Abstract
A small soluble cytochrome c-554 purified from Methylosinus trichosporium OB3b has been purified and analyzed by amino acid sequencing, mass spectrometry, visible, CD and EPR spectroscopies. It is found to be a mono heme protein with a characteristic cytochrome c fold, thus fitting into the class of cytochrome c 2, which is the bacterial homologue of mitochondrial cytochrome c. The heme iron has a Histidine/Methionine axial ligation and exhibits a highly anisotropic/axial low spin (HALS) EPR signal, with a g max at 3.40, and ligand field parameters V/ξ = 0.99, Δ/ξ = 4.57. This gives the rhombicity V/Δ = 0.22. The structural basis for this HALS EPR signal in Histidine/Methionine ligated hemes is not resolved. The ligand field parameters observed for cytochrome c-554 fits the observed pattern for other cytochromes with similar ligation and EPR behaviour.
Introduction
The bacterium Methylosinus trichosporium OB3b is an obligatory methanotrophic gram-negative bacterium that can utilize methane as its only source of carbon and energy [1], [2], and is one of the most studied methanotrophic alphaproteobacteria. In addition to be able to oxidize methane, Methylosinus trichosporium Ob3b is able to oxidize a broad spectrum of toxic and organic compounds otherwise difficult to degrade, including halogenated hydrocarbons as trichloroethylene [3], [4]. This ability to oxidize potential biocides has led to an interest in using Methylosinus trichosporium OB3b for bioremediation of recalcitrant organic pollutants. Methylosinus trichosporium OB3b have two different enzyme systems capable of oxidizing methane, the soluble methane monooxygenase (sMMO) [5] and the membrane-bound particulate methane monooxygenase (pMMO) [6]. The expression of these enzyme systems (relative to each other) varies with the growth conditions, most importantly the copper concentration. High concentrations of copper(II) results in a high proportion of pMMO, while sMMO dominates at low copper(II) concentrations [2], [5], [6], [7]. In bacterial methane metabolism, a soluble c-type cytochrome is known to be involved in the oxidation of methanol to methanal by methanol dehydrogenase in the periplasmic space [2], [8].
C-type cytochromes are a diverse group of electron transfer proteins found in all areas of life. They are known to play important parts in key metabolic processes as respiration and photosynthesis. The covalent attachment of the heme group to the protein backbone is the key characteristic of these proteins and it is suggested that this is important for retaining the heme group outside the cytoplasm or in the mitochondrial intermembrane space [9], but it is proposed that heme attachment influences both heme reduction potential and ligand-iron interaction [10]. This attachment is formed by two (in some cases only one) thioether bonds with cysteine residues. The heme binding motif, Cys-X-X-Cys-His, is highly conserved and provides cysteine residues for the covalent attachment as well as a histidine axial ligand coordinating to the heme iron. The histidine is structurally constrained and the imidazole plane aligned roughly along the heme α-γ meso axis. The other ligand is most commonly methionine (e.g. mitochondrial cytochrome c [11], in the photosynthetic reaction centre [12] and soluble bacterial cytochromes [13], [14], [15]), but it can be histidine (e.g. cytochrome cd 1), the N-terminal amino group (cytochrome f) [16] or the iron can be five coordinated, as in cytochrome c' [17]. Historically different naming systems have been employed for the c-type cytochromes according to their physical properties, such as spectral features, redox potential or isoelectric point. In 1982, Ambler identified four major classes of c-type cytochromes based mainly on their sequence [18]. More recently Bertini and co-workers have added groups to this list when they scanned 188 genomes for cytochrome c domains, in order to obtain a wide coverage of the possible roles of c-type cytochromes [19]. The analysis of bacterial genomes revealed an astonishing variety in the number and types of c-type cytochromes encoded by different bacteria.
In this study we report purification and properties of a cytochrome c-554 from Methylosinus trichosporium OB3b, grown under pMMO expressing conditions. We compare this cytochrome with cytochrome c-555 from Methylococcus capsulatus (Bath), which was purified using the same protocol. We observe that these two cytochromes, both from methane oxidising bacteria, exhibit markedly different ferric low-spin EPR spectra. Cytochrome c-554 from Methylosinus trichosporium OB3b exhibits a highly anisotropic/axial low spin (HALS) EPR signal, whereas cytochrome c-555 from Methylococcus capsulatus (Bath) exhibits a rhombic EPR signal. Since the relationship between structure and these EPR signals in His/Met-ligated hemes is not understood, the characterization of more His/Met coordinated heme systems may be helpful in explaining the physical basis of the different EPR spectral types [20].
Methods
Materials
Horse heart cytochrome c was obtained from Sigma-Aldrich, cytochrome c-552 from Nitrosomonas europaea was donated by Professor Alan B. Hooper, University of Minnesota [15], [21], and cytochrome c-553 from Bacillus pasteurii was donated by Professor Stefano Ciurli, University of Bologna [13].
Bacterial Growth
Methylosinus trichosporium OB3b culture was obtained from the laboratory of John D. Lipscomb (University of Minnesota). Fermentation was conducted in a 10 L Biostat bioreactor (B. Braun, Melsungen) using a previously described culture medium [22] containing 10 µM copper sulphate. Cells were grown at 30°C and an agitation rate of 200–300 rpm and were purged with a 1∶4 methane/air mixture. The pH in the fermentor was maintained at 6.8–7.0 by addition of 1 M H2SO4 (aq). Cells were harvested at an OD540 between 3.0 and 5.0. The bacterial culture was first cooled to 0°C using crushed ice. The cooled cell culture was filtered through a Millipore Masterflex Cross-flow filtration unit (45 µm) until the volume was 1 litre. Harvested cells were centrifuged at 7000 g for 10 minutes, washed in 50 mM Pipes buffer, pH 7.0, frozen in liquid nitrogen and stored at −80°C.
