like PSA have long been a source of this enzyme, particularly as it is generally present at concentrations that range from 100–400 μg/ml in this fluid. Using a large cohort of archived seminal plasma samples reflective of healthy, benign and prostate cancer conditions allowed systematic characterization of PSA for similarities and differences in its disease specific glycosylation patterns. While PSA glycosylation has been previously studied by many other groups17–19, 21, 32, to our knowledge we are the first to examine PSA glycoforms across matched, disease-defined sample sets reflective of multiple samples. For a glycoprotein with one site of N-glycosylation, the number of different glycan structures identified across the conditions analyzed is highly variable, ranging from predominant complex bi- or tetraantennary structures, to hybrid and high mannose glycoforms. In this regard, use of pooled samples to identify disease specific variants of PSA will be highly limiting. While it is appropriate to define the repertoire of potential structures, there were no conclusions that could be reached regarding specific disease glycoform variants of PSA. Methods that facilitate characterization of individual samples like targeted lectin-ELISA assays33 or specific selective reaction monitoring (SRM) approaches using instrumental configurations like the hybrid triple quadrupole MS assay for PAP will be necessary to better define disease specific glycoform changes for PSA. The diversity of glycan structures detected for PSA, and the well established role of PSA in clinical medicine and prostate disease, certainly warrant these types of approaches on larger sample cohorts.

The cumulative glycan results for PAP represent the first characterization of PAP structures using mass spectrometry approaches. Previous reports indicated that PAP glycosylation at Asn-301 was of the high-mannose type, while it was hypothesized that the Asn-188 site contained complex-type glycans and the Asn-62 site contained non-complex structures9. Our results confirm that high-mannose glycoforms are present at the Asn-301 site, with the presence of Man6 and Man7 glycans observed for this site. Based on the data summarized in Table 3, we have found that sialylated complex-type glycans occupy the site at Asn-62, with bi- and tri-antennary structures present. The glycans attached to Asn-188 are less defined, but the preliminary results indicate a larger glycan constituent, most likely the tetra-antennary complex sialylated and fucosylated structures observed in the characterization studies (Table 2). Clearly, application of alternative proteases besides trypsin could better clarify the glycopeptide constituents of the Asn-188 site. Emerging improvements in computer programs like SimGlycan (Applied Biosystems/PremierBiosoft) that allow annotation of large complex glycan constituents will also facilitate this characterization. Conversely, the HPLC and MALDI-TOF profiling indicated the presence of truncated glycan species predominantly in the prostate cancer samples. Their further characterization at the structural level, as well as their site of attachment, could lead to specific PAP glycan biomarker assays. Additionally, the described purification and analysis approaches for both PAP and PSA glycans are compatible with emerging quantitative isotope labeling strategies34. Missing for both PAP and PSA are any determinations of the anomeric linkages for the different glycan species, as linkage differences and positions of the sialic acid residues in particular could dictate biological and clinical differences. The permethylation strategies already utilized are equally valid for providing PSA and PAP glycans for more detailed MS/MSn structural characterization approaches35, 36, and these are currently ongoing in our laboratories.

The cumulative glycan structural information from PSA and PAP is being used in a prostate cancer biomarker “pipeline” to develop specific lectin-ELISA assays33 targeting fucosylation and sialylation differences, as well as targeted SRM and/or multiple reaction monitoring (MRM) assays in proximal prostatic fluids. These approaches are particularly advantageous for the analysis of many individual seminal plasma samples, as well as other proximal prostatic fluids termed expressed prostatic secretions (EPS) being collected for molecular genetic biomarker assays37, 38. Expressed prostatic secretions are collected in voided urine following a standard urological digital rectal exam combined with prostate massage, and analysis of their glycoprotein constituents could complement and extend results reported in seminal plasma. In conclusion, there are multiple glycan targets of potential clinical relevance that warrant continued structural analysis of PAP and PSA glycopeptide species. The use of seminal plasma derived proteins will continue to facilitate this characterization, and can also be readily adapted to other clinical relevant proximal fluids of the prostate.

