Antimicrobial Peptoids Are Effective against Pseudomonas aeruginosa Biofilms^,

Abstract

The resistance of biofilms to conventional antibiotics complicates the treatment of chronic cystic fibrosis (CF). We investigated the effects of peptoids, peptides, and conventional antibiotics on the biomass and cell viability within Pseudomonas aeruginosa biofilms. At their MICs, peptoids 1 and 1-C13_4mer caused maximum reductions in biomass and cell viability, respectively. These results suggest that peptoids of this class could be worth exploring for the treatment of pulmonary infections occurring in CF patients.

TEXT

Pseudomonas aeruginosa is one of most fatal known pathogens, causing 200,000 hospital-acquired infections annually in the United States (17). More than 80% of cystic fibrosis (CF) patients are infected by P. aeruginosa (13, 26), and chronic CF infections result from the formation of P. aeruginosa biofilms in the lung (14, 27). The current standard of care for the treatment of P. aeruginosa infections is long-term use of antibiotics in combination (12). The frequent use of antibiotics has led to the widespread emergence of multidrug-resistant Pseudomonas strains, exacerbating the overall problem (4, 6). The high prevalence of antibiotic resistance has created a pressing need to discover pharmaceutical candidates that could replace or complement current therapies.

Antimicrobial peptides (AMPs) are integral components of the innate host defense mechanism in many organisms (11). Unlike conventional antibiotics, AMPs seem to function through a nonspecific mechanism (3), and the failure of bacteria to evolve resistance to AMPs is believed to be attributable to this generalized mechanism of action (11, 23). Although AMPs seem promising as therapeutics to treat bacterial infections, many peptides have low bioavailability (11). Efforts to ameliorate these biostability disadvantages have prompted the design, synthesis, and use of nonnatural mimics of AMPs (2, 3, 5, 24, 25, 28, 29). Oligo-N-substituted glycines (peptoids) are isomers of peptides, with side chains attached to the backbone nitrogen rather than the α-carbon (22, 32). This structural difference makes them highly resistant to protease activity and reduces the likelihood of immunogenicity (15, 20). In this study, we investigated the activities of seven different peptoids and two AMPs, relative to those of three conventional antibiotics, against planktonic cells and biofilms of P. aeruginosa (strain PA 14).

The selected peptoids (Table 1; Fig. 1) are analogues of our lead compound and positive control, an amphipathic and cationic dodecamer peptoid, peptoid 1, known to have good activity against planktonic bacteria; in contrast, peptoid 1-(S)-N-(sec-butyl) glycine (Nssb) is almost inactive and acts as a negative control (5, 22; A. M. Czyzewski, R. Kapoor, N. P. Chongsiriwatana, M. T. Dohm, S. Vakulenko, S. Mobashery, and A. E. Barron, submitted for publication). Peptoids were synthesized by a solid-phase, submonomer protocol (32); the monomer structures are shown in Fig. 1. All results are presented as averages of results from three independent replicates in three parallel trials. Error bars represent the means ± standard deviations. Statistical differences from the control (without an added antimicrobial) were determined by one-way analysis of variance (ANOVA) with post hoc testing by the Tukey-Kramer method. Differences were considered statistically significant at a P of <0.001. For detailed materials and methods, see the supplemental material.

Table 1.

Sequences of peptoids, AMPs, and conventional antibiotics and their antimicrobial activities against planktonic PA 14

Peptoid, AMP, or antimicrobial	Sequence (amino to carboxyamide)a	MICb for P. aeruginosa (PA 14) in:
		μM	mg/liter
1	H-(NLys-Nspe-Nspe)4-NH2	12.5	22.7
1-11mer	H-(NLys-Nspe-Nspe)3-NLys-Nspe-NH2	12.5–25	20.7–41.4
1-Pro9	H-(NLys-Nspe-Nspe)2-NLys-Nspe-l-Pro-NLys-Nspe-Nspe-NH2	25–50	43.8–87.6
1-achiral	H-(NLys-Npm-Npm)4-NH2	25	42.6
1-C134mer	H-Ntridec-NLys-Nspe-Nspe-NLys-NH2	12.5–25	10.4–20.8
14mer	H-NLys-Nspe-Nspe-NLys-NH2	>100	>59.5
1-Nssb	H-(NLys-Nssb-Nssb)4-NH2	>100	>143.4
LL-37	[LL-37, 37 aa]	25–50	112.3–224.6
Pexiganan	GIGKFLKKAKKFGKAFVKILKK	12.5–25	30.9–61.8
Ciprofloxacin		0.4	0.1
Tobramycin		1.6	0.7
Kanamycin		>100	>48.4

