Skip to main content
Applied and Environmental Microbiology logoLink to Applied and Environmental Microbiology
. 2011 Apr;77(8):2749–2754. doi: 10.1128/AEM.02481-10

Isolation of Lactobacillus salivarius 1077 (NRRL B-50053) and Characterization of Its Bacteriocin, Including the Antimicrobial Activity Spectrum▿

Edward A Svetoch 1, Boris V Eruslanov 1, Vladimir P Levchuk 1, Vladimir V Perelygin 1, Evgeny V Mitsevich 1, Irina P Mitsevich 1, Juri Stepanshin 1, Ivan Dyatlov 1, Bruce S Seal 2, Norman J Stern 2,*
PMCID: PMC3126352  PMID: 21378051

Abstract

Lactobacillus salivarius 1077 (NRRL B-50053) was isolated from poultry intestinal materials, and in vitro anti-Campylobacter jejuni activity was demonstrated. The isolate was then used for bacteriocin production and its enrichment. The protein content of the cell-free supernatant from the spent medium was precipitated by ammonium sulfate and dialyzed to produce the crude antimicrobial preparation. A typical bacteriocin-like response of sensitivity to proteolytic enzymes and resistance to lysozyme, lipase, and 100°C was observed with this preparation. The polypeptide was further purified by gel filtration, ion-exchange, and hydrophobic-interaction chromatography. Matrix-assisted laser desorption ionization–time of flight mass spectrometry (MALDI-TOF MS), Edman degradation, and isoelectrofocusing were used to characterize its 3,454-Da molecular mass, the amino acid sequence of its 37 residue components, and the isoelectric point of pI 9.1 of the bacteriocin. Bacteriocin L-1077 contained the class IIa bacteriocin signature N-terminal sequence YGNGV. MICs of bacteriocin L-1077 against 33 bacterial isolates (both Gram negative and Gram positive) ranged from 0.09 to 1.5 μg/ml. Subsequently, the therapeutic benefit of bacteriocin L-1077 was demonstrated in market-age (40- to 43-day-old) broiler chickens colonized with both C. jejuni and Salmonella enterica serovar Enteritidis. Compared with untreated control birds, both C. jejuni and S. Enteritidis counts in colonized ceca were diminished by >4 log10 and S. Enteritidis counts in both the liver and the spleen of treated birds were reduced by 6 to 8 log10/g compared with those in the nontreated control birds. Bacteriocin L-1077 appears to hold promise in controlling C. jejuni/S. Enteritidis among commercial broiler chickens.

INTRODUCTION

Bacteriocins (BCNs) are low-molecular-weight proteins which are produced by bacterial ribosomes and possess antimicrobial properties (2, 5, 8, 14, 15). These proteins are primarily cationic, hydrophobic, or amphiphilic peptides, with molecular masses of 5 to 6 kDa. Mature bacteriocin antimicrobials are comprised of 20 to 60 amino acids (14, 15). Bacteriocins are produced by widely diverse microorganisms that belong to a variety of systematic groups and occupy various ecological niches. According to a widely accepted classification (8), subclass IIa carries pediocin-like anti-Listeria peptides, which have a conserved N-terminal sequence of YGNGV and one or two cysteine bridges.

Numerous aspects distinguish bacteriocins from antibiotics (2). (i) Bacteriocins are produced on the surface of ribosomes in microbial cells, while antibiotics are primarily secondary metabolites of the cell. (ii) Unlike producers of antibiotics, bacteriocin producers are insensitive to the bactericidal effects. (iii) Bacteriocin molecules may attach to the target cell wall anywhere on the surface, as no specific receptors on the target cell wall apparently exist. (iv) The mechanism of bacteriocin for lethality is versatile and is associated with the process of pore formation in the outer cell membrane. Bacteriocins bind with cell walls of susceptible microbes, cause ionic imbalances, and generate pores. Inorganic ions leak through the pores, thereby killing the target cell. Antibiotics, on the other hand, can inhibit synthesis of the subcellular processes (cell wall synthesis, intracellular protein production, and DNA and RNA replication). (v) Limited resistance of a target cell to bacteriocins develops when the target alters its cell membrane chemical composition.

Bacteriocins have advantages over antibiotics. (i) There is no information suggesting that bacteriocins are toxic for animals or accumulate in tissues. Bacteriocins are susceptible to proteases and should degrade in the host. (ii) Bacteriocins are effective against antibiotic-resistant pathogens (24). (iii) Bacteriocins are already produced in animal hosts by normal microflora and likely have an important role in the kinetics of the microbial ecosystem. (iv) Consumers desire naturally grown and processed foods. A European Union import ban on poultry treated with chlorinated water has been in place since 1997 and has limited imports of United States poultry meat, which is generally treated by this process. Application of bacteriocins would provide an alternative to the chemical disinfection approaches that are presently employed.