Acknowledgments

This work was funded in part by NIH/NCI grant 2U01 CA98028 (OJS)

References

  • 1.Gann PH, Hennekens CH, Stampfer MJ. A prospective evaluation of plasma prostate-specific antigen for detection of prostatic cancer. Jama. 1995;273(4):289–94. [PubMed] [Google Scholar]
  • 2.Chan DW, Sokoll LJ. Prostate-specific antigen: update 1997. J Int Fed Clin Chem. 1997;9(3):120–5. [PubMed] [Google Scholar]
  • 3.Partin AW, Oesterling JE. The clinical usefulness of percent free-PSA. Urology. 1996;48(6A Suppl):1–3. doi: 10.1016/s0090-4295(96)00602-4. [DOI] [PubMed] [Google Scholar]
  • 4.Wilkinson BA, Hamdy FC. State-of-the-art staging in prostate cancer. BJU Int. 2001;87(5):423–30. doi: 10.1046/j.1464-410x.2001.02146.x. [DOI] [PubMed] [Google Scholar]
  • 5.Makarov DV, Carter HB. The discovery of prostate specific antigen as a biomarker for the early detection of adenocarcinoma of the prostate. J Urol. 2006;176(6 Pt 1):2383–5. doi: 10.1016/j.juro.2006.08.019. [DOI] [PubMed] [Google Scholar]
  • 6.Han M, Piantadosi S, Zahurak ML, Sokoll LJ, Chan DW, Epstein JI, Walsh PC, Partin AW. Serum acid phosphatase level and biochemical recurrence following radical prostatectomy for men with clinically localized prostate cancer. Urology. 2001;57(4):707–11. doi: 10.1016/s0090-4295(00)01073-6. [DOI] [PubMed] [Google Scholar]
  • 7.Moul JW, Connelly RR, Perahia B, McLeod DG. The contemporary value of pretreatment prostatic acid phosphatase to predict pathological stage and recurrence in radical prostatectomy cases. J Urol. 1998;159(3):935–40. [PubMed] [Google Scholar]
  • 8.Stamey TA, Yang N, Hay AR, McNeal JE, Freiha FS, Redwine E. Prostate-specific antigen as a serum marker for adenocarcinoma of the prostate. N Engl J Med. 1987;317(15):909–16. doi: 10.1056/NEJM198710083171501. [DOI] [PubMed] [Google Scholar]
  • 9.Jakob CG, Lewinski K, Kuciel R, Ostrowski W, Lebioda L. Crystal structure of human prostatic acid phosphatase. Prostate. 2000;42(3):211–8. doi: 10.1002/(sici)1097-0045(20000215)42:3<211::aid-pros7>3.0.co;2-u. [DOI] [PubMed] [Google Scholar]
  • 10.Menez R, Michel S, Muller BH, Bossus M, Ducancel F, Jolivet-Reynaud C, Stura EA. Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody. J Mol Biol. 2008;376(4):1021–33. doi: 10.1016/j.jmb.2007.11.052. [DOI] [PubMed] [Google Scholar]
  • 11.Couldrey C, Green JE. Metastases: the glycan connection. Breast Cancer Res. 2000;2(5):321–3. doi: 10.1186/bcr75. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Dwek MV, Ross HA, Leathem AJ. Proteome and glycosylation mapping identifies post-translational modifications associated with aggressive breast cancer. Proteomics. 2001;1(6):756–62. doi: 10.1002/1615-9861(200106)1:6<756::AID-PROT756>3.0.CO;2-X. [DOI] [PubMed] [Google Scholar]
  • 13.Fukuda M. Cell surface glycoconjugates as onco-differentiation markers in hematopoietic cells. Biochim Biophys Acta. 1985;780(2):119–50. doi: 10.1016/0304-419x(84)90002-7. [DOI] [PubMed] [Google Scholar]
  • 14.Dennis JW, Laferte S, Waghorne C, Breitman ML, Kerbel RS. Beta 1–6 branching of Asn-linked oligosaccharides is directly associated with metastasis. Science. 1987;236(4801):582–5. doi: 10.1126/science.2953071. [DOI] [PubMed] [Google Scholar]
  • 15.Belanger A, van Halbeek H, Graves HC, Grandbois K, Stamey TA, Huang L, Poppe I, Labrie F. Molecular mass and carbohydrate structure of prostate specific antigen: studies for establishment of an international PSA standard. Prostate. 1995;27(4):187–97. doi: 10.1002/pros.2990270403. [DOI] [PubMed] [Google Scholar]