^aNLys, N-(4-aminobutyl) glycine; Nspe, (S)-N-(1-phenylethyl) glycine; Npm, N-(1-phenylmethyl) glycine; Ntridec, N-(tridecyl) glycine.

^bMICs are represented as the MICs at which no visible growth of bacteria was observed (7). See Fig. 1 for submonomer structures.

Fig. 1.

Peptoid submonomer chemical structures.

Activities of peptoids against planktonic cells.

MICs were determined in accordance with CLSI M7-A6 protocols (Table 1) (5, 7). Ciprofloxacin and tobramycin were active in the low micromolar range, while PA 14 showed a high tolerance to kanamycin (Table 1). Pexiganan and LL-37 were active in the range of 12.5 to 50 μM. Peptoid 1 was active at 12.5 μM, whereas peptoid 1-Nssb was completely inactive. Alkylated peptoid 1-C13_4mer was active in the range of 12.5 to 25 μM, while unalkylated peptoid 1_4mer was ineffective (Table 1). Other variants displayed lower antimicrobial activity than peptoid 1.

Biofilm formation assay.

To determine if peptoids could be used prophylactically to prevent biofilm formation, we spectrophotometrically tested whether peptoids eliminated P. aeruginosa prior to biofilm formation using a crystal violet (CV) staining assay (Fig. 2A and B) (30). Since the MICs of most of the peptoids were in the range of 12.5 to 25 μM, we selected the lower value (12.5 μM) as the threshold of antimicrobial activity. Ciprofloxacin and tobramycin caused an ∼70% reduction in biofilm formation at 4× and 8× their MICs, respectively, and were distinct from kanamycin, which had no effect (Fig. 2A). AMPs showed only an ∼10% reduction in biomass, compared to peptoids 1-Nssb and 1_4mer (Fig. 2B). Peptoids 1 and 1-C13_4mer provided significant reductions in biomass (∼70% and ∼40%, respectively) (Fig. 2A and B). The other peptoids showed activities similar to that of peptoid 1-C13_4mer.

Fig. 2.

Efficacies of antimicrobial peptoids, AMPs, and conventional antibiotics against biofilm formation (A and B) and for the detachment of preexisting P. aeruginosa biofilms (C and D) for two different groups of antimicrobial compounds tested. Prevention of biofilm formation and detachment of existing biofilms are plotted as percent biomass, as analyzed by a crystal violet (CV) staining assay.

Biofilm detachment assay.

Peptoids were evaluated as potential therapeutics for CF by testing their efficacy against preexisting biofilms. The detachment assay was performed by pregrowing the biofilms without the presence of an antibiotic and measuring the biofilm reduction by the CV staining process (Fig. 2C and D) (30). Ciprofloxacin and tobramycin caused reductions of ∼60% and ∼30%, respectively, but AMPs were unable to reduce the biomass of established biofilms (Fig. 2C). Peptoids 1 and 1-C13_4mer impaired existing biofilms by 60% and 40%, respectively (Fig. 2C and D). Other peptoids had activities equivalent to that of peptoid 1-C13_4mer.

Cell viability.