This paper describes the discovery, characterization, and effectiveness of a new bacteriocin, L-1077, produced by Lactobacillus salivarius L-1077 (NRRL B-50053). We also demonstrate one potential application of this bacteriocin as a therapeutic agent administered to market-age broiler chickens in drinking water to effectively control both Campylobacter jejuni and Salmonella in the live animal.

MATERIALS AND METHODS

Microbiology.

At a Russian slaughter/processing plant, healthy commercial broiler chickens served as donors of cecal content providing antagonistic flora. These materials were streaked onto lactic acid bacterial (de Man, Rogosa, and Sharpe [MRS]; Difco) agar and incubated within an anaerobic atmosphere overnight at 37°C. Lactobacillus colonies were isolated and identified with the API 50 CHL microtest system (bioMérieux, France). Isolates were grown anaerobically at 37°C overnight to confluence on MRS agar. Agar blocks (∼0.5 cm3) containing the growth were aseptically cut and transferred to brucella agar supplemented with 5% lysed blood seeded with C. jejuni NCTC 11168. Plates were incubated at 42°C under a microaerobic atmosphere for 24 to 48 h. Zones of growth inhibition were noted, and the diameters were measured.

Bacteriocin L-1077 purification.

The isolate produced a zone of inhibition, and Lactobacillus salivarius L-1077 (NRRL B-50053) was isolated for further study. Consistent with methods previously described (21, 25), the BCN was produced and purified to homogeneity. The isolate was fermented overnight in 10% (vol/vol) brucella broth medium under quiescent aerobic conditions maintained at 37°C. The spent culture was centrifuged (10,000 × g, 10 min) to remove the cells. The supernatant was adjusted to pH 6.2 by adding 1 N NaOH and 130 U/ml catalase to remove the influence of organic acids and hydrogen peroxide. Proteins in the cell-free supernatant were precipitated with ammonium sulfate and then dialyzed as previously described (23). The crude preparation was filtered through a 0.22-μm filter (Millipore, Bedford, MA) and further purified by cation-exchange and hydrophobic-interaction chromatographic separations (23).

Bioassays and chemical analyses.

Activities of the chromatographic fractions were initially screened against C. jejuni NCTC 11168. An additional 32 widely diverse, pathogenic bacterial isolates (see Table 2) were tested for MICs (μg/ml). Protein concentrations of the fractions were determined (11). Doubling dilutions of the preparations were performed, and 10 μl of each dilution was spotted onto plates of blood-supplemented brucella agar previously seeded with cells of C. jejuni NCTC 11168 or the additional bacterial isolates, as previously described (23). All assays were conducted in duplicate.

Table 2.

Antimicrobial activities of bacteriocin L-1077 against selected pathogens, as determined with a 10-μl spot testa

Strain no. Test strain MIC of L-1077 (μg/ml)
1 Salmonella Enteritidis 1 0.19
2 Salmonella Enteritidis 4 0.38
3 Salmonella Enteritidis 204 0.38
4 Salmonella Enteritidis 237 0.19
5 Salmonella Choleraesuis 434/4 0.38
6 Salmonella Choleraesuis 370 0.19
7 Salmonella Typhimurium 483/6 0.19
8 Salmonella Typhimurium 44/8 0.19
9 Salmonella Gallinarum-Pullorum 0.19
10 Escherichia coli HB 101 0.19
11 E. coli-600 0.19
12 E. coli O157:H7 Y-63 0.19
13 E. coli O157:H7 G-35 0.19
14 E. coli O157:H7 OD 30 0.19
15 E. coli O157:H7 T lab 39 0.19
16 Yersinia enterocolitica 03 0.76
17 Yersinia enterocolitica 09 0.76
18 Yersinia enterocolitica 11 0.76
19 Citrobacter freundii 0.76
20 Klebsiella pneumoniae 0.76
21 Shigella dysenteriae 0.76
22 Staphylococcus aureus 0.76
23 Staphylococcus epidermidis 0.76
24 Yersinia pseudotuberculosis 4 0.76
25 Yersinia pseudotuberculosis 99/14 0.76
26 Pseudomonas aeruginosa 508 0.38
27 Proteus mirabilis 0.38
28 Morganella morganii 0.38
29 Listeria monocytogenes A 9-72 0.19
30 Proteus vulgaris 7A 1.5
31 Clostridium perfringens 13124 0.7
32 Campylobacter jejuni L-4 0.09
a

Test strains were surface plated onto agar plates, successive one-half-concentration dilutions were spotted onto the plates, and the plates were incubated to determine inhibitory concentrations.