  • 16.Armbruster DA. Prostate-specific antigen: biochemistry, analytical methods, and clinical application. Clin Chem. 1993;39(2):181–95. [PubMed] [Google Scholar]
  • 17.Peracaula R, Tabares G, Royle L, Harvey DJ, Dwek RA, Rudd PM, de Llorens R. Altered glycosylation pattern allows the distinction between prostate-specific antigen (PSA) from normal and tumor origins. Glycobiology. 2003;13(6):457–70. doi: 10.1093/glycob/cwg041. [DOI] [PubMed] [Google Scholar]
  • 18.Prakash S, Robbins PW. Glycotyping of prostate specific antigen. Glycobiology. 2000;10(2):173–6. doi: 10.1093/glycob/10.2.173. [DOI] [PubMed] [Google Scholar]
  • 19.Okada T, Sato Y, Kobayashi N, Sumida K, Satomura S, Matsuura S, Takasaki M, Endo T. Structural characteristics of the N-glycans of two isoforms of prostate-specific antigens purified from human seminal fluid. Biochim Biophys Acta. 2001;1525(1–2):149–60. doi: 10.1016/s0304-4165(00)00182-3. [DOI] [PubMed] [Google Scholar]
  • 20.Mattsson JM, Valmu L, Laakkonen P, Stenman UH, Koistinen H. Structural characterization and anti-angiogenic properties of prostate-specific antigen isoforms in seminal fluid. Prostate. 2008;68(9):945–54. doi: 10.1002/pros.20751. [DOI] [PubMed] [Google Scholar]
  • 21.Tabares G, Jung K, Reiche J, Stephan C, Lein M, Peracaula R, de Llorens R, Hoesel W. Free PSA forms in prostatic tissue and sera of prostate cancer patients: analysis by 2-DE and western blotting of immunopurified samples. Clin Biochem. 2007;40(5–6):343–50. doi: 10.1016/j.clinbiochem.2006.12.006. [DOI] [PubMed] [Google Scholar]
  • 22.Tajiri M, Ohyama C, Wada Y. Oligosaccharide profiles of the prostate specific antigen in free and complexed forms from the prostate cancer patient serum and in seminal plasma: a glycopeptide approach. Glycobiology. 2008;18(1):2–8. doi: 10.1093/glycob/cwm117. [DOI] [PubMed] [Google Scholar]
  • 23.Yoshida KI, Honda M, Arai K, Hosoya Y, Moriguchi H, Sumi S, Ueda Y, Kitahara S. Serial lectin affinity chromatography with concavalin A and wheat germ agglutinin demonstrates altered asparagine-linked sugar-chain structures of prostatic acid phosphatase in human prostate carcinoma. J Chromatogr B Biomed Sci Appl. 1997;695(2):439–43. doi: 10.1016/s0378-4347(97)00186-2. [DOI] [PubMed] [Google Scholar]
  • 24.Kawinski E, Levine E, Chadha K. Thiophilic interaction chromatography facilitates detection of various molecular complexes of prostate-specific antigen in biological fluids. Prostate. 2002;50(3):145–53. doi: 10.1002/pros.10042. [DOI] [PubMed] [Google Scholar]
  • 25.Block TM, Comunale MA, Lowman M, Steel LF, Romano PR, Fimmel C, Tennant BC, London WT, Evans AA, Blumberg BS, Dwek RA, Mattu TS, Mehta AS. Use of targeted glycoproteomics to identify serum glycoproteins that correlate with liver cancer in woodchucks and humans. Proc Natl Acad Sci U S A. 2005;102(3):779–84. doi: 10.1073/pnas.0408928102. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Mehta A, Carrouee S, Conyers B, Jordan R, Butters T, Dwek RA, Block TM. Inhibition of hepatitis B virus DNA replication by imino sugars without the inhibition of the DNA polymerase: therapeutic implications. Hepatology. 2001;33(6):1488–95. doi: 10.1053/jhep.2001.25103. [DOI] [PubMed] [Google Scholar]
