Abstract
Cellulose binding domains (CBD) in the carbohydrate binding module family 1 (CBM1) are structurally conserved regions generally linked to catalytic regions of cellulolytic enzymes. While widespread amongst saprophytic fungi that subsist on plant cell wall polysaccharides, they are absent amongst most plant pathogenic fungal cellulases. A genome wide survey for CBM1 was performed on the highly destructive plant pathogen Phytophthora infestans, a fungal-like Stramenopile, to determine if it harbored cellulolytic enzymes with CBM1. Only five genes were found to encode CBM1, and none were associated with catalytic domains. Surveys of other genomes indicated that the CBM1-containing proteins, lacking other domains, represent a unique group of proteins largely confined to the Stramenopiles. Immunolocalization of one of these proteins, CBD1, indicated that it is embedded in the hyphal cell wall. Proteins with CBM1 domains can have plant host elicitor activity, but tests with Agrobacterium-mediated in planta expression and synthetic peptide infiltration failed to identify plant hypersensitive elicitation with CBD1. A structural basis for differential elicitor activity is proposed.
Introduction
Cellulose binding domains (CBD), are highly conserved regions of family 1 carbohydrate binding modules (CBM), are generally associated with catalytic glycoside hydrolases, whose members include endoglucanases, exocellobiohydrolases and beta-glucosidases. The non-catalytic CBD aids in anchoring to polysaccharides, and is often separated from the catalytic region by a short, flexible linker region rich in serine, proline and threonine [1]. These carbohydrate binding modules aid in specific binding, but are required principally for binding to crystalline cellulose [2]. While CBM1 is ubiquitous on fungal saprophyte-encoded glycoside hydrolases, they have thus far been absent in most fungal plant pathogen-encoded glycoside hydrolases identified subsequent to the first fungal phytopathogen endoglucanase sequence reported [3]–[4]. Recently, genome sequence information has become available for the major plant pathogenic organism Phytophthora [5]–[6]. While sharing some similarities to phytopathogenic fungi, Phytophthora is classified within the Stramenopiles, separate from the fungal kingdom. In an effort to discover if Phytophthora-encoded glycoside hydrolases follow the structural paradigm of those found in fungal phytopathogens, a genome-wide survey for CBM1 in Phytophthora infestans was initiated. A total of five putative gene products were identified, however, none were associated with any form of catalytic domain. The gene products represent a novel group of Phytophthora proteins, with one or two cellulose binding domains. As Phytophthora cell walls are comprised largely of cellulosic glucans [7] it is probable that the cellulose binding proteins are associated with the cell wall. One Phytophthora glycoprotein with cellulose binding domains and a lectin binding region, referred to as CBEL, was found associated with the cell wall [8]. The CBEL protein, one of the cellulose binding domain proteins also identified in our search, elicits plant defenses [8]–[9]. In our study we have focused on a previously unrecognized, 13 kD cellulose binding protein, determining cellular location and elicitor activity.
Results
We performed a genome-wide search of Phytophthora infestans genes encoding family 1 carbohydrate binding modules (CBM1) that are commonly found on cellulolytic enzymes from saprophytic fungi. There were very few CBM1 motifs detected (Figure 1), and none were associated with proteins having any type of catalytic domain. Analysis of corresponding EST data from the numerous P. infestans cDNA libraries that have been sequenced indicates that CBD1, CBD4 and CBD5 are transcribed. Our research focused on the previously undocumented CBD1, that is the smallest CBM1 containing protein (13 kD). The protein contains one CBM1, as opposed to CBD4 and CBD5 (corresponding to a protein known as CBEL), that contain two CBM1 regions. The protein has a signal peptide (www.cbs.dtu.dk/services/SignalP), a region with high probability of O-glycosylation (www.cbs.dtu.dk/services/NetOGlyc) and a CBM1 that is located near the C-terminus (Figure 2). Interestingly, the CBM1 ends about 14 amino acids from the terminus of a non-enzymatic protein, while CBM1 is situated at the extreme terminus of cellulolytic enzymes. Homologues of CBD1 are found in P. sojae, P. ramorum and P. capsici (Figure 3).
Figure 1. Identification of Phytophthora infestans genomic regions encoding the cellulose binding domain (Carbohydrate Binding Module 1) motif.
The CBD2 and CBD3 gene regions have no corresponding ESTs.
Figure 2. Sequence of a small cellulose binding domain protein (CBD1) encoded by Phytophthora infestans.
Signal peptide cleavage site denoted by asterisk, underlined region represents peptide sequence used for antibody production, italicized letters represent predicted O-glycosylation region, and bold letters represent the conserved CBM1 sequence.
Figure 3. Identification of a small CBM1 protein in Phytophthora species.
Disulfide bonds occur between C8:C25 and C19:C35.
To test the ability of P. infestans CBD1 to elicit a plant response, expression in plants was mediated through infiltration of tobacco and potato with Agrobacterium carrying pBI121-cbd1. Six days after infiltration there were no signs of necrosis due to hypersensitive reaction to CBD1. Western blots showed that the protein was expressed in planta (data not shown). The possibility existed that the CBD1 protein was somehow sequestered and unable to interact with a potential receptor region, but this is unlikely as in planta expression of the Phytophthora CBEL protein elicited necrosis [9]. Synthetic peptides were also tested to determine if host defense could be elicited. The peptide, spanning the conserved CBM1 domain, was infiltrated at levels beyond that expected as biologically relevant, yet necrosis was not observed during a one week observation period.
During the initial isolation of CBD1, we precipitated proteins found in the culture medium. Using an anti-CBD1 antibody, we did not detect the protein in the filtrate. The antibody was then used for immunodetection, to determine if the protein was associated with the hyphae. A strong signal was apparent along the hyphal and sporangial walls of P. infestans that emerged from infected samples of potato leaf tissue (Figure 4A). The hyphae growing through the tissue was also labeled (Figure 4B).
Figure 4. Immunofluorescent detection of hyphae and sporangia of P. infestans.
Primary antibodies were prepared to a peptide representing the amino terminus (after signal peptide cleavage) of CBD1. Samples were viewed by confocal microscopy after incubation with FITC labeled secondary antibodies. A) hyphae and sporangia emerging from infected potato leaf tissue B) hyphae along the transition zone between symptomatic (upper right) and asymptomatic (lower left) infected leaf tissue.
To determine the association of CBD1 with the hyphal wall, various extraction methods were performed. Two effective methods were found, boiling in SDS or overnight incubation in Tris buffer (pH 9.5). Methods that would commonly elute CBM1 from cellulose were not effective [2], [ 18], [20]. The higher pH of 30 mM NaOH (11.5) was also not suitable. SDS extraction suggests interaction with other cell wall proteins. Total extractable CBD1 was quite low indicating a resilient association with the cell wall (data not shown).
Discussion
This genome wide screen provides the first comprehensive evidence that Phytophthora retains the structural paradigm first found for phytopathogenic fungi [3]–[4], where cellulolytic enzymes are devoid of CBM1. Previous studies have clearly shown that Phytophthora encodes cellulolytic enzymes, such as family 5 and family 12 endoglucanases [10]–[11]. They are present as multiple copy gene families and there was no evidence of CBM1 motifs in these proteins.
The lack of CBM1 motifs on enzymes that may be critical to early penetration and invasion by biotrophic and hemibiotrophic fungi is becoming firmly established with the release of a wide range of genome sequences. Scanning numerous phytopathogenic fungal genomes we find that most lack CBM1 altogether. In special cases CBM1 can be identified with cellulolytic enzymes from phytopathogenic fungi, however they are found in necrotrophic pathogens. For example, Pyrenophora tritici-repentis, causal agent of tan spot disease of wheat, harbors a glycosyl hydrolase family 61 with a C-terminal CBM1 (accession XP_001936606). This particular fungus has a number of cellulolytic enzymes with CBM 1. Putative cellulolytic proteins with CBM 1 can also be detected in necrotrophic fungi such as Phaeosphaeria nodorum (accession EAT77212) and Verticillium dahliae (accession BQ109945).
Cellulolytic enzymes are not the only catalytic proteins that may contain a CBM1 region. In one very well documented case [12], the phytopathogenic fungus Colletotrichum gloeosporiodes f. sp. malvae was found to express two different pectin lyase genes, one included a CBM1 (accession AF158256). This is of particular interest as this phytopathogen undergoes a transition from hemibiotroph to necrotroph during disease progression. The pectin lyase with a CBM1 was only expressed during the necrotrophic phase.
The apparent negative selection against the presence of proteins with CBM1 motifs in phytopathogenic fungi is most likely due to their elicitor activity when recognized by potential host plants [13]. Plants do not encode CBM1 motifs, thus recognition and response to these motifs would be expected to limit the invasive ability of a fungus. Recent studies on CBEL (Carbohydrate-Binding Elicitor Lectin), a glycoprotein with two CBM1 regions, that is found in numerous Phytophthora species and is included in this genome survey, further supports the idea that CBM1 can act as a type of elicitor form referred to as a “pathogen-associated molecular pattern” or PAMP [8]–[9].
While the lack of elicitation by CBD1 or the synthetic peptide seems contrary to our initial hypothesis that CBM1 is recognized by plants [13], the basis for elicitor activity may reside in the structural subtleties of various CBM1 domains (Figure 5). A mutational analysis of Phytophthora parasitica var. nicotianae CBEL indicated that the tyrosine (Y 52 and Y 188) in each CBM1 was essential for elicitor activity. This tyrosine is conserved in the Trichoderma elicitors endoglucanase 1 (EG1) [13] and swollenin (SW) [14]–[15] as well as P. infestans CBEL. It is also present in P. infestans CBD4, which carries two CBM1 regions and, as with the other Phytophthora proteins containing a CBM1, has no apparent catalytic regions. A homologue of P. infestans CBD4 is found in P. sojae (accession AY183419) and was shown to elicit necrosis when expressed in planta through a Potato Virus X expression vector [16]. The tyrosine is also present in other CBM1 domains that haven't yet been tested for elicitor activity. The specific tyrosine, whose substitution eliminates elicitor activity, is absent in CBD1 from the four species of Phytophthora we have reviewed (Figure 3). Earlier mutational analysis of the CBM1 region from Trichoderma demonstrated that the same tyrosine (referred to as Y32 within the conserved CBM1) affects side chain conformations on the “rough” outer face of the CBM1 [17]–[19]. The inner “smooth” face of CBM 1 is involved in cellulose binding, while the outer face does not interact directly with cellulose. Therefore, while not essential for cellulose binding, this tyrosine plays a role in the three dimensional structure of the CBM1, suggesting that a specific structure must be retained for plant recognition. This further suggests that the cellulose binding activity, per se, may not be important to plant responses.
Figure 5. Comparison of a selection of cellulose binding domain (Carbohydrate Binding Module 1) proteins by alignment of conserved regions.
PiCB1, Phytophthora infestans (CBD1) ABW76417; SpCB1, Saprolegnia parasitica AAZ94039; Pp1a, Pp1b and Pp1c, Porphyra purpurea AAA61792; Ae1a and Ae1b, Aphanomyces euteiches Ae_11AL5933; Scp1a and Scp1b, Schizosaccharomyces pombe NP_593986; Ol1a and Ol1b, Ostreococcus lucimarinus ABO94230; TaSW, Trichoderma asperellum ACB05430; TrEG1, Trichoderma reesei AAA34212; PiCB4a and PiCB4b, Phytophthora infestans (CBD4) ACL80756; PiCBELa and PiCBELb, Phytophthora infestans (CBD5) ACM68430; PuA and PuB, Pythium ultimum (CBD4) ADOS01001693. Arrow indicates previously reported site of mutation of tyrosine residue (ref. 17), found on the outer, non-cellulose binding face of the CBM1 of TrEG1. Designations of a, b and c refer to repeated CBM motifs within the same protein.
It should be noted that while CBM1 can act as an elicitor of plant defenses, the CBM1 needs to be exposed to allow for interaction with a yet undetermined plant molecule. The CBM1 on extracellular, cellulolytic enzymes is fully exposed after secretion and movement away from the microbial source, while the Phytophthora CBM1 containing proteins are wall bound, with no specific evidence that the CBM1 region is protruding or otherwise exposed. While a null response to a Phytophthora CBM1 would indicate that it was not an elicitor, a positive elicitation by introduction of Phytophthora CBM1 proteins as peptides, recombinant proteins or vectored recombinant proteins fail to represent the wall bound nature of these proteins. Therefore Phytophthora may be a successful biotroph during initial host infection by “hiding” the potential elicitor-positive CBM1 domains found in CBD4 and CBD5 in the hyphal wall. The CBD1 protein has a modified CBM1 domain that is “elicitor-negative”, allowing for localization on the surface of the hyphae.
The P. infestans CBD1 protein contains a signal peptide and a region with high probability of O-glycosylation, features suggesting extracellular localization. Proteins with O-glycosylation have been found associated with cell walls although it is unresolved as to whether Phytophthora has the machinery for O-glycosylation [20]. Interestingly, the three CBM1 proteins in Phytophthora infestans that are expressed; CBD1, CBD4 and CBD5 (CBEL), have Phytophthora homologues that have been associated with the cell wall [this study], [ 8, 20,].
Other proteins containing CBM regions have been associated with cell walls. One protein from Schizosaccharomyces pombe (accession NP 593986) contains two CBM1 regions and a GPI anchor, suggesting involvement at the cell membrane:wall interface. Another CBM-containing protein involved in synthesis of the cellulosic stalk of Dictyostelium discoideum (accession EAL 61319) is similar in size to P. infestans CBD1, however it contains a CBM49 [21]–[22]. The Stramenopiles Aphanomyces (www.polebio.scsv.ups-tlse.fr/aphano/) and Saprolegnia have numerous proteins with one or more CBM1 regions [23]–[24] that will likely be found associated with their cell walls. A single protein with two CBM1 regions was found in Pythium ultimum, while none were found in a search of Hyalanoperonospora aradopsidis. Notable is the fact that these proteins do not have a catalytic domain, thus the principal purpose of CBM1 proteins in the Stramenopiles seems to be in cell wall structure. In two organisms with distance relationship to the Stramenopiles [5]–[6], one can find the CBM1 domain. The brown alga Porphyra has a protein with three distinct CBM1 domains [25] and the diatom, Ostreococcus lucimarinus has a protein with two CBM1 modules and a leucine-rich repeat region (accession ABO94230). The additional CBM modules can provide much higher affinity for cellulose [26].
The presence of CBM1 may allow for interaction with cellulose outside of the cell wall. One protein, CBEL, was associated with adhesion to cellulosic substrates, however this protein harbors a lectin-like region that may also contribute to adhesion [27]. In the case of CBD4, as well as for CBEL, there are two CBM1 regions, which may allow for tethering of two separate glucan molecules. It will be interesting to determine where the CBM1 is situated relative to the rest of the protein, and if the CBM1 is embedded or exposed on the hyphal surface.
In addition to a possible role in cell wall synthesis, these proteins may play a role in hyphal permeability. While many fungi can survive in relative dry conditions, Phytophthora is referred to as a “water mold” and thrives under very moist and even aquatic conditions. The water mold fungi lack the wall associated hydrophobins present in other fungi that aid in desiccation survival. They are also more permeable to various compounds, including antibiotics [28]. The CBM1 proteins could play a role in regulating porosity of the hyphae. Another possible function is hyphal protection from enzymatic attack. The Cladosporium fulvum AVR4 protein has been shown to be a chitin binding protein that protects the hyphae from host chitinases during plant infection by binding to the surface of the hyphal wall [29]–[30]. The CBM1 proteins may help protect the overall integrity of the cell wall during attack by plant glucanases, however does not seem to be secreted outside the hyphal wall like AVR4. These proteins may also assist in protecting the cell wall from glucanases produces by saprophytic fungi that attack Phytophthora [31].
Materials and Methods
Culture conditions and inoculations
Liquid cultures of Phytophthora infestans were incubated at 20°C for three weeks in pea broth as previously described [10]. Infected plant tissue was prepared by inoculating detached leaflets of potato (cv. Green Mountain) with sporangia harvested from solid medium cultures as previously described [10]. Leaflets were maintained on moist paper towels in enclosed glass dishes for 5 days. Samples were harvested from infected leaves in the region spanning symptomatic to asymptomatic tissues, and fixed in methanol until further use.
Gene identification and cloning
The carbohydrate binding module (CBM) family 1 motif (www.cazy.org) was used for tBLASTn searches of the genome of Phytophthora infestans (www.broad.mit.edu/annotation/genome/phytophthora_infestans). Additional genes encoding conserved CBM1 domains [32] were identified from searches in GenBank (www.ncbi.nlm.nih.gov/index.html).
The two small CBM1 encoding genes were cloned from P. infestans total RNA, extracted according to manufacturer's protocols for the Illustra kit (GE Healthcare, Buckinghamshire,UK). A cDNA pool was generated from total RNA using Superscript reverse transcriptase (Invitrogen, Carlsbad, CA, USA) and oligo dT reverse primer. DNA copies were generated from cDNA (100 ng) using forward primer cb1f (CGGTCCAAGCAGCACGCAGTCTCCG) and reverse primer cb1r (GGAATCGCTAGAGCTCCAGTCG). The PCR product was generated using Go Taq polymerase (Promega, Madison, WI, USA) with cycle parameters of 93 C for 3 min. followed by 35 cycles of 59 C for 30 sec., 72 C for 1 min., 93 C for 30 sec., and a final cycle of 72 C for 7 min. The product was cloned into TOPO TA cloning vector pCR-4 (Invitrogen) and transformed into E. coli. Plasmids were isolated from overnight shake cultures of transformed E. coli and sequenced.
Antibodies and immunolocalization
The amino terminal portion of the processed protein was chosen as the antigenic target. The peptide sequence SNLRNGDSSVPVRT-C was synthesized and used to raise antibodies in rabbits (GenScript Corp., Piscataway, New Jersey, USA) with a final ELISA titer of 1∶6000.
Infected leaf tissue sections were rehydrated after methanol fixation by transfer to 50 mM Tris (pH 7.0). Samples were placed on concave microscope slides and incubated for 1 h at room temperature in Tris buffer (pH 7.0) plus 50 mM NaCl and 0.1% bovine serum albumin. Buffer was removed with an absorbent tissue and replaced with fresh buffer plus rabbit anti-CBD1 peptide (1∶300 dilution). Control samples were incubated with pre-immune serum. Samples were incubated for one hour, buffer removed and the sample rinsed three times for five minutes with fresh buffer. Secondary goat anti-rabbit, FITC labeled antibodies (Sigma, St. Louis, MO, USA) were added at a 1∶400 dilution and incubated for one hour. Samples were rinsed as previous and maintained in fresh buffer for confocal microscopy.
Cell wall isolation and extraction
Harvested mycelial mats (3 g wt weight per sample) were rinsed twice by immersion in 30 ml of distilled water, and retained in 30 ml of distilled water on ice. Hyphae were comminuted for 1 min. with a Polytron homogenizer (Brinkmann, Westbury, NY, USA). Hyphal fragments were pelleted (3000 g, 10 min) followed by resuspension in 10 ml distilled water. The sample was sonicated for 20 sec. (Sonic Materials, Danbury, CT, USA ) followed by pelleting of hyphal fragments. The sample was washed with 40 ml distilled water and pelleted, subjected to a second round of sonication, washing and pelleting. The final samples, comprised of purified hyphal walls, were then used for extraction of wall-bound protein.
Each final sample (2.5 g wt weight) was extracted by individual extraction methods. Alkaline extraction was performed overnight at 4 C in 15 ml of 30 mM NaOH (pH 11.5), or 0.1 M Tris base (pH 9.5). Cellulose binding domain elution methods were performed overnight at 4 C in 15 ml using 10% polyethylene glycol or 0.25 M NaCl. Samples were also boiled for 5 min in 15 ml of 10% sodium dodecyl sulfate.
Samples from each treatment were pelleted (3000 g, 10 min) and the supernatant (10 ml) transferred to clean 50 ml polypropylene tubes. Ice-cold acetone (30 ml) was added to each supernatant, and tubes placed in a freezer (−20 C) overnight. Samples were centrifuged and the pellet was air dried.
Samples were resuspended in 0.2 ml Tris (pH 6.0), and 25 microliters added to an equal volume of Laemmeli buffer and placed in boiling water for 5 min. Samples were briefly centrifuged and loaded onto 4–20% gradient acrylamide gels (Life Therapeutics, Frenchs Forest NSW, Australia). Gels were run for three hours at 75 V, followed by electroblotting (3 h at 75 V) to nitrocellulose. Western blots were blocked with TBS plus 0.1% bovine serum albumin, incubated with anti-CBD1, rinsed and incubated with alkaline phosphatase labeled secondary antibody (Pierce, Rockford, IL, USA). After rinsing in Tris (pH 9.5) bands were detected by addition of Western Blue AP substrate (Promega).
Expression in plant leaf by Agrobacterium infiltration
The TOPO-cbd1 plasmid (10 ng) was used with Xba1 containing forward primer cbfa (TCTAGACCTTTAGCCATAATGACC) and the Sac1 containing reverse primer cbra (GAGCTCTCACAACTCCAGTCGAATGAC). A PCR product was generated using Go Taq polymerase (Promega) and amplification performed with cycle parameters of 93 C for 2 min. followed by 35 cycles of ; 53 C for 30 sec., 72 C for 1 min., 93 C for 30 sec., and a final cycle of 72 C for 7 min. The product was cloned into TOPO TA cloning vector (Invitrogen, Carlsbad, CA, USA) and transformed into E. coli. Plasmid was isolated from overnight cultures of transformed E. coli and digested with Xba1 and Sac1 (Fermentas, Baltimore, MD, USA). The shuttle vector pBI121 (Invitrogen) was also digested with Xba1 and Sac1, releasing the beta-glucuronidase coding region. The restriction digested pBI121 was gel purified, along with the restriction digested CBD-encoding insert. The cbd insert was ligated into pBI121 and electroporated into Agrobacterium tumefaciens LBA4404 (Invitrogen). Cells were infiltrated with a syringe into the apoplast of leaves from tobacco (Nicotiana tabacum) and potato (Solanum tuberosum).
Synthetic peptide infiltration
A synthetic peptide of 36 amino acids (GVRAWAQCGGLYYLGKTKCQQHTFCKQLSEFISVCF) spanning the conserved cellulose binding domain region (aa. 80–116) was synthesized (GenScript). This region encompasses the full CBM1. Peptide was dissolved in 50 mM sodium acetate pH 5.0 to a final concentration of 500 nM and infiltrated into the apoplast of leaves from tobacco and potato, using a needle-free syringe.
Footnotes
Competing Interests: The authors have declared that no competing interests exist.
Funding: Funding for this study was obtained from ongoing budgeted federal funding of the United States Department of Agriculture Agriculture Research Service program. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1.Boraston AB, Bolam DN, Gilbert HJ, Davies GJ. Carbohydrate-binding modules: fine-tuning polysaccharide recognition. Biochem J. 2004;382:769–781. doi: 10.1042/BJ20040892. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Lehtio J, Sugiyama J, Gustavsson M, Fransson L, Linder M, et al. The binding specificity and affinity determinants of family 1 and family 3 cellulose binding modules. Proc Natl Acad Sci. 2003;100:484–489. doi: 10.1073/pnas.212651999. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Wang H, Jones RW. A unique endoglucanase-encoding gene cloned from the phytopathogenic fungus Macrophomina phaseolina. Appl Environ Microbiol. 1995;61:2004–2006. doi: 10.1128/aem.61.5.2004-2006.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Wang H, Jones RW. Cloning, characterization and functional expression of an endoglucanase-encoding gene from the phytopathogenic fungus Macrophomina phaseolina. Gene. 1995;158:125–128. doi: 10.1016/0378-1119(95)00094-m. [DOI] [PubMed] [Google Scholar]
- 5.Tyler B, Tripathy S, Xuemin Z, Dehal P, Jiang R, et al. Phytophthora genome sequences uncover evolutionary origins and mechanisms of pathogenesis. Science. 2006;313:1261–1266. doi: 10.1126/science.1128796. [DOI] [PubMed] [Google Scholar]
- 6.Hass B, Kamoun S, Zody MC, Jiang RH, Handsaker RE, et al. The genome sequence of the Irish potato famine pathogen Phytophthora infestans. Nature. 2009;461:393–398. 2009. doi: 10.1038/nature08358. [DOI] [PubMed] [Google Scholar]
- 7.Farkas V. Biosynthesis of cell walls of fungi. Microbiol Rev. 1979;43:117–144. doi: 10.1128/mr.43.2.117-144.1979. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Mateos FV, Rickauer M, Esquerre-Tugaye M-T. Cloning and characterization of a cDNA encoding an elicitor of Phytophthora parasitica var. nicotianae that shows cellulose-binding and lectin-like activities. Mol Plant Microb Interact. 1997;10:1045–1053. doi: 10.1094/MPMI.1997.10.9.1045. [DOI] [PubMed] [Google Scholar]
- 9.Gaulin E, Drame N, Lafitte C, Torto-Alalibo T, Martinez Y, et al. Cellulose binding domains of a Phytophthora cell wall protein are novel pathogen-associated molecular patterns. Plant Cell. 2006;18:1766–1777. doi: 10.1105/tpc.105.038687. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Costanzo S, Ospina-Giraldo MD, Deahl KL, Baker CJ, Jones RW. Gene duplication event in family 12 glycosyl hydrolase from Phytophthora spp. Fungal Genet Biol. 2006;43:707–714. doi: 10.1016/j.fgb.2006.04.006. [DOI] [PubMed] [Google Scholar]
- 11.Costanzo S, Ospina-Giraldo MD, Deahl KL, Baker CJ, Jones RW. Alternate intron processing of family 5 endoglucanase transcripts from the genus Phytophthora. Curr Genetics. 2007;52:115–123. doi: 10.1007/s00294-007-0144-z. [DOI] [PubMed] [Google Scholar]
- 12.Wei Y, Shih J, Li J, Goodwin PH. Two pectin lyase genes, pnl-1 and pnl-2, from Colletotrichum gloeosporioides f.sp. malvae differ in a cellulose-binding domain and in their expression during infection of Malva pusilla. Microbiol. 2002;148:2149–2157. doi: 10.1099/00221287-148-7-2149. [DOI] [PubMed] [Google Scholar]
- 13.Wang H, Jones RW. Analyzing the role of a cellulose binding domain in fungal:plant interactions. Phytopathology. 1996;86:S91. [Google Scholar]
- 14.Saloheimo M, Paloheimo M, Hakola S, Pere J, Swanson B, et al. Swollenin, a Trichoderma reesei protein with sequence similarity to plant expansins, exhibits disruption activity on cellulosic materials. Eur J Biochem. 2002;269:4202–4211. doi: 10.1046/j.1432-1033.2002.03095.x. [DOI] [PubMed] [Google Scholar]
- 15.Brotman Y, Briff E, Viterbo A, Chet I. Role of swollenin, an expansin-like protein from Trichoderma, in plant colonization. Plant Physiol. 2008;147:779–789. doi: 10.1104/pp.108.116293. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Qutob D, Kamoun S, Gijzen M. Expression of a Phytophthora sojae necrosis-inducing protein occurs during transition from biotrophy to necrotrophy. Plant J. 2002;32:361–373. doi: 10.1046/j.1365-313x.2002.01439.x. [DOI] [PubMed] [Google Scholar]
- 17.Linder M, Mattinen ML, Kontteli M, Lindenerg G, Stahlberg J, et al. Identification of functionally important amino acids in the cellulose-binding domain of Trichoderma reesei cellobiohydrolase I. Protein Sci. 1995;4:1056–1064. doi: 10.1002/pro.5560040604. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Hoffren A-M, Teeri T, Teleman O. Molecular dynamics simulation of fungal cellulose-binding domains:differences in molecular rigidity but a preserved cellulose binding surface. Protein Engineer. 1995;8:443–450. doi: 10.1093/protein/8.5.443. [DOI] [PubMed] [Google Scholar]
- 19.Mattinen ML, Kontteli M, Kerovuo J, Linder M, Annila A. Three-dimensional structures of three engineered cellulose-binding domains of cellobiohydrolase I from Trichoderma reesei. Protein Sci. 1997;6:294–303. doi: 10.1002/pro.5560060204. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Meijer HJG, van de Vondervoort PJI, Yin Q-Y, de Koster CG, Klis FM, et al. Identification of cell wall-associated proteins from Phytophthora ramorum. Mol Plant Microb Interact. 2006;19:1348–1358. doi: 10.1094/MPMI-19-1348. [DOI] [PubMed] [Google Scholar]
- 21.Wang Y, Slade MB, Gooley AA, Atwell BJ, Williams KL. Cellulose-binding modules from extracellular matrix proteins of Dictyostelium discoideum stalk and sheath. Eur J Biochem. 2001;268:4334–4345. doi: 10.1046/j.1432-1327.2001.02354.x. [DOI] [PubMed] [Google Scholar]
- 22.Metcalf T, Kelley K, Erdos GW, Kaplan L, West CM. Formation of the outer layer of the Dictyostelium spore coat depends on the inner-layer protein SP85/PsB. Microbiol. 2003;149:305–317. doi: 10.1099/mic.0.25984-0. [DOI] [PubMed] [Google Scholar]
- 23.Torto-Alalibo T, Tian M, Gajendran K, Waugh ME, van West P, et al. Expressed sequence tags from the oomycete fish pathogen Saprolegnia parasitica reveal putative virulence factors. BMC Microbiol. 2005;5:46. doi: 10.1186/1471-2180-5-46. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Gaulin E, Madoui M-A, Bottin A, Jacquet C, Mathe C, et al. Transcriptome of Aphanomyces euteiches:new oomycete putative pathogenicity factors and metabolic pathways. PLoS ONE. 2008;3:e1723. doi: 10.1371/journal.pone.0001723. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Liu Q-Y, Ross N, Lanthier P, Reith M. A gametophyte cell wall protein of the red alga Porphyra purpurea contains four apparent polysaccharide-binding domains. J Phycol. 1996;32:995–1003. [Google Scholar]
- 26.Linder M, Salovuori I, Ruohonen L, Teeri T. Characterization of a double cellulose-binding domain. J Biol Chem. 1996;35:21268–21272. doi: 10.1074/jbc.271.35.21268. [DOI] [PubMed] [Google Scholar]
- 27.Gaulin E, Jauneau A, Villalba F, Rickauer M, Esquerre-Tugaye M-T, et al. The CBEL glycoprotein of Phytophthora parasitica va. nicotianae is involved in cell wall deposition and adhesion to cellulosic substrates. J Cell Sci. 2002;115:4565–4575. doi: 10.1242/jcs.00138. [DOI] [PubMed] [Google Scholar]
- 28.Jones RW, Hancock JG. Mechanism of gliotoxin action and factors mediating gliotoxin sensitivity. J Gen Microbiol. 1988;134:2067–2075. [Google Scholar]
- 29.Westerink N, Roth R, van den Burg HA, de Wit PJGM, Joosten MHAJ. The AVR4 elicitor protein of Cladosporium fulvum binds to fungal components with high affinity. Mol Plant Microb Interact. 2002;15:1219–1227. doi: 10.1094/MPMI.2002.15.12.1219. [DOI] [PubMed] [Google Scholar]
- 30.van den Burg HA, Harrison SJ, Joosten MHAJ, Vervoot J, de Wit PJGM. Cladosporium fulvum Avr4 protects fungal cell walls against hydrolysis by plant chitinases accumulating during infection. Mol Plant Microb Interact. 2006;19:1420–1430. doi: 10.1094/MPMI-19-1420. [DOI] [PubMed] [Google Scholar]
- 31.Picard K, Tirilly Y, Benhamou N. Cytological effects of cellulases in the parasitism of Phytophthora parasitica by Pythium oligandrum. Appl Environ Microbiol. 2000;66:4305–4314. doi: 10.1128/aem.66.10.4305-4314.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Marchler-Bauer A, Anderson JB, Derbyshire MK, DeWeese-Scott C, Gonzales NR, et al. CDD: a conserved domain database for interactive domain family analysis. Nucl Acid Res. 2007;35:D237–240. doi: 10.1093/nar/gkl951. [DOI] [PMC free article] [PubMed] [Google Scholar]