The amino acid sequence of the purified bacteriocin was determined by Edman degradation using a 491 cLC automatic sequencer (6) (Applied Biosystems). The bacteriocin molecular weight was determined by mass spectrometry (MS) using a Voyager-DERP mass spectrometer (Perkin-Elmer). The matrix-assisted laser desorption ionization–time of flight (MALDI-TOF) analysis was performed per the manufacturer's instructions. After the biochemical determination of the primary amino acid sequence, the physical characteristics were analyzed utilizing the Protean function of DNAStar (Madison, WI) (13). The primary amino acid sequence was entered into the BLAST database (1) to search for proteins with similar sequences.

Chicken challenges.

Purified bacteriocin was diluted in tap water to provide 25, 12.5, or 6.25 mg or no bacteriocin L-1077/liter in the experimental bird drinking waters. We obtained commercial-age birds which had already been colonized by C. jejuni through field exposure. The 43-day-old birds were challenged with an 0.2-ml suspension of ∼1010 to 1011 CFU of Salmonella enterica serovar Enteritidis 92 Rifr. The rifampin-resistant S. Enteritidis isolate had been created by sequential passage on media containing increasing levels of rifampin. Strain S. Enteritidis 92 Rifr was cultured overnight in Endo's medium containing 100 μg/ml rifampin. The birds were provided feed and water ad libitum. The three treated groups of broilers were provided one of the three levels of bacteriocin L-1077 per liter in drinking water for 3 days. In the second therapeutic trial, groups of 40-day-old broilers, commercially colonized with C. jejuni and challenged with S. Enteritidis 92 Rifr, were treated for 1, 2, or 3 days with 12.5 mg bacteriocin L-1077/liter in their drinking water.

Microbiological sampling.

At designated times (after day 1, 2, or 3 of treatment), groups of broilers were sacrificed and weighed. The average weights of all the birds within each group together with the amount of water that they consumed were used to estimate the total average amount of bacteriocin provided to the groups of broilers. The birds were dissected to aseptically remove the ceca, livers, and spleens of the animals. The chilled tissues were returned directly to the laboratory and were subjected to 10-fold serial dilutions and plated onto the following media and conditions: (i) MRS agar for 24 h at 37°C anaerobically, (ii) Campy-Cefex agar (19) for 48 h at 42°C microaerobically, or (iii) Endo agar plus 100 μg rifampin/ml for 24 h at 37°C aerobically, to estimate levels of lactic acid bacteria, C. jejuni, and S. Enteritidis, respectively.

RESULTS

After ammonium sulfate protein precipitation of the fermentation culture supernatant, bacteriocin L-1077 activity was low and the protein concentration was relatively high (Table 1). Each succeeding purification step increased the specific activity against C. jejuni and reduced the contaminating nonbacteriocin proteins. A 95.7% purity of the bacteriocin was ultimately achieved, and the specific activity was 229,000 absorbance units (AU)/mg of protein. This purified material was subjected to polyacrylamide gel electrophoresis (PAGE; data not shown) to further purify the molecule. The peptide band was then subjected to Edman degradation, and the characteristic YGNGV consensus sequence typical of class IIa bacteriocin was observed for bacteriocin L-1077. The MALDI-TOF mass spectrometry (MS) analysis indicated the molecular mass of bacteriocin L-1077 as 3,454 Da with an isoelectric point of pI 9.1. The chemically determined molecular mass and pI are in relatively close agreement with the predicted values of 4,000 Da and 9.8, respectively, based on the amino acid sequence of bacteriocin L-1077. The amino acid sequence is TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT. The bacteriocin is composed of 15 hydrophobic residues (A, I, L, F, and V) and 9 polar residues (N, Q, T, and Y) with one acidic (D) and four basic (K and R) amino acids. Bacteriocin L-1077 is predicted to have a charge of 2.91 at a pI of 7. The interior of the peptide from residues 9 through 25 is hydrophobic while the N-terminal and C-terminal regions are hydrophilic. No peptides similar to bacteriocin L-1077 were discovered following BLAST analyses.

Table 1.