Protein purification of cytochrome c-554 from Methylosinus trichosporium OB3b
While still in the frozen state, 30 g cells were packed into the cooled X-press® (AB BIOX, Gothenburg) pressure cell [23]. Cells were disrupted by several passages through the 1 mm diameter orifice at a pressure of ∼500 bars. This breaks the ice crystals irrespective of the cell membranes, thus disrupting the cells. The pressate was thawed and diluted with 120 ml 10 mM Tris HCl buffer, pH 8.2. The suspension was incubated with DNase I solution (80 Kunitz units) for 60 minutes at 4°C, and homogenized and centrifuged at 12.000 g for 20 minutes and then at 75.000 g for 3 hours. Ammonium sulphate was dissolved in the supernatant until the solution was 75% saturated, stirred for 60 minutes at 4°C, and centrifuged at 13.000 g for 30 minutes. The supernatant was applied to a phenyl sepharose column (1.5 cm×30 cm), equilibrated with 1.5 M (NH4)2SO4 in 10 mM Tris HCl buffer (pH 8.2). The protein was eluted with a linear gradient from 1.5 M to 0 M (NH4)2SO4. The eluted fractions with significant absorption at 410 nm were collected and concentrated in an Amicon® ultrafiltration cell (10 kDa filter cut-off). The ionic strength of the sample was decreased using a NAP- 10 column (GE Healthcare), which is a standardized Sephadex G-25 gel filtration column, before it was applied to a CM sepharose column (1.5 cm×20 cm), which had been equilibrated with 10 mM Tris HCl buffer (pH 8.2). The protein was eluted with a linear gradient from 0 to 0.15 M KCl in 10 mM Tris HCl buffer (pH 8.2), and then concentrated. The protein solution was applied to a Sephadex G-75 gel filtration column (1.5 cm×30 cm) equilibrated with 10 mM Tris HCl buffer (pH 8.2), concentrated and stored at −80°C. The same procedure was used to purify cytochrome c-555 from Methylococcus capsulatus (Bath).
Protein Sequencing
Protein sequencing was performed by automatic Edman degradation on an Applied Biosystems 477A Protein Sequencer (Applied Biosystems, Foster City, CA, USA) with an online 120A PTH amino acid analyser in the lab of Knut Sletten [24]. Cyanogen bromide (CNBr) cleavage of the protein was performed by dissolving 50 nmol freeze dried protein in 70% formic acid followed by an addition of a 50-fold excess of CNBr [25]. The mixture was left to incubate in darkness at 20°C for 24 hours. The CNBr was removed by evaporation before sequencing. The peptide sequences obtained was compared with the newly released genome [26] using TBLASTN, which searches a translated nucleotide sequence using a protein query [27]. The full peptide sequence identified was modelled on the structure peptide backbone of ferrocytochrome c 2 from Rhodopseudomonas viridis (1CO6.pdb) using SWISS-MODEL [28]. The protein sequence data reported in this paper will appear in the UniProt Knowledgebase under the accession number D5QVH0.
EPR Spectroscopy
The EPR spectra were acquired with a Bruker Elexsys 300E 10/12 X–band spectrometer equipped with a Bruker ER4116DM dual mode resonator cavity. A HeFlow cryostat (ESR 900, Oxford Instruments) allowed temperature regulation of the sample in the region 3.6 K to 100 K. The EPR samples were prepared by employing fast freezing procedures (from 273 K to77 K) of the protein solutions placed in EPR tubes. In all the measurements for cytochromes c, the EPR signals were too broad to detect above 30 K; thus most of the EPR spectra were collected at 10 K. The experimental conditions was: 9.65 GHz, modulation amplitude 1 mT, modulation frequency 100 kHz, sweep time168 s, time constant 82 ms, 4×104 gain, and the spectra was recorded in perpendicular mode. The spectra were recorded at 10±0.5 K, except for the temperature behaviour studies were data were recorded at 7, 13, 16, 21, 26, 31 and 36 K. The EPR spectra was recorded under non-saturating microwave power, with the exception of the microwave power saturation studies performed at 0.08, 0.2, 0.4, 0.8, 2.01, 6.35, 15.9, 63.5 and 159 mW. The spectral features was simulated with WINEPR SimFonia version 1.25 provided by Bruker.
Light absorption spectroscopy
UV-Vis transitions were observed on a HP8452A Spectrophotometer and a Jasco J-810 Spectropolarimeter. The heme content was quantified using alkaline pyridine hemochrome [29], which gives distinct absorption band, where the extinction coefficients vary only with the type of heme. (For heme c the extinction coefficients for the α- and β-bands are ε551 = 29.1 mM−1 cm−1 and ε522 = 18.6 mM−1 cm−1 [29].) A few grains of dithionite were added to the purified cytochrome c solution (50 µM) before an equal amount of a stock solution containing 0.15 M NaOH and 2.1 M pyridine was mixed with the protein solution. The heme concentration measured using alkaline pyridine hemochrome [29], was used to calculate extinction coefficients for the initial cytochrome solution.