CV staining assays measure total biofilm biomass but provide no information about cell viability (9). To determine whether peptoids were effective in killing the bacterial cells within biofilms, cell viability was measured by bacterial plating (9) at a concentration close to the MIC (12.5 μM) and at a completely lethal concentration (100 μM) (Fig. 3). At 12.5 μM, ciprofloxacin and tobramycin prevented the formation of biofilms by reducing cell viability by ∼3 logs, and kanamycin showed no killing (Fig. 3A). In contrast, LL-37 and pexiganan reduced viability by ∼14% and ∼7%, respectively. Peptoids 1-Nssb and 1_4mer were inactive, whereas peptoids 1 and 1-C13_4mer were active to a significant degree, reducing cell viability by ∼1.5 and ∼3 logs, respectively. Peptoids 1-11_mer, 1-Pro₉, and 1-achiral were less active, yielding an ∼0.5-log reduction in viable cells (Fig. 3A).

Fig. 3.

Effects of antimicrobials (tested at 12.5 and 100 μM) on cell viability in preventing the formation of biofilms (A) and in reducing the established P. aeruginosa (PA 14) biofilms (B). All symbols (∼, #, -, and *) indicate that values for antimicrobials at 12.5 μM are statistically significantly different (P < 0.001) from the value with no antimicrobial (blank). Different symbols indicate a statistically significant difference (P < 0.001) between compounds with two different symbols (e.g., peptoids 1 and 1-C13_4mer) but not between compounds with the same symbol (e.g., ciprofloxacin and tobramycin in panel A). The absence of a symbol indicates no statistically significant difference from the value with no antimicrobial. Statistical significance at 100 μM is not shown.

Like conventional antibiotics, peptoids were less effective in killing bacteria in established biofilms than in killing planktonic bacteria prior to the formation of biofilms (Fig. 3). Ciprofloxacin and tobramycin caused significant ∼2- and ∼1-log decreases in viable cells, respectively, while AMPs had no effect (Fig. 3B). Significant reductions were caused by peptoids 1 (∼1-log decrease) and 1-C13_4mer (∼2-log decrease), whereas peptoids 1-11_mer and 1-Pro₉ were ineffective in killing the cells in established biofilms; finally, peptoid 1-achiral caused ∼0.5-log killing.

It is clear that peptoids prevent biofilm formation by killing planktonic cells that could otherwise contribute to biofilm formation, and peptoid 1 is the most promising agent. Bacterial detachment from the surface by peptoids resulted in biomass reduction. Cationic AMPs and peptoids are known to bind DNA (10, 16, 21), and this binding may facilitate detachment or disruption of otherwise-stable biofilm structures. It has previously been reported that extracellular DNA (eDNA) is involved in cell-cell attachment (1); the development of P. aeruginosa biofilms is disrupted by DNase I (31). Effective biofilm detachment by peptoid 1 relative to that of other peptoids may be due to the inherent oligomerization of peptoid 1 (19; Yoriel Marcano and Annelise Barron, unpublished data). Oligomerization via interactions of aromatic side chains, which is disrupted upon an encounter with an anionic bacterium, would increase the localized concentration of peptoid near the cell membrane, increasing its activity and perhaps contributing to biofilm detachment.

In contrast, peptoid 1-C13_4mer was most efficient in reducing cell viability relative to other peptoids. The hydrophobic tail gives peptoid 1-C13_4mer a surfactant-like nature which may interact strongly with and disrupt the hydrophobic exopolysaccharide matrix, facilitating deeper peptoid penetration into the matrix than that of peptoid 1_4mer, which lacks this tridecyl surfactant tail. Alkylated peptides and peptoids have the potential for micelle formation at the MIC (18), which again, as for peptoid 1, may increase their local concentration when they reach the anionic bacterial cell membrane, if we presume that the cationic micelles spontaneously dissemble after adsorption to the anionic membrane surface.

In this study, we have shown that antimicrobial peptoids reduce the viability of P. aeruginosa (PA 14) biofilms at their MICs, whereas antibiotics showed comparable results only at concentrations 8 to 30 times higher than their MICs (Fig. 3). To the best of our knowledge, this is the first study demonstrating the effects of antimicrobial peptoids against P. aeruginosa biofilms. Peptoids such as those we have tested in this study may prove to be interesting as a novel class of antibiotics, as they act rapidly and seem to be able to overcome the resistance that makes conventional antibiotics less effective against chronic infections.