Biochemical purification of bacteriocin L-1077 using specified procedures

Sample purification step Protein (mg/ml) Sp act (AU/mg protein) against C. jejuni Purity (%)
Culture supernatant 1.3 435 0
Gel filtration on Superose 12 HR 10/30 0.02 80,000 13.3
Binding to SP-Sepharose FF 0.015 107,000 76.4
Hydrophobic-interaction chromatography on Phenyl Sepharose 6 Fast Flow 0.007 229,000 95.7

The MIC values observed for the 32 pathogenic bacteria tested ranged from 0.09 to 1.5 μg/ml (Table 2). The wide genetic panorama among these tested susceptible isolates is significant. Many of the Gram-negative isolates tested approached the lower MIC values which are reported, but the Gram-positive Listeria monocytogenes, Staphylococcus, and Clostridium perfringens isolates also manifested sensitivities similar to that of bacteriocin L-1077. Each of the isolates tested represents consequential etiologic agents causing a variety of human diseases or pathological poultry and livestock infections (9, 17).

The therapeutic value of bacteriocin L-1077 in broilers infected with C. jejuni and Salmonella Enteritidis 92 Rifr is represented in Tables 3 and 4. The data from the first experiment are presented in Table 3 and demonstrate the effectiveness of dosing birds with 5.5 to 21.3 mg/bird for 3 days to dramatically reduce both agents. The broilers weighed approximately 2 kg when the samples were taken. In this experiment, the nontreated control birds were intestinally colonized by C. jejuni in excess of 106 CFU/g and by S. Enteritidis 92 Rifr in excess of 108 CFU/g of cecal content. Both the liver and spleen parenchymal organs of these birds were colonized by S. Enteritidis 92 Rifr at ≥108 CFU/g. The lactic acid bacteria were present at ≥108.5 CFU/g of cecal content. In the group of birds provided 21 mg bacteriocin, C. jejuni was not detected in the ceca of any of the experimental broiler group. Likewise, the presence and levels of S. Enteritidis 92 Rifr in the ceca, livers, and spleens of these treated birds were dramatically reduced compared with those in the positive-control group of broilers.

Table 3.

Therapeutic effects of 3-day BCN L-1077 treatments, of various concentrations, against a mixed infection of Campylobacter jejuni and Salmonella Enteritidis 92 Rifr in 43-day-old broilersa

Chicken group (conditions) Broiler BCN dose (mg/bird) Log10 CFU/g organ homogenate (after treatment)
Lactic acid bacteria in cecal content C. jejuni
S. Enteritidis
Liver Spleen Liver Spleen
Control group (commercial feed; bacteriocin-free water) 1 0 6.79 4.86 8.65 8.60 8.60
2 6.79 4.26 8.08 8.49 8.46
3 8.57 4.80 8.56 7.90 8.28
4 8.45 7.48 8.38 7.85 8.36
5 8.11 5.26 8.46 8.52 8.59
6 8.40 7.36 8.32 8.60 8.43
Avg (no. of birds averaged) 7.85 (6) 6.96 (6) 8.45 (6) 8.41 (6) 8.46 (6)
Exptl group 1 (commercial feed; 25 mg bacteriocin L-1077/liter) 7 21.3 8.15 NDb ND ND 4.61
8 8.15 ND 4.15 4.23 ND
9 8.76 ND 3.81 ND ND
10 7.56 ND ND ND ND
11 8.60 ND ND ND ND
12 7.30 ND ND ND ND
13 8.30 ND 2.76 ND ND
14 7.28 ND 2.60 ND ND
Avg (no. of birds averaged) 8.28 (8) ND (8) ND (4), 2.69 (2), 3.81 (1), 4.15 (1) ND (7), 4.23 (1) ND (7), 4.61 (1)
Exptl group 2 (commercial feed and water with 12.5 mg BCN L-1077/liter) 15 10.9 8.46 ND ND 3.43 ND
16 7.60 ND ND ND ND
17 8.95 ND ND ND ND
18 8.81 ND 2.81 ND ND
19 8.04 ND ND ND ND
20 6.85 ND ND ND ND
21 7.77 ND ND ND 1.95
22 8.08 ND 2.34 ND ND
Avg (no. of birds averaged) 8.43 (8) ND (8) ND (6), 2.63 (2) ND (7), 3.43 (1) ND (7), 1.95 (1)
Exptl group 3 (commercial feed and water with 6.25 mg BCN L-1077/liter) 23 5.5 7.30 ND ND ND ND
24 8.11 ND ND ND ND
25 8.69 ND ND ND ND
26 6.52 ND 3.08 ND ND
27 8.60 ND 4.11 4.23 4.28
28 9.26 ND 3.34 4.46 4.43
29 8.30 ND 3.38 4.32 4.23
30 7.83 ND ND 4.32 4.15
Avg (no. of birds averaged) 8.59 (8) ND (8) ND (4), 3.28 (3), 4.11 (1) ND (4), 4.34 (4) ND (4), 4.28 (4)
a

All birds were commercially colonized with nonspecified C. jejuni.

b

ND, none detected; detection limit of >100 cells.