Mass spectroscopy and heme cleavage
The protein mass was established using a Voyager-RP DE mass spectrometer (Applied Biosystems, Foster City, CA, USA) in the linear positive ion mode. Acceleration voltage, grid voltage and the delay time between ion production and extraction were adjusted to get optimal peak resolution for each sample. For each spectrum, 100 single scans were accumulated. The matrix, sinapinic acid (3,5-dimethoxy-4-hydroxy cinnamic acid (D-7927, Sigma-Aldrich, St. Louis, MI, USA)) was dissolved to saturation in a 1∶1 (v/v) mixture of acetonitrile and 0,1% (v) aqueous trifluoroacetic acid. Equal volumes of sample and matrix solution were mixed on the sample plate and air dried. All data were calibrated using an external calibration standard mixture (Applied Biosystems, Foster City, CA, USA). The c-type hemes was cleaved from the protein by reacting with 2-nitrophenylsulfenylchloride (2-NPS-Cl). It was performed by mixing 80 µl cytochrome c solution (20–30 µM) in 50% acetic acid with 40 µl 2-NPS-Cl (4 mM in acetic acid) and incubated for 10 minutes. Removal of 2-NPS from modified cysteine residues were done by adding 80 µl 0.4% mercaptoethanol (in a 10 M Urea solution) and incubated for another 10 minutes before the protein was desalted on a NAP-5 column equilibrated with 10% acetic acid. In the fractions collected after desalting there were an absence of the characteristic heme absorption bands, but a peak at 365 nm was observed confirming the presence of tryptophan residues modified by 2-NPS-Cl [30]. Ferrous and ferric cytochrome were prepared by addition of an excess of sodium dithionite, Na2S2O4, or potassium ferricyanide, K3Fe(CN)6, to the cytochrome solution, respectively, and excess reagents were removed on a NAP-5 column.
Results
Protein purification of cytochrome c-554
The purification procedure was monitored with light absorption by observing the ratio A410 /A280 as a measure of the heme to protein ratio. At the end of the purification procedure, this ratio approached 8. This is a reasonable value for a pure protein sample when compared with our measured extinction coefficient and the amino acids found in the protein sequence. SDS-PAGE revealed no protein impurities and suggested a molecular weight of about 13000 Da (data not shown). This is in good agreement with the mass obtained by mass spectrometry (see below).
Visible absorption and CD spectra indicates methionine ligation of cytochrome c-554
The absorption spectrum of the reduced form the cytochrome had α-, β- and Soret bands at 554, 524 and 416 nm, respectively. Upon oxidation, the Soret band shifted to 410 nm and the β-band to 526 nm (Figure 1A). Heme concentrations were calculated using pyridine hemochrome to obtain an accurate estimate of heme protein content [29]. These protein concentrations were used to calculate the extinction coefficients. The absorption spectrum of the reduced cytochrome has the following extinction coefficients: ε416 = 126 mM−1 cm−1, ε524 = 17 mM−1 cm−1 and ε554 = 24 mM−1 cm−1. The oxidized cytochrome has the extinction coefficients: ε410 = 116 mM−1 cm−1 and ε526 = 14 mM−1 cm−1. The oxidized protein also exhibited a weak band at 695 nm, which is indicative of methionine ligation [31]. The feature at 695 nm was further confirmed by CD spectroscopy [21]. The observed negative CD feature corresponding to this absorption band is red-shifted compared to mammalian cytochrome c, similar to what we observe in cytochrome c-552 from Nitrosomonas europaea, which has the same His/Met heme ligation and a known 3D structure [11], [15] (Figure 1B).
Mass spectroscopy reveals a single heme group
There exist many classes of c-type cytochromes, with varying number of heme groups attached. Determining the number of hemes attached to a protein might prove difficult, as seen in the case of cytochrome c-554 from Nitrosomonas europaea, which were believed to contain two hemes but were later found to contain four hemes [32], [33]. To establish the number of heme groups and to obtain an accurate mass determination, MALDI-TOF MS was performed. The molecular weight of the cytochrome was estimated to be 12230±15 Da (Figure 2A). Treatment with 2-nitrophenylsulfenylchloride (2-NPS-Cl) was used to cleave the heme group. The 2-NPS-Cl treated protein exhibited peaks corresponding to a loss of one heme group (Figure 2B). No peaks at lower mass to charge ratios were found, indicating the presence of a single heme group in the protein. Treatment with 2-NPSCl cleaves of the heme group by breaking the thioether bond between the heme group and the cysteine in the CXXCH heme binding motif (Figure 2C). 2-NPS will furthermore react with tryptophan residues to create a chromophore with an absorption maximum at 365 nm (Figure 2D). The observation of this chromophore was used to trace the protein after removal of the heme group, and furthermore suggested the presence of two tryptophan residues in the protein.