  • 27.Guile GR, Rudd PM, Wing DR, Prime SB, Dwek RA. A rapid high-resolution high-performance liquid chromatographic method for separating glycan mixtures and analyzing oligosaccharide profiles. Anal Biochem. 1996;240(2):210–26. doi: 10.1006/abio.1996.0351. [DOI] [PubMed] [Google Scholar]
  • 28.Ciucanu I, Kerek F. A simple and rapid method for the permethylation of carbohydrates. Carbohydrate Research. 1984;131:209–217. [Google Scholar]
  • 29.Ceroni A, Dell A, Haslam SM. The GlycanBuilder: a fast, intuitive and flexible software tool for building and displaying glycan structures. Source Code Biol Med. 2007;2:3. doi: 10.1186/1751-0473-2-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Sandra K, Devreese B, Van Beeumen J, Stals I, Claeyssens M. The Q-Trap mass spectrometer, a novel tool in the study of protein glycosylation. J Am Soc Mass Spectrom. 2004;15(3):413–23. doi: 10.1016/j.jasms.2003.11.003. [DOI] [PubMed] [Google Scholar]
  • 31.Carr SA, Huddleston MJ, Bean MF. Selective identification and differentiation of N- and O-linked oligosaccharides in glycoproteins by liquid chromatography-mass spectrometry. Protein Sci. 1993;2(2):183–96. doi: 10.1002/pro.5560020207. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Tabares G, Radcliffe CM, Barrabes S, Ramirez M, Aleixandre RN, Hoesel W, Dwek RA, Rudd PM, Peracaula R, de Llorens R. Different glycan structures in prostate-specific antigen from prostate cancer sera in relation to seminal plasma PSA. Glycobiology. 2006;16(2):132–45. doi: 10.1093/glycob/cwj042. [DOI] [PubMed] [Google Scholar]
  • 33.Mehta AS, Long RE, Comunale MA, Wang M, Rodemich L, Krakover J, Philip R, Marrero JA, Dwek RA, Block TM. Increased levels of galactose-deficient anti-Gal immunoglobulin G in the sera of hepatitis C virus-infected individuals with fibrosis and cirrhosis. J Virol. 2008;82(3):1259–70. doi: 10.1128/JVI.01600-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Atwood JA, 3rd, Cheng L, Alvarez-Manilla G, Warren NL, York WS, Orlando R. Quantitation by isobaric labeling: applications to glycomics. J Proteome Res. 2008;7(1):367–74. doi: 10.1021/pr070476i. [DOI] [PubMed] [Google Scholar]
  • 35.Prien JM, Huysentruyt LC, Ashline DJ, Lapadula AJ, Seyfried TN, Reinhold VN. Differentiating N-linked glycan structural isomers in metastatic and nonmetastatic tumor cells using sequential mass spectrometry. Glycobiology. 2008;18(5):353–66. doi: 10.1093/glycob/cwn010. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Wuhrer M, Catalina MI, Deelder AM, Hokke CH. Glycoproteomics based on tandem mass spectrometry of glycopeptides. J Chromatogr B Analyt Technol Biomed Life Sci. 2007;849(1–2):115–28. doi: 10.1016/j.jchromb.2006.09.041. [DOI] [PubMed] [Google Scholar]
  • 37.Hessels D, Smit FP, Verhaegh GW, Witjes JA, Cornel EB, Schalken JA. Detection of TMPRSS2-ERG fusion transcripts and prostate cancer antigen 3 in urinary sediments may improve diagnosis of prostate cancer. Clin Cancer Res. 2007;13(17):5103–8. doi: 10.1158/1078-0432.CCR-07-0700. [DOI] [PubMed] [Google Scholar]
  • 38.Laxman B, Morris DS, Yu J, Siddiqui J, Cao J, Mehra R, Lonigro RJ, Tsodikov A, Wei JT, Tomlins SA, Chinnaiyan AM. A first-generation multiplex biomarker analysis of urine for the early detection of prostate cancer. Cancer Res. 2008;68(3):645–9. doi: 10.1158/0008-5472.CAN-07-3224. [DOI] [PMC free article] [PubMed] [Google Scholar]

RESOURCES