Table 4.

Therapeutic effects of 1 to 3 days of BCN L-1077 (12.5 mg/liter) treatment against a mixed infection of Campylobacter jejuni and Salmonella Enteritidis 92 Rifr in 40- to 42-day-old broilersa

Chicken group (conditions) Broiler Bacteriocin dose (mg/bird) Log10 CFU/g organ homogenate (after treatment)
Lactic acid bacteria in cecal content C. jejuni
S. Enteritidis
Liver Spleen Liver Spleen
C. jejuni- and Salmonella Enteritidis-colonized, untreated control birds 1 0 8.48 7.00 8.34 8.41 8.61
2 8.36 6.04 8.08 8.66 8.73
3 8.68 3.30 8.41 8.36 8.41
4 8.13 6.30 8.26 8.40 8.41
5 8.20 5.36 7.79 8.32 8.15
6 8.30 8.08 7.78 8.59 8.32
Avg (no. of birds averaged) 8.53 (6) 7.15 (6) 8.18 (6) 8.48 (6) 8.48 (6)
C. jejuni and Salmonella Enteritidis colonized (treated for 1 day with bacteriocin L-1077) 7 3.75 8.85 3.89 NDb 6.43 6.48
8 6.74 ND ND 3.54 3.85
9 7.68 ND 3.26 3.71 3.78
10 9.00 3.81 3.57 6.54 6.89
11 7.56 3.95 ND 6.81 6.45
12 8.84 2.65 3.72 6.60 6.74
13 8.76 3.74 ND 6.90 6.91
14 8.34 ND 3.15 6.79 6.40
Avg (no. of birds averaged) 8.61 (8) ND (3), 2.65 (1), 3.86 (4) ND (4), 3.48 (4) 3.63 (2), 6.71 (6) 3.82 (2), 6.69 (6)
C. jejuni and Salmonella Enteritidis colonized (treated for 2 days with bacteriocin L-1077) 15 7.5 8.70 3.04 ND ND 3.49
16 8.91 3.57 ND 3.56 ND
17 8.77 3.83 ND 3.28 3.40
18 9.18 3.76 ND 3.40 3.23
19 7.68 3.54 ND 3.62 3.46
20 8.99 2.98 ND 3.30 3.32
21 8.66 3.82 ND 3.71 3.43
22 9.04 3.34 2.08 3.18 3.18
Avg (no. of birds averaged) 8.88 2.98 (1), 3.62 (7) ND (7), 2.08 (1) ND (1), 3.48 (7) ND (1), 3.38 (7)
C. jejuni and Salmonella Enteritidis colonized (treated for 3 days with bacteriocin L-1077) 23 11.25 8.08 3.0 ND ND ND
24 7.67 2.79 ND ND ND
25 8.00 ND ND ND ND
26 8.65 3.60 ND ND 3.23
27 7.87 3.23 2.15 3.41 3.15
28 8.75 3.43 ND ND ND
29 9.32 3.40 ND ND ND
30 8.81 3.18 ND ND ND
Avg (no. of birds averaged) 8.71 (8) ND (1), 2.79 (1), 3.34 (6) ND (7), 2.15 (1) ND (7), 3.41 (1) ND (6), 3.19 (2)
a

Birds were challenged and colonized with 1.3 × 1010 CFU of S. Enteritidis 92 Rifr. All birds were commercially colonized with nonspecified C. jejuni.

b

ND, none detected; detection limit of >100 cells.

In the final experiment, commercial market-age birds already colonized with C. jejuni were also challenged and colonized with S. Enteritidis 92 Rifr. Groups of broilers were treated with 12.5 mg bacteriocin L-1077/liter of drinking water over a 3-day study period (Table 4). A 4-log10 reduction in numbers of C. jejuni within the cecal contents was observed in each group over the 3 days of treatment. Salmonella Enteritidis was similarly reduced by >4 log10 in the ceca after 1 day of treatment and further reduced with two additional days of bacteriocin treatment to nearly nondetectable levels. Three- to 4-log10 S. Enteritidis reductions were observed in both the liver and the spleen samples after only 1 day of bacteriocin treatment, and further reductions occurred with each additional day of treatment, approaching nondetectable levels after 3 days of treatment. Finally, the lactic acid bacterial counts in the ceca of the treated birds were approximately the same as those observed in the control group or even had increases in cell densities of this general bacterial grouping within the tissue.