Amino acid sequence of cytochrome c-554 from Methylosinus trichosporium OB3b
Two parts of the cytochrome c-554 from Methylosinus trichosporium OB3b were sequenced using Edman degradation [34]. The first 39 amino acids on the N-terminal were determined to be AGDPAAGEKVFNKCKACHQVGETAKNAVAPELNGIDGRK. After cyanogenbromide (CNBr) treatment two peptide fragments were observed, which verified the presence of only one methionine residue in this sequence. The amino acid sequence obtained from the second peptide is MIFPGLSSENDQANVWAYLSQFGADGKK. Sequence alignment indicates that this is the C-terminal part of the protein, and that the methionine at the beginning of the second fragment is the sixth heme axial ligand. The middle part of the protein has not been sequenced. The two sequences, bridged by a gap of unknown length, were aligned using tBlastn with the complete genome of Methylosinus trichosporium OB3b [26], [27]. Full identity was found with the bases 13660–13980 in contig00046 of the genome. The complete sequence of the protein contains the following 108 amino acids: H2N-AGDPAAGEKVFNKCKACHQVGETAKNAVAPELNGIDGRKSASAEGYNYSEPFKALGITWDEAQFKEFIKNPKAKVPGTKMIFPGLSSENDQANVWAYLSQFGADGKKK-COOH. The heme binding motif and the iron coordinating methionine residue is underlined. The complete protein sequence contains only one heme binding motif and two tryptophans in agreement with the observations from mass spectrometry. There is only one methionine residue in the protein, in position 80, in good agreement with the cyanogenbromide cleavage. The genomic sequence revealed a 24 amino acid signal sequence, MKSISMLTLAASVAFAVTAGQAVA, confirming the periplasmic location of this protein [35]. Based on the primary sequence, a theoretical pI value of 8.55 was calculated using the program ProtParam on the ExPASy server [9], [36].
The sequence was aligned with protein and nucleotide sequence databases using protein blast and tBlastn [27]. The best alignment is found with a c-type cytochrome from the genome sequence of Nitrobacter winogradskyi strain Nb-255, which has 64% identical residues and 78% positive residues (identical residues or conservative mutations). All best alignments represent c-type cytochromes from bacteria belonging to the alphaproteobacteria in the order Rhizobiales, in which Methylosinus trichosporium OB3b is included. The most similar alignment with a protein with known 3D structure is ferrocytochrome c 2 from Rhodopseudomonas viridis with 56 (52%) identical residues, a total of 74 (69%) positive residues and no gaps (pdb-id: 1CO6) [37]. Homology modelling of the tertiary structure using this cytochrome as template reveals a tertiary structure similar to the cytochrome c fold of mitochondrial cytochrome c (Figure 3) [11], [38]. The identity with horse heart cytochrome c is 30.5% (33 out of 108 residues).
EPR spectroscopy shows that cytochrome c-554 exhibits a highly anisotropic low spin (HALS) signal
Electron paramagnetic resonance (EPR) spectroscopy probes unpaired electron in a sample. As the only unpaired electrons in proteins occur at metal ions or in free radical enzyme mechanisms, EPR is an excellent tool to study the chemically active part of a protein without interference from the protein backbone. Cytochrome c-554 from Methylosinus trichosporium OB3b exhibits a ferric HALS (Highly Axial Low-Spin or Highly Anisotropic Low-Spin (S = ½)) also called Type I EPR signal by the nomenclature introduced by F. Ann Walker [39] when subjected to low temperature EPR spectroscopy, with a g max value of 3.40 (Figure 4C). HALS EPR signals are also known as “large g max” signals. This kind of signals have been observed in cytochromes with His/His, His/amine and His/Met coordination of the heme iron, and the main characteristic of these signals is a g-value higher than 3.3 [20], [39], [40], [41]. Because of the nature of the very broad HALS EPR signal, direct assignment of all three g-values is generally not possible. The microwave absorption amplitude decays slowly and extends to high magnetic fields, which results in a weak slope, and hence small amplitudes in the 1st derivative spectrum. Usually low-spin ferric hemes exhibit rhombic EPR spectra where two distinct g-values can be clearly resolved (Figure 4D). In the HALS EPR spectra, the last two g-values are very poorly resolved. HALS EPR spectra can be observed in cytochromes c from markedly different bacterial species like Bacillus pasteurii, Nitrosomonas europaea and Methylosinus trichosporium OB3b (Figure 4A, B and C), while other bacterial cytochromes c like cytochrome c-555 from Methylococcus capsulatus (Bath) (see below) exhibit rhombic EPR spectra with g-values at 2.93, 2.28 and 1.49 (Figure 4D and Table 1).
Table 1. Ligand field and g-tensor values for the EPR signal from the c-type cytochromes (EPR spectra shown in Figure 4).
The line width of the two lower g-components (at higher magnetic field) in the HALS EPR signals is very broad and can not be accurately assigned from the spectrum. Simulations of the EPR signal shows that the spectrum is best fit with g y = 1.8 (Figure 4E). The g x-value was too broad for any meaningful simulation, and was calculated to be 1.1 using the equation g z 2+ g y 2+ g x 2 = 16 [40]. Using the equations of Taylor the crystal field parameters were calculated to be V/ξ = 0.994, Δ/ξ = 4.57. This gives the rhombicity V/Δ = 0.22 and a2+ b2+ c2 = 1.0006, which is in the acceptable range demanded by this analysis [41]. These are refined values compared to what we previously reported [42], still fitting the observed trend for the c-type cytochromes with His/Met ligation that exhibit a ferric HALS EPR signal.
At 10 K this EPR signal is difficult to saturate, revealed by a relatively high microwave power saturation value (P½). The P½ value was determined for the HALS EPR signal from cytochrome c-554 from Methylosinus trichosporium OB3b using the equation [43]:
Where S denotes the double integral of the EPR signal, K is a normalisation factor, P is the microwave power, b is a component relating to the type of relaxation and P½ is the microwave power at half saturation. The b factor can vary between 1 for a completely inhomogeneous relaxation, and 3 for a completely homogenous relaxation. The microwave power saturation behaviour of Methylosinus trichosporium OB3b cytochrome c-554 was simulated with a b factor of 1 and indicates a P½ value of 44 mW±9 mW (Figure 5C). All the studied c-type cytochromes that exhibit HALS EPR spectra show P½ values above 40 mW at 10 K [44], [45], indicating that high saturation midpoint may be a general feature of the HALS EPR signal.
EPR spectra of the “g-max” signal were recorded at seven different temperatures ranging from 7 K to 36 K under non-saturating conditions (microwave power 0.8 mW) with all other instrumental parameters kept constant (Figure 5A). At 36 K, the EPR signal was barely visible. This is similar to the temperature behaviour of the other HALS EPR signals studied, and consistent with the former notion that these signals are not readily observed above 20 K [39], [44]. Figure 5B shows how the double integral of the EPR signal varies with the inverse absolute temperature. The linear behaviour shows that the magnetisation follows the Curie law in this temperature interval. This implies that the unpaired electron in the ferric cytochrome behaves like an ideal spin-½ paramagnet in the temperature range 7 K to 36 K, hence it is not influenced by neighbouring paramagnetic species.
Cytochrome c-555 from Methylococcus capsulatus (Bath)
Frozen cells of the methane oxidizing gammaproteobacterium Methylococcus capsulatus (Bath) was received as a generous gift from DB Lab A/S in Odense, Denmark [46]. The same purification protocol as was used for cytochrome c-554 from Methylosinus trichosporium OB3b was used to purify a c-type protein from this bacterium. This c-type cytochrome has a molecular weight of 11120 Da as determined by MALDI-TOF MS. The first 14 amino acids were sequenced using Edman degradation and showed full identity with the cytochrome c-555 previously reported by Ambler et al. [47]. This cytochrome exhibits a rhombic EPR signal (Figure 4D, 4F and Table 1) where the crystal field parameters were calculated to be V/ξ = 1.87 and Δ/ξ = 3.06. This gives the rhombicity V/Δ = 0.61 and a2+ b2+ c2 = 1.003.
Discussion
HALS EPR signals can occur both in Histidine/Methionine ligated hemes like in cytochromes c 2, and in bis-Histidine ligated hemes. In bis-Histidine ligated hemes, a relation between the geometry of the histidines and the different EPR spectra has been found [39], [48]. A similar structural basis for this signal in His/Met coordinated hemes is not understood [20], [21], [40], [42], [44], [45], [49]. The derived ligand field parameters for cytochrome c-554 from Methylosinus trichosporium Ob3b is V/ξ = 0.99 and Δ/ξ = 4.57, and a rhombicity V/Δ = 0.22. This is similar to what we find in other c-type cytochromes (Table 1) where we observe that proteins exhibiting HALS EPR signals have V/ξ around 1.0 and a rhombicity lower than 1/3.
Six coordinated c-type cytochromes are electron transfer proteins, but the biological role of cytochrome c-554 from Methylosinus trichosporium Ob3b has not been elucidated. The homologues of cytochrome c-554 in the group cytochrome c 2 is known to mediate electron transfer between bc 1 complexes and cytochrome c oxidases during aerobic growth [19]. A similar role is possible for this cytochrome, as the high theoretical pI suggests a weak membrane association and the signal sequence suggests a periplasmic localisation, which is a common localisation for cytochromes c [50], or it might be involved in the metabolism of methane. The genome of Methylosinus trichosporium OB3b contains several (around 10) putative c-type cytochromes, but only a few is mentioned in the literature [51]. The homology with mitochondrial cytochrome c is not unreasonable as the mitochondrion is believed to originate from another alphaproteobacterium [52].
Cytochrome c-554 belongs to the class of cytochrome c 2. The homologous mitochondrial cytochrome c has a rhombic EPR spectrum with g-values of 3.06, 2.24 and 1.24 [53] and the related membrane interacting cytochrome c 2 from Rhodobacter sphaeroides has g-values of 3.29, 2.06 and 1.14 at neutral pH [54]. Both of these have known crystal structure [55]. Interestingly, the axial methionine ligand in the latter structure can be lost, as also suggested for horse heart cytochrome c at high pH [56]. This indicates, together with the fluxionality of the methionine ligand in Nitrosomonas europaea cytochrome c-552 that the methionine is loosely coordinated to the iron. The g-values of cytochrome c-554 from Methylosinus trichosporium OB3b is clearly HALS, and represent the high end of the g max range observed for the small soluble cytochromes c [42]. The mitochondrial cytochrome c is found in low g max end of this range, and cytochrome c 2 from Rhodobacter sphaeroides is in the middle of this range. The homology with these membrane interacting cytochromes further strengthens the idea that cytochrome c-554 is membrane associated, and might have a weakly coordinated axial methionine. This study further indicate that subtle differences in the His/ Met ligated heme proteins can modulate the low-spin EPR signal [42], [45]. This is in agreement with preliminary, unpublished crystallographic studies, by Kara Bren's and K.Kristoffer Andersson's laboratories, on the Nitrosomonas europaea cytochrome c-552 mutant without the HALS EPR signal.
Acknowledgments
Thanks are due to Siv Fauchald who worked on this protein as her ‘hovedfag' thesis, and Dr. Bettina Katterle who was responsible for the cultivation on Methylosinus trichosporium OB3b and knowledge transfer in the lab. We are also grateful to Hamid Shegarfi and Innocent O. Chukwu, who helped in growing the bacterium and assisted in the purification procedure, and Dr. Giorgio Zoppellaro who performed the EPR on Methylococcus capsulatus (Bath) cytochrome c-555, and assisted with the EPR analysis.
Footnotes
Competing Interests: The authors have declared that no competing interests exist.
Funding: This research was funded by the Norwegian Research Council (grant number 157855 [to EH] and grant number 177661/V30 [to KKA]). The funder had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1.Whittenbury R, Phillips KC, Wilkinson JF. Enrichment, isolation and some properties of methane-utilizing bacteria. J Gen Microbiol. 1970;61:205–218. doi: 10.1099/00221287-61-2-205. [DOI] [PubMed] [Google Scholar]
- 2.Semrau JD, DiSpirito AA, Yoon S. Methanotrophs and copper. FEMS Microbiol Rev. 2010;34:496–531. doi: 10.1111/j.1574-6976.2010.00212.x. [DOI] [PubMed] [Google Scholar]
- 3.Fox BG, Borneman JG, Wackett LP, Lipscomb JD. Haloalkene Oxidation by the Soluble Methane Monooxygenase from Methylosinus trichosporium OB3b - Mechanistic and Environmental Implications. Biochemistry. 1990;29:6419–6427. doi: 10.1021/bi00479a013. [DOI] [PubMed] [Google Scholar]
- 4.Sullivan JP, Dickinson D, Chase HA. Methanotrophs, Methylosinus trichosporium OB3b, sMMO, and their application to bioremediation. Crit Rev Microbiol. 1998;24:335–373. doi: 10.1080/10408419891294217. [DOI] [PubMed] [Google Scholar]
- 5.Lipscomb JD. Biochemistry of the Soluble Methane Monooxygenase. Annu Rev Microbiol. 1994;48:371–399. doi: 10.1146/annurev.mi.48.100194.002103. [DOI] [PubMed] [Google Scholar]
- 6.Balasubramanian R, Rosenzweig AC. Structural and mechanistic insights into methane oxidation by particulate methane monooxygenase. Acc Chem Res. 2007;40:573–580. doi: 10.1021/ar700004s. [DOI] [PubMed] [Google Scholar]
- 7.Hakemian AS, Rosenzweig AC. The biochemistry of methane oxidation. Annu Rev Biochem. 2007;76:223–241. doi: 10.1146/annurev.biochem.76.061505.175355. [DOI] [PubMed] [Google Scholar]
- 8.Dales SL, Anthony C. The Interaction of Methanol Dehydrogenase and its Cytochrome Electron Acceptor. Biochem J. 1995;312:261–265. doi: 10.1042/bj3120261. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Wood PM. Why do c-type cytochromes exist? FEBS Lett. 1983;164:223–226. doi: 10.1016/0014-5793(83)80289-0. [DOI] [PubMed] [Google Scholar]
- 10.Bowman SEJ, Bren KL. The chemistry and biochemistry of heme c: functional bases for covalent attachment. Nat Prod Rep. 2008;25:1118–1130. doi: 10.1039/b717196j. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Bushnell GW, Louie GV, Brayer GD. High-Resolution 3-Dimentional Structure of Horse Heart Cytochrome c. J Mol Biol. 1990;214:585–595. doi: 10.1016/0022-2836(90)90200-6. [DOI] [PubMed] [Google Scholar]
- 12.Lancaster CRD, Michel H. Three-dimensional structures of photosynthetic reaction centers. Photosynth Res. 1996;48:65–74. doi: 10.1007/BF00040997. [DOI] [PubMed] [Google Scholar]
- 13.Benini S, Gonzalez A, Rypniewski WR, Wilson KS, Van Beeumen JJ, et al. Crystal structure of oxidized Bacillus pasteurii cytochrome c(553) at 0.97-angstrom resolution. Biochemistry. 2000;39:13115–13126. doi: 10.1021/bi000402j. [DOI] [PubMed] [Google Scholar]
- 14.Salemme FR, Freer ST, Xuong NH, Alden RA, Kraut J. Structure of Oxidized Cytochrome c 2 of Rhodospirillum rubrum. J Biol Chem. 1973;248:3910–3921. doi: 10.2210/pdb1c2c/pdb. [DOI] [PubMed] [Google Scholar]
- 15.Timkovich R, Bergmann D, Arciero DM, Hooper AB. Primary Sequence and Solution Conformation of Ferrocytochrome c-552 from Nitrosomonas europaea. Biophys J. 1998;75:1964–1972. doi: 10.1016/S0006-3495(98)77637-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Carrell CJ, Schlarb BG, Bendall DS, Howe CJ, Cramer WA, et al. Structure of the soluble domain of cytochrome f from the cyanobacterium Phormidium laminosum. Biochemistry. 1999;38:9590–9599. doi: 10.1021/bi9903190. [DOI] [PubMed] [Google Scholar]
- 17.Finzel BC, Weber PC, Hardman KD, Salemme FR. Structure of Ferricytochrome c' from Rhodospirillum Molischianum at 1.67 Å resolution. J Mol Biol. 1985;186:627–643. doi: 10.1016/0022-2836(85)90135-4. [DOI] [PubMed] [Google Scholar]
- 18.Ambler RP. The Structure an Classification of Cytochromes c. In: Kaplan NO, Robinson, A, editors. From Cyclotrons to Cytochromes. New York: Academic Press; 1982. pp. 263–280. [Google Scholar]
- 19.Bertini I, Cavallaro G, Rosato A. Cytochrome c: Occurrence and functions. Chem Rev. 2006;106:90–115. doi: 10.1021/cr050241v. [DOI] [PubMed] [Google Scholar]
- 20.Salerno JC. Cytochrome Electron Spin resonance Line Shapes, Ligand Field, and Components Stoichiometry in Ubiquinol Cytochrome c Oxidoreductase. J Biol Chem. 1984;259:2331–2336. [PubMed] [Google Scholar]
- 21.Arciero DM, Peng QY, Peterson J, Hooper AB. Identification of Axial Ligands of Cytochrome C(552) from Nitrosomonas europaea. FEBS Lett. 1994;342:217–220. doi: 10.1016/0014-5793(94)80504-0. [DOI] [PubMed] [Google Scholar]
- 22.Cornish A, Nicholls KM, Scott D, Hunter BK, Aston WJ, et al. In vivo C-13 NMR Investigations of methanol oxidation by the obligate methanotroph Methylosinus trichosporium OB3B. J Gen Microbiol. 1984;130:2565–2575. [Google Scholar]
- 23.Magnusson KE, Edebo L. Large-Scale Disintegration of Microorganisms by Freeze-Pressing. Biotechnol Bioeng. 1976;18:975–986. doi: 10.1002/bit.260180710. [DOI] [PubMed] [Google Scholar]
- 24.Kjaeraas S, Husby G, Sletten K. The amino acid sequence of an AL-protein, AL-KH, isolated from the heart of a patient with Waldenstroms macroglobulinemia and amyloidosis. Amyloid. 2006;13:260–262. doi: 10.1080/13506120600960767. [DOI] [PubMed] [Google Scholar]
- 25.Gross E, Witkop B. Selective cleavage of methionyl peptide bonds in ribonuclease with cyanogen bromide. J Am Chem Soc. 1961;83:1510–1511. [Google Scholar]
- 26.Stein LY, Yoon S, Semrau JD, DiSpirito AA, Crombie A, et al. Genome Sequence of the Obligate Methanotroph Methylosinus trichosporium Strain OB3b. J Bacteriol. 2010;192:6497–6498. doi: 10.1128/JB.01144-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Altschul SF, Madden TL, Schaffer AA, Zhang JH, Zhang Z, et al. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 1997;25:3389–3402. doi: 10.1093/nar/25.17.3389. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Arnold K, Bordoli L, Kopp J, Schwede T. The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics. 2006;22:195–201. doi: 10.1093/bioinformatics/bti770. [DOI] [PubMed] [Google Scholar]
- 29.Falk JE. Haems. I. Determination As Pyridine Haemochromes. In: Falk JE, editor. Porphyrins and Metalloporphyrins. Amsterdam: Elsevier Publishing; 1964. pp. 181–188. [Google Scholar]
- 30.Fontana A, Veronese FM, Boccu E. Reaction of sulfenyl halides with cytochrome - novel method for heme cleavage. FEBS Lett. 1973;32:135–138. doi: 10.1016/0014-5793(73)80756-2. [DOI] [PubMed] [Google Scholar]
- 31.Stellwagen E, Cass R. Alkaline isomerization of ferricytochrome-c from Euglena Gracilis. Biochem Biophys Res Commun. 1974;60:371–375. doi: 10.1016/0006-291x(74)90214-9. [DOI] [PubMed] [Google Scholar]
- 32.Yamanaka T, Shinra M. Cytochrome c-552 and cytochrome c-554 derived from Nitrosomonas europaea - purification, properties, and their function in hydroxylamine oxidation. J Biochem. 1974;75:1265–1273. doi: 10.1093/oxfordjournals.jbchem.a130510. [DOI] [PubMed] [Google Scholar]
- 33.Andersson KK, Lipscomb JD, Valentine M, Munck E, Hooper AB. Tetraheme cytochrome c-554 from Nitrosomonas europaea - heme-heme interactions and ligand-binding. J Biol Chem. 1986;261:1126–1138. [PubMed] [Google Scholar]
- 34.Edman P. Method for determination of the amino acid sequence in peptides. Acta Chem Scand. 1950;4:283–293. [Google Scholar]
- 35.Bendtsen JD, Nielsen H, von Heijne G, Brunak S. Improved prediction of signal peptides: SignalP 3.0. J Mol Biol. 2004;340:783–795. doi: 10.1016/j.jmb.2004.05.028. [DOI] [PubMed] [Google Scholar]
- 36.Gasteiger EHC, Gattiker A, Duvaud S, Wilkins MR, Appel RD, et al. Protein Identification and Analysis Tools on the ExPASy Server. In: Walker JM, editor. The Proteomics Protocols Handbook. Totowa, New Jersey: Humana Press; 2005. pp. 571–607. [Google Scholar]
- 37.Sogabe S, Miki K. Refined crystal-structure of ferrocytochrome-c(2) from Rhodopseudomonas viridis at 1.6 angstrom resolution. J Mol Biol. 1995;252:235–247. doi: 10.1006/jmbi.1995.0491. [DOI] [PubMed] [Google Scholar]
- 38.Banci L, Bertini I, Rosato A, Varani G. Mitochondrial cytochromes c: a comparative analysis. J Biol Inorg Chem. 1999;4:824–837. doi: 10.1007/s007750050356. [DOI] [PubMed] [Google Scholar]
- 39.Walker FA. Magnetic spectroscopic (EPR, ESEEM, Mossbauer, MCD and NMR) studies of low-spin ferriheme centers and their corresponding heme proteins. Coord Chem Rev. 1999;186:471–534. [Google Scholar]
- 40.de Vries S, Albracht SPJ. Intensity of Highly Anisotropic Low-Spin Heme EPR Signals. Biochim Biophys Acta. 1979;546:334–340. doi: 10.1016/0005-2728(79)90050-1. [DOI] [PubMed] [Google Scholar]
- 41.Taylor CPS. EPR of Low-Spin heme Complexes - Relation of t2g Hole Model to Directional Properties of g-tensor, and a New Method for Calculating Ligand Field parameters. Biochim Biophys Acta. 1977;491:137–149. doi: 10.1016/0005-2795(77)90049-6. [DOI] [PubMed] [Google Scholar]
- 42.Zoppellaro G, Bren KL, Ensign AA, Harbitz E, Kaur R, et al. Studies of Ferric Heme Proteins with Highly Anisotropic/Highly Axial Low Spin (S = 1/2) Electron Paramagnetic Resonance Signals with bis-Histidine and Histidine-Methionine Axial Iron Coordination. Biopolymers. 2009;91:1064–1082. doi: 10.1002/bip.21267. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Brudvig GW. Electron paramagnetic resonance spectroscopy. Meth Enzymol. 1995;246:536–554. doi: 10.1016/0076-6879(95)46024-1. [DOI] [PubMed] [Google Scholar]
- 44.Zoppellaro G, Teschner T, Harbitz E, Schuenemann V, Karlsen S, et al. Low-temperature EPR and Mossbauer spectroscopy of two cytochromes with His-Met axial coordination exhibiting HALS signals. ChemPhysChem. 2006;7:1258–1267. doi: 10.1002/cphc.200500693. [DOI] [PubMed] [Google Scholar]
- 45.Zoppellaro G, Harbitz E, Kaur R, Ensign AA, Bren KL, et al. Modulation of the Ligand-Field Anisotropy in a Series of Ferric Low-Spin Cytochrome c Mutants derived from Pseudomonas aeruginosa Cytochrome c-551 and Nitrosomonas europaea Cytochrome c-552: A Nuclear Magnetic Resonance and Electron Paramagnetic Resonance Study. J Am Chem Soc. 2008;130:15348–15360. doi: 10.1021/ja8033312. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Bothe H, Jensen KM, Mergel A, Larsen J, Jorgensen C, et al. Heterotrophic bacteria growing in association with Methylococcus capsulatus (Bath) in a single cell protein production process. Appl Microbiol Biotechnol. 2002;59:33–39. doi: 10.1007/s00253-002-0964-1. [DOI] [PubMed] [Google Scholar]
- 47.Ambler RP, Dalton H, Meyer TE, Bartsch RG, Kamen MD. The Amino Acid Sequence of Cytochrome cis-555 from the Methane Oxidizing Bacterium Methylococcus Capsulatus Biochem J. 1986;233:333–337. doi: 10.1042/bj2330333. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Yatsunyk LA, Carducci MD, Walker FA. Low-spin ferriheme models of the cytochromes: Correlation of molecular structure with EPR spectral type. J Am Chem Soc. 2003;125:15986–16005. doi: 10.1021/ja036398r. [DOI] [PubMed] [Google Scholar]
- 49.Berry EA, Walker FA. Bis-histidine-coordinated hemes in four-helix bundles: how the geometry of the bundle controls the axial imidazole plane orientations in transmembrane cytochromes of mitochondrial complexes II and III and related proteins. J Biol Inorg Chem. 2008;13:481–498. doi: 10.1007/s00775-008-0372-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Hooper AB, Dispirito AA. In Bacteria Which Grows on Simple Reductants, Generation of a Proton Gradient Involves Extracytoplasmic Oxidation of Substrate. Microbiol Rev. 1985;49:140–157. doi: 10.1128/mr.49.2.140-157.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Tonge GM, Harrison DEF, Higgins IJ. Purification and Properties of Methane Mono-oxygenase Enzyme System from Methylosinus trichosporium OB3b Biochem J. 1977;161:333–344. doi: 10.1042/bj1610333. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Andersson SGE, Zomorodipour A, Andersson JO, Sicheritz-Ponten T, Alsmark UCM, et al. The genome sequence of Rickettsia prowazekii and the origin of mitochondria. Nature. 1998;396:133–140. doi: 10.1038/24094. [DOI] [PubMed] [Google Scholar]
- 53.Salmeen I, Palmer G. Electron Paramagnetic resonance of Beef Heart Ferricytochrome c. J Chem Phys. 1968;48:2049–2052. doi: 10.1063/1.1669014. [DOI] [PubMed] [Google Scholar]
- 54.Drepper F, Mathis P. Structure and function of cytochrome c(2) in electron transfer complexes with the photosynthetic reaction center of Rhodobacter sphaeroides: Optical linear dichroism and EPR. Biochemistry. 1997;36:1428–1440. doi: 10.1021/bi961351m. [DOI] [PubMed] [Google Scholar]
- 55.Axelrod HL, Feher G, Allen JP, Chirino AJ, Day MW, et al. Crystallization and X-ray structure of cytochrome c2 from Rhodobacter sphaeroides in 3 Crystal Forms. Acta Crystallogr D. 1994;50:596–602. doi: 10.1107/S0907444994001319. [DOI] [PubMed] [Google Scholar]
- 56.Hederstedt L, Andersson KK. Electron Parapmagnetic Resonance Spectroscopy of Bacillus subtilis Cytochrome b558 in Escherichia coli Membranes and in Succinate Dehydrogenase Complex from Bacillus subtilis Membranes. J Bacteriol. 1986;167:735–739. doi: 10.1128/jb.167.2.735-739.1986. [DOI] [PMC free article] [PubMed] [Google Scholar]