DISCUSSION

It is imperative to develop new innovative approaches for controlling food-borne bacterial disease-causing agents with the widely observed increase in antibiotic resistance among all bacterial groups (7, 12). Consequently, our research has focused on a search for new antimicrobials with emphasis on bacteriocins, antimicrobial peptides produced by generally recognized as safe (GRAS) bacterial entities (10, 21, 23). These bacteriocins could be utilized to control bacterial pathogens in poultry and potentially have positive physiological effects on avian gut morphology (3). The bacteriocin L-1077 can be classified as a class IIa pediocin-like antimicrobial peptide that contains the amino acid sequence YGNGV motif but lacks the XCXXXXVXV sequences with no C and V downstream residues. Consequently, L-1077 contains the hydrophilic, cationic N-terminal “pediocin box” region that is hypothesized to be the cell wall binding portion of the molecule (4). Although L-1077 has the YGNGV motif and a structure similar to those of other class II bacteriocins, it was not recognized as being similar to other peptides in the databases by BLAST analysis. Consequently, this is another novel peptide.

As with each of our four previously reported bacteriocins, substantial reductions (>4 log10 CFU) of Salmonella Enteritidis and/or Campylobacter jejuni in broiler ceca were therapeutically mediated by these four antimicrobial peptides (10, 20, 21, 23). The selected bacteriocin-producing organisms were produced by Gram-positive Paenibacillus polymyxa, Lactobacillus salivarius, Enterococcus durans/faecium/hirae group, and Enterococcus faecium isolates. Each isolate, derived from healthy adult broiler chicken intestinal material, was initially selected because of anti-Campylobacter activity. As C. jejuni is a Gram-negative organism which does not use carbohydrates as its energy source, the selective medium employed contained limited (0.1% glucose) amounts of sugar, and this precluded organic acid production as the mechanism for Campylobacter inhibition. Using this physiologic tool, our group has been able to select and identify unique bacteriocin-producing isolates. As directly fed, live bacteria, these isolates have been unable to therapeutically control C. jejuni in the gut, but the purified bacteriocin elicited the desired control mechanism required to mediate favorable control (22). We have learned that one mechanism for C. jejuni control in the live broiler is independent of the antagonistic cell and, rather, appears to be primarily dependent on the secreted and purified bacteriocin.

The MIC values listed in Table 2 indicated the high potency of bacteriocin L-1077. Campylobacter jejuni L-4 was the most sensitive isolate tested, with a MIC of 0.09 μg/ml, and Proteus vulgaris 7A was the least sensitive of the isolates tested, at a highly acceptable MIC of 1.5 μg/ml. The pathogens tested manifest their virulence in both gastrointestinal and systemic infections. The Shiga-like toxin expressed by the isolates of Escherichia coli O157:H7 might initially be established within the intestinal tract, and the toxin might subsequently cause a more disseminated pathology. Salmonella serovar Enteritidis and Salmonella enterica serovar Choleraesuis will initially colonize the gastrointestinal (GI) tract of poultry and swine, respectively, but then translocate to infect the parenchymal organs of the host. The other pathogens have their unique mechanisms and sites of infection. Therefore, as observed with the S. Enteritidis 92 Rifr strain in our chicken experiments, the BCN treatment dramatically reduced extraintestinal infections associated with the low MIC values. There appears to be an association of low MIC values with in vivo therapeutic control of bacterial infections with bacteriocin L-1077. Further application of bacteriocin to other bacterial infections in vivo remains to be explored. In our rudimentary attempts to extend BCN applications, we have shown modest therapeutic success against Mycobacterium tuberculosis using a mouse model (18). Further refinement in the delivery of bacteriocins to various sites of infection will be required.

Data were obtained with a young broiler chicken model. The data in Table 3 are derived from an experiment in which we provided different concentrations of bacteriocin L-1077 to infected broilers over a 3-day treatment. Table 4 provides data for a similar experiment in which a single fixed quantity of bacteriocin (25 mg/liter) was administered in drinking waters. These birds were sacrificed at daily intervals after 1 to 3 days of treatment. All levels of treatment greatly reduced the systemic S. Enteritidis infections (Table 3), as did all durations of treatment (Table 4). These observations are notable because bacteriocin was able to survive the acidic GI tract environment and protease activities within the intestinal tract and penetrate the intestinal wall following oral ingestion. Perhaps the bacteriocin was transported (likely through the blood) to the spleen and liver where the S. Enteritidis infection was prominent. The bacteriocin may also have triggered an immune response of the chicken to better control the pathogen. The orally administered bacteriocin was able to induce its bactericidal activity in those two organs as well as in the cecum. The bactericidal influence upon C. jejuni within the GI tract was less pronounced than what was seen for both C. jejuni L-4 and NCTC 11168 isolates under in vitro conditions. The C. jejuni infections acquired during commercial production contained isolates more resistant than the laboratory isolates. Thus, we observed only 4-log10 reductions as reported in Table 4 while the birds enrolled in the trial, reported in Table 3, showed reductions to nondetectable levels of C. jejuni. Reductions of 3 log10 on processed poultry are postulated to substantially reduce human health risks for Campylobacter (16). The lactic acid bacteria are widely considered to provide a beneficial component to the intestinal profile found in the healthy warm-blooded host, which may have also contributed to infection control. We did not explore whether the bacteriocin treatment killed individual isolates among the lactic acid bacterial category, but we did observe that quantitative influences of bacteriocin provided only increased levels of lactic acid bacteria. Even if some of these organisms were killed by the bacteriocin treatment, the resistant portion of this bacterial group was able to quickly replace that part of the microflora.

We describe the isolation of a C. jejuni antagonist, L. salivarius isolate L-1077, that produced bacteriocin L-1077. The bacteriocin was purified and characterized as an antimicrobial polypeptide 37 amino acids in length with a 3,454-Da molecular mass. The isoelectric point of bacteriocin L-1077 was pI 9.1, and its nitrogen-terminal amino acid sequence of YGNGV was indicative of its class IIa bacteriocin assignment. MICs of bacteriocin L-1077 against 33 Gram-negative and Gram-positive bacterial isolates ranged from 0.09 to 1.5 μg/ml. The therapeutic benefit of bacteriocin L-1077 was demonstrated in market-age broiler chickens colonized with both C. jejuni and Salmonella Enteritidis. Compared with untreated control birds, both C. jejuni and S. Enteritidis counts in colonized ceca were diminished by >4 logs, and S. Enteritidis numbers in both the liver and the spleen of treated birds were reduced by 6 to 8 logs/g below those in the nontreated control birds. Bacteriocin L-1077 appears to hold promise to control C. jejuni/S. Enteritidis in commercial broiler chickens.

ACKNOWLEDGMENTS

This work was supported by the United States Department of State, the Russian Federation State Research Center for Applied Microbiology (SRCAM), United States Department of Agriculture-Agricultural Research Service (USDA-ARS) CRIS project Interventions and Methodologies to Reduce Human Food-Borne Bacterial Pathogens in Chickens 6612-32000-046-00, and International Science and Technology Center (ISTC) project 1720.

Approval for the conduct of these experiments was provided by the Institutional Animal Care and Use Committee (PMS-03-03, “Control of Campylobacter in Poultry Production”).

Footnotes

▿

Published ahead of print on 4 March 2011.

REFERENCES

  • 1. Altschul S. F., et al. 1997. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25:3389–3402 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2. Cleveland J., Montville T. J., Nes I. F., Chikindas M. L. 2001. Bacteriocins: safe, natural antimicrobials for food preservation. Int. J. Food Microbiol. 71:1–20 [DOI] [PubMed] [Google Scholar]
  • 3. Cole K., et al. 2006. Bacteriocins reduce Campylobacter colonization and alter gut morphology in turkey poults. Poult. Sci. 85:1570–1575 [DOI] [PubMed] [Google Scholar]
  • 4. Cotter P. D., Hill C., Ross R. P. 2005. Bacteriocins: developing innate immunity for food. Nat. Rev. Microbiol. 3:777–788 [DOI] [PubMed] [Google Scholar]
  • 5. Eijsink V. G. H., et al. 2002. Production of class IIa bacteriocins by lactic acid bacteria: an example of biological warfare and communication. Antonie Van Leeuwenhoek 81:639–654 [DOI] [PubMed] [Google Scholar]
  • 6. Garneau S., Martin N., Vederas J. C. 2002. Two-peptide bacteriocins produced by lactic acid bacteria. Biochimie 84:577–592 [DOI] [PubMed] [Google Scholar]
  • 7. Gyles C. L. 2008. Antimicrobial resistance in selected bacteria from poultry. Anim. Health Res. Rev. 9:149–158 [DOI] [PubMed] [Google Scholar]
  • 8. Klaenhammer T. R. 1993. Genetics of bacteriocins produced by lactic acid bacteria. FEMS Microbiol. Rev. 12:39–85 [DOI] [PubMed] [Google Scholar]
  • 9. Lennette E. H., Balows A., Hausler W. J., Jr., Truant J. P. (ed.). 1980. Manual of clinical microbiology, 3rd ed. American Society for Microbiology, Washington, DC [Google Scholar]
  • 10. Line J. E., et al. 2008. Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and gram-negative bacteria. Antimicrob. Agents Chemother. 52:1094–1100 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11. Lowry O. H., Rosebrough N. J., Farr A. L., Randall R. J. 1951. Protein measurement with the Folin phenol reagent. J. Biol. Chem. 193:265–275 [PubMed] [Google Scholar]
  • 12. Nathan C., Goldberg F. M. 2005. The profit problem in antibiotic R&D. Nat. Rev. Drug Discov. 4:887–891 [DOI] [PubMed] [Google Scholar]
  • 13. Nishikawa K., Nakashima H., Kanehisa M., Ooi T. 1987. Detection of weak sequence homology of proteins for tertiary structure prediction. Protein Seq. Data Anal. 1:107–116 [PubMed] [Google Scholar]
  • 14. Nissen-Meyer J., Nes I. F. 1997. Ribosomally synthesized antimicrobial peptide: their function, structure biogenesis, and mechanism of action. Arch. Microbiol. 167:67–77 [PubMed] [Google Scholar]
  • 15. Riley M. A., Wertz J. E. 2002. Bacteriocins: evolution, ecology and application. Annu. Rev. Microbiol. 56:117–137 [DOI] [PubMed] [Google Scholar]
  • 16. Rosenquist H., Nielsen N. L., Sommer H. M., Nørrun B., Christensen B. B. 2003. Quantitative risk assessment of human campylobacteriosis associated with thermophilic Campylobacter species in chicken. Int. J. Food Microbiol. 83:87–103 [DOI] [PubMed] [Google Scholar]
  • 17. Saif Y. M., et al. 2003. Diseases of poultry, 11th ed. Iowa State University Press, Ames, IA [Google Scholar]
  • 18. Sosunov V., et al. 2007. Antimycobacterial activity of bacteriocins and their complexes with liposomes. J. Antimicrob. Chemother. 59:919–925 [DOI] [PubMed] [Google Scholar]
  • 19. Stern N. J., Wojton B., Kwiatek K. 1992. A differential-selective medium and dry ice-generated atmosphere for recovery of Campylobacter jejuni. J. Food Prot. 55:514–517 [DOI] [PubMed] [Google Scholar]
  • 20. Stern N. J., et al. 2005. Paenibacillus polymyxa purified bacteriocin to control Campylobacter jejuni in chickens. J. Food Prot. 68:1450–1453 [DOI] [PubMed] [Google Scholar]
  • 21. Stern N. J., et al. 2006. Isolation of a Lactobacillus salivarius and purification of its bacteriocin that is inhibitory to Campylobacter jejuni in the chicken gastrointestinal system. Antimicrob. Agents Chemother. 50:3111–3116 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22. Stern N., et al. 2008. Bacteriocins reduce Campylobacter jejuni colonization while bacteria producing bacteriocins are ineffective. Microb. Ecol. Health Dis. 20:74–79 [Google Scholar]
  • 23. Svetoch E. A., et al. 2008. Diverse antimicrobial killing by Enterococcus faecium E 50-52 bacteriocin. J. Agric. Food Chem. 56:1942–1948 [DOI] [PubMed] [Google Scholar]
  • 24. Svetoch E. A., et al. 2009. Antimicrobial activities of bacteriocins E 50-52 and B 602 against antibiotic-resistant strains involved in nosocomial infections. Probiotics Antimicrob. Proteins 1:136–142 [DOI] [PubMed] [Google Scholar]
  • 25. Zheng G., Slavik M. F. 1999. Isolation, partial purification and characterization of a bacteriocin produced by a newly isolated Bacillus subtilis strain. Lett. Appl. Microbiol. 28:363–368 [DOI] [PubMed] [Google Scholar]

Articles from Applied and Environmental Microbiology are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES