Skip to main content
PLOS ONE logoLink to PLOS ONE
. 2011 Oct 26;6(10):e26540. doi: 10.1371/journal.pone.0026540

Peptide Fingerprinting of Alzheimer's Disease in Cerebrospinal Fluid: Identification and Prospective Evaluation of New Synaptic Biomarkers

Holger Jahn 1,*,#, Stefan Wittke 2,3,#, Petra Zürbig 2, Thomas J Raedler 1,4, Sönke Arlt 1, Markus Kellmann 5, William Mullen 6, Martin Eichenlaub 1, Harald Mischak 2,6, Klaus Wiedemann 1
Editor: Koichi M Iijima7
PMCID: PMC3202544  PMID: 22046305

Abstract

Background

Today, dementias are diagnosed late in the course of disease. Future treatments have to start earlier in the disease process to avoid disability requiring new diagnostic tools. The objective of this study is to develop a new method for the differential diagnosis and identification of new biomarkers of Alzheimer's disease (AD) using capillary-electrophoresis coupled to mass-spectrometry (CE-MS) and to assess the potential of early diagnosis of AD.

Methods and Findings

Cerebrospinal fluid (CSF) of 159 out-patients of a memory-clinic at a University Hospital suffering from neurodegenerative disorders and 17 cognitively-healthy controls was used to create differential peptide pattern for dementias and prospective blinded-comparison of sensitivity and specificity for AD diagnosis against the Criterion standard in a naturalistic prospective sample of patients. Sensitivity and specificity of the new method compared to standard diagnostic procedures and identification of new putative biomarkers for AD was the main outcome measure. CE-MS was used to reliably detect 1104 low-molecular-weight peptides in CSF. Training-sets of patients with clinically secured sporadic Alzheimer's disease, frontotemporal dementia, and cognitively healthy controls allowed establishing discriminative biomarker pattern for diagnosis of AD. This pattern was already detectable in patients with mild cognitive impairment (MCI). The AD-pattern was tested in a prospective sample of patients (n = 100) and AD was diagnosed with a sensitivity of 87% and a specificity of 83%. Using CSF measurements of beta-amyloid1-42, total-tau, and phospho181-tau, AD-diagnosis had a sensitivity of 88% and a specificity of 67% in the same sample. Sequence analysis of the discriminating biomarkers identified fragments of synaptic proteins like proSAAS, apolipoprotein J, neurosecretory protein VGF, phospholemman, and chromogranin A.

Conclusions

The method may allow early differential diagnosis of various dementias using specific peptide fingerprints and identification of incipient AD in patients suffering from MCI. Identified biomarkers facilitate face validity for the use in AD diagnosis.

Introduction

In an aging population dementias are a serious threat. Currently 30 million people worldwide suffer from Alzheimer's disease (AD) and the World Health organization projects that this number will triple over the next 20 years [1]. The cumulative incidence of AD has been estimated to rise from about 5% by age 70 to 50% by age 90 [2]. The clinical diagnosis of dementias is established late in the course of the disease process with poor sensitivity and specificity [3][5]. According to current diagnostic criteria, AD cannot be diagnosed before the disease has progressed so far that clinical dementia is present. The disease process, however, probably starts 20–30 years before first clinical signs emerge [6]. Hence we are in need of new diagnostic tools that are capable of detecting pre-clinical signs of neurodegenerative disorders. Recently different new analytical proteomic technologies like mass spectrometry coupled with protein separation or protein microarrays that can be applied on cerebrospinal fluid (CSF) have been developed to study proteins in neuroscience [7]. Due to the intimate relation between brain function and CSF composition, pathological brain-processes are more likely to be reflected in CSF than in other body-fluids (e.g. blood or urine). Since more than 70% of the CSF-proteins are isoforms of albumin, transferrin and immunoglobulines [8], and due to technical limitations only few studies have focused on the composition of proteins in CSF in the past [9]. Nonetheless an enormous wealth of information regarding pathological processes should be present in the less abundant CSF-proteins and the identification of changes in CSF composition at that level beside the current disease models would promote the understanding of the various dementias and their fundamental pathological processes. Such valid new biomarkers for AD could also serve as surrogate markers in detecting treatment effects while any earlier identification of AD patients is another goal to enable the development of treatments that stop or postpone the disease processes.

We report proteome analysis of CSF using capillary electrophoresis coupled to an electrospray ionisation time of flight mass spectrometer (CE-MS) and its potential use in the diagnosis of AD and other dementias. This approach allows the comprehensive analysis of low molecular weight peptides and protein fragments present in biological fluids in a single time-limited step. The method was already successfully applied to the examination of human urine for the differential diagnosis of renal diseases [10][13], the diagnosis of prostate or urothelial cancer [14][16], ureteropelvic junction obstruction [17], and rejection of renal transplants [18] demonstrating the broad application spectrum of this new technique that also allows the comparison of biomarker sequencing data by use of different mass spectrometer types [19]. In addition we already implemented the recommendations for studies in clinical proteomics that were recently formulated by experts in the field [20] to avoid pitfalls and circumvent methodological problems that became apparent in earlier studies in this fast developing field of science.

Methods

Ethics Statement

The study was approved by the ethics committee of the “Ärztekammer Hamburg, Germany” and all patients and/or their relatives gave written informed consent and all clinical investigations have been conducted according to the principles expressed in the Declaration of Helsinki. Furthermore, the University Hospital Hamburg-Eppendorf has carried out all investigations according to international Good Laboratory Practice (GLP) and Good Clinical Practice (GCP) standard.

Patient characteristics

Between April 2002 and December 2005 176 patients referred to the memory clinic of the University Hospital Hamburg-Eppendorf were recruited for this study. All patients underwent a diagnostic work-up and were diagnosed according to ICD-10 and the National Institute of Neurological and Communicative Disorders and the Stroke-Alzheimer's Disease and Related Disorders Association criteria (NINCDS-ADRDA) to identify patients with vascular dementia [21], [22]. MCI diagnoses were made according to the criteria of Petersen [23] and FTD was diagnosed according to the Lund–Manchester criteria [24]. The structure of cognitive dysfunction was assessed with a neuropsychological test battery allowing the identification of MCI subtypes. Distinction of MCI and dementia was based on CDR rating (see Table S3 for neuropsychological tests). Patients underwent lumbar puncture for diagnostic purposes. In a first step CSF of 17 control samples of cognitively healthy volunteers (these persons underwent a lumbar puncture in connection with a knee arthroscopy and agreed to obtain an additional cognitive testing apart from allowing to collect some CSF during peridural anaesthesia), 34 samples of patients with a clinical diagnosis of sporadic AD, 12 samples of patients with FTD and 13 samples of patients with schizophrenia ( Table 1 ) was analyzed to establish disease specific peptide patterns. The clinical diagnoses of these training cases were supported by laboratory and image data from magnetic resonance imaging (MRI) and positron emission tomography (PET). The training set patients were selected to have no other major medical comorbidity. In a second step 100 patients (51 female, 49 male; mean age 65.3±12.3 years) (Table S2) with memory complaints were recruited for a prospective sample cohort, CSF was analysed to obtain a diagnosis and patients were clinically followed. These patients suffered from various dementias, MCI or memory complains of other causes. A few had further medical comorbidities like hypertension or diabetes type II or a history of insults or encephalitis.

Table 1. Demographic data of training sets.

Group Number Male Female Age [years±SD] MMSE [mean±SD]
Controls 17 13 4 58.9±11,5 30.0±0.0
AD Training set 34 14 20 69.0±6.5 21.2±5.1
FTD Training set 12 4 8 65.6±7.9 22.4±2.5
Schizophrenia set 13 5 8 38.1±14.4 29.6±0.7

Baseline data of training sets for cognitively healthy controls and trainings sets for AD, FTD and schizophrenia. Given are numbers for gender, and the averages for age and the scores of the Mini Mental State Examination (MMSE).

Cerebrospinal fluid samples

Cerebrospinal fluid (CSF) was obtained by lumbar puncture in a sitting position according to standard procedures [25]. After collection of the 4 mL CSF for routine diagnosis, additional 5 ml of the CSF was sampled for this study into a polypropylene test tube. The CSF was centrifuged immediately after collection (1600 g, 4°C, 15 min), aliquoted into polypropylene test tubes (each aliquot, 750 µL), frozen within 30–40 min after the puncture and stored at −80°C until use. The CSF was at no time thawed/refrozen. After thawing, 700 µL of CSF were diluted with 700 µL buffer (pH 10.5; 2 M urea, 100 mmol/L NaCl, 0.0125% NH3; Sigma-Aldrich, Taufkirchen, Germany) and ultracentrifugated using Centrisart ultrafiltration devices (cut off 20 kDa, Sartorius, Göttingen, Germany) at 4°C until 1.1 mL of filtrate was obtained. Subsequently the filtrate was applied onto a PD-10 desalting column (Amersham Bioscience, Uppsala, Sweden) equilibrated in 0.01% NH4OH in HPLC-grade in water (Roth, Germany) to decrease matrix effects by removing urea, electrolytes, salts, and to enrich peptides present. Finally the eluate was lyophilized stored at 4°C and resuspended in 10 µL HPLC-grade water before CE-MS analysis.

Since blood contaminations may affect the proteome of CSF [26] we controlled our CSF samples for traces of haemoglobin and the presence of erythrocytes by microscopy of a centrifuged CSF sample. Using these two methods we can exclude any blood contamination of our CSF samples above 0.001% by that controlling a potential serious confounder of CSF biomarker studies with regard to proteins abundant in plasma.

Immunochemistry

The CSF levels of Aß42, total tau, and phospho181-tau were measured using commercial ELISAs (Innogenetics, Ghent, Belgium) according to the manufacturer's protocol. Cut-off values for AD suspicious biomarker concentrations were >540 pg/ml for total-tau, >61 pg/ml for phospho181-tau and beta-amyloid1–42 values <240+1.18×total-tau pg/ml [4].

CE-MS

CE-MS analysis was performed as described using a P/ACE MDQ (Beckman Coulter, Fullerton, USA) system on-line coupled to a Micro-TOF MS (Bruker Daltonic, Bremen, Germany) [15][17].

Reproducibility and comparability

Analytical characteristics such as accuracy, mass accuracy, traceability and repeatability of the CE-MS application were recently described [15], [27]. Thus, here we report about additional precision tests to underline the validity of the analytical data. Initially the sampling procedure was validated by fractionated extraction of six aliquots of CSF from one patient. Figure S1 shows the protein contour plots of 4 different fractions. Classification of each fraction resulted in the same and correct classification as AD. We re-measured 10 samples twice and again all samples were classified correctly (Table S4). We were also able to re-puncture one patient with an AD pattern. The AD pattern was found again and stable after one year. Finally the reproducibility of the CE-MS approach is emphasized (Figure S2). Distinct lines (four to six) are visible in the peptide pattern due to the charge per peptide, which can be ascribed to the peptide structure (number of basic amino acids) and consequently allow the comparison of biomarker sequencing data even by use of different mass spectrometer types coupled with CE or liquid chromatography (LC) [19].

Data processing and cluster analysis

Mass spectral ion peaks representing identical molecules at different charge states were deconvoluted into single masses using MosaiquesVisu [27]. In addition the migration time and ion signal intensity (amplitude) were normalized using internal peptide standards [27], [28]. The resulting peak list characterizes each peptide by its molecular mass (in Dalton), normalized CE-migration time (in minutes), and normalized signal intensity. All detected peptides were deposited, matched, and annotated in a Microsoft SQL database, allowing further analysis and comparison of multiple samples (patient groups) (Table S5). Peptides within different samples were considered identical if the mass deviation was less than 100 ppm and the migration time deviation was less than 1 min.

To define biomarker patterns we employed the following stringent quality control and selection criteria to avoid artefacts as well as to attain high levels in reproducibility and specificity: 1) the MS peaks list must contain 800–1400 peptides; 2) the normalized mean signal amplitude of each marker peptide must be >25 counts in one diagnostic group; 3) the frequency of occurrence (FOC) of each candidate biomarker must be >40% in one of the groups defined above; 4) the difference in the FOC between the two groups must be either >30% or, 5) if the difference in the FOC is less than 30%, the mean amplitude in one diagnostic group must be >1.4-fold higher compared to the other group and the FOC of the selected amplitude biomarker must be >70% in the diagnostic group with the higher mean amplitude.

Employing these criteria, a list of pre-defined peptides was obtained by the comparison of all available data sets (e.g. control vs. AD, FTD, schizophrenia patients, respectively) with MosaCluster software package [13]. The pre-defined set of peptides was further validated by randomly excluding 30% of available samples. This procedure was repeated 5 times to utilize markers (preliminary biomarker pattern) with consistently high discriminative value. Subsequently the preliminary biomarker patterns were refined by employing an unadjusted p-value limit of 0.01 and using one-out cross-validation to attain high sensitivity and specificity. This approach resulted in the definition of biomarker patterns consisting of 10–20 biomarkers.

Tandem sequencing

Tandem (MS/MS) sequencing was performed using Orbitrap instruments (Thermo Finnigan, Bremen, Germany). Orbitrap experiments were performed on a Dionex Ultimate 3000 nanoflow system connected to an LTQ Orbitrap hybrid mass spectrometer (Thermo Electron, Bremen, Germany) equipped with a nanoelectrospray ion source. Binding and chromatographic separation of the peptides took place on a fused silica nanocolumn (10 cm; 75-µm i.d.; C18, 5 µm; NanoSeparations, Nieuwkoop, Netherlands). The MS was operated in data-dependent mode to automatically switch between MS and MS/MS acquisition. Full scan MS spectra (from m/z 300–2000) were acquired in the Orbitrap with resolution R = 60,000 at m/z 400 (target value of 500,000 charges in the linear ion trap).

Statistical Analysis

To verify the diagnostic value of the potential biomarkers pre-selected by the criteria mentioned above, raw p-values (so called unadjusted p-values) were calculated using the natural logarithm transformed intensities and the Gaussian approximation to the t-distribution, both implemented as macros in the commercial statistical package SAS (SAS Institute, Cary, NC; www.sas.com). Estimates of sensitivity and specificity were calculated based on tabulating the number of correctly classified samples. The receiver operating characteristic (ROC) curve was obtained by plotting all sensitivity values (true positive fraction) on the y axis against their equivalent (1-specificity) values (false positive fraction) for all available thresholds on the x-axis (MedCalc Software, Mariakerke, Belgium, www.medcalc.be). The area under the ROC curve (AUC) was evaluated as it provides a single measure of overall accuracy that is not dependent upon a particular threshold. After the best suited biomarkers are selected disease specific biomarker patterns (model) were established and the internal sensitivity and specificity for the training set were determined by leave one-out cross-validation analysis as described [15].

Due to the difference of the mean age between the training sets for the control cohort and patients suffering on Alzheimer's disease we verified if the AD-pattern is related to age or not. For this purpose the control group was divided into two subgroups, whereas the first group consisted of controls aged 61 or younger (n = 10; mean age 54±12) and the second group of patients aged 63 or older (n = 7, mean age 65±4).

Adapting the AD-biomarker pattern to these two subgroups resulted in a misclassification rate of 43% after cross-validation. Hence the AD-biomarker pattern used in this study is not capable to discriminate between the two subgroups and therefore an age related inconsistency in the pattern is unlikely.

Results

CSF-samples were investigated using CE-MS with the aim to define a panel of disease-specific biomarkers that allow the identification and prospective diagnostic labelling of patients with various dementias, mild cognitive impairment (MCI) and their separation from healthy controls (for demographic data see Table 1 ).

Development of disease specific peptide patterns

In each sample we were able to tentatively identify >800 different peptides based on migration time and mass, with molecular weights ranging from 0.8 to 20 kDa. The data from the individual CE-MS analyses were compiled and specific biomarker patterns for AD, FTD and schizophrenia were developed with emphasis on a panel of biomarkers that should enable to detect AD-cases based solely on peptides in CSF.

Figure 1A shows the compiled data of 34 measurements of CSF from patients with sporadic Alzheimer's disease, while Figure 1B shows the data for the healthy controls from our training sets.

Figure 1. Contour-plots of the training set.

Figure 1

A) Compiled 3-D protein contour plot from CSF samples of 34 patients with Alzheimer's disease. The normalized CE-migration time (in min) is plotted on the x-axis and the relative molecular mass (in kDa) on the y-axis. As a third dimension, the signal intensity is colour coded (blue lowest and white highest signal intensity). Each dot represents one peptide. B) Compiled 3-D protein contour plot for healthy controls (n = 17). C) Discriminative biomarker pattern for subjects suffering from Alzheimer's disease (n = 34). Depicted is a 3-D plot of 12 peptides that serve as specific biomarkers for AD brain damage. The normalized CE-migration time (in min) is plotted on the x-axis and the relative molecular mass (in Da) on the y-axis. As a third dimension, the signal intensity is colour coded.

For the identification of AD specific peptides, analyses of these data with MosaCluster yielded 131 potentially biomarkers (Table S1), which fulfil the defined selection criteria (see Methods section “Data processing and cluster analysis”). Given the number of cases and controls available, the pattern of 131 potential biomarkers was refined by statistical testing and employing an unadjusted p-value limit of 0.01, resulting in a preliminary diagnostic pattern of 35 potential biomarkers (Table S1, see bold marked peptides). Subsequently the preliminary pattern was iteratively refined by eliminating one potential biomarker and utilizing leave-one-out cross-validation for verification (while maintaining high sensitivity and specificity). Leave-one-out cross validation uses a single sample as the validation data and the remaining samples as the training data. Each sample is used once as the validation data, giving an indication of how well the training set will perform when it is applied on unknown samples. This approach yielded a final diagnostic pattern (“AD-pattern”) based on 12 discriminatory peptides ( Figure 1C ). Utilizing support vector machines the AD-pattern allowed correct classification of 31/34 AD and 15/17 control samples, thus a sensitivity of 91% and specificity of 88%. The data including the AUC of the receiver operating characteristic (ROC) for these 12 biomarkers are shown in Table 2 and Figure 2 . The overall AUC for this biomarker pattern in the training set was calculated as 0.979 (95% CI: 0.893–0.997; p-value = 0.0001) pointing towards the potential of this multidimensional approach.

Table 2. Peptide pattern identifying AD.

Peptide identification Frequency by group [%] Mean amplitude
Protein ID Mass [Da] CE-time [min] AD Control AD Control AUC
11229 1196.36 36.37 0.32 0.71 46658 49517 0.70
35146 1387.07 20.42 0.18 0.47 144 119 0.65
35998 1390.49 36.26 0.50 0.12 298 88 0.71
77519 2179.03 25.31 0.76 0.35 85 32 0.83
78842 2214.22 26.48 0.85 0.29 149 83 0.84
86638 2423.19 27.03 0.62 0.18 48 47 0.72
95324 2706.37 28.30 0.74 0.24 130 120 0.75
102634 3068.46 30.03 0.76 0.29 185 84 0.81
110596 3401.73 23.48 1.00 1.00 2557 4518 0.82
130889 4005.54 22.57 0.71 0.41 582 400 0.69
131863 4036.30 24.92 0.71 0.24 373 250 0.75
160599 5582.16 24.30 0.41 0 283 0 0.71

Shown are unique internal protein-IDs, mass, CE-migration time, observed frequency of occurrence, the corresponding mean amplitudes, and AUC values (as a biomarker quality measure) for the final peptide panel. Five peptides, which are marked in bold, are already identified (see Table 4 ).

Figure 2. Peptide pattern identifying AD.

Figure 2

Shown are the ROC analyses of all biomarkers. In the table unique internal protein-ID, mass, CE-migration time, observed frequency of occurrence, the corresponding mean amplitudes, and AUC values (as a biomarker quality measure) in the different groups for the final peptide panels. Five peptides, which are marked in yellow, are already identified ( Table 4 ).

Subsequently this approach was also used to establish biomarker patterns for FTD (14 discriminatory peptides; data not shown) and schizophrenia (14 discriminatory peptides; data not shown). In the case that more than one disease specific pattern scores positive the use of differential diagnostic patterns is required for a final classification. Thus differential diagnostic patterns for AD versus FTD and AD versus schizophrenia based on the disease specific biomarkers have also been established.

Blinded evaluation of prospectively collected samples

Using the defined patterns a blinded evaluation of additional prospective collected samples of 100 individuals followed. Whereas all non-AD samples in this study were used as disease controls, the blinded and prospective group consisted of samples from patients with multiple neurodegenerative disorders like MCI, vascular dementia, Parkinson's dementia, FTD, depression or other dementia syndromes. Given the need to differentiate against other forms of dementia and also other neuropsychological diseases, a hierarchical model for the classification of the blinded and prospectively collected samples was established. For this issue, in a first step the biomarker patterns for AD, FTD, and schizophrenia are applied onto the unknown sample for classification. If more than one disease-pattern scores positive differential diagnostic patterns are used for final classification. By this approach we circumvent the methodological problems of several investigations in proteomic research, which compare only two diagnostic groups [29], [30].

Our method using the defined peptide pattern showed a sensitivity of 87% and a specificity of 83% for the diagnosis of AD of the prospective samples (Table S2). Using CSF measurements of beta-amyloid1–42, total-tau and phospho181-tau, AD diagnosis had a sensitivity of 88% and a specificity of 67% in our clinical cohort. Interestingly, four patients diagnosed with primary progressive aphasia were classified as positive for both FTD and AD patterns.

Epidemiological studies have documented the accelerated rate of progression to dementia and AD in subjects with MCI. However, many MCI cases will never develop dementia [23]. To date there is no accepted clinical method to classify which MCI cases will progress to AD.

32 cases (17 male, 15 female; age: 66.1±6.6 years; MMSE: 27.8±1.9; values as mean ± SD) in the blinded set were originally diagnosed with MCI. After lumbar puncture the patients were clinically followed up for a mean of 57±7 months (mean ± SD; max 72, min 41 months). Twenty-one patients scored positive for the AD pattern, 11 patients scored negative for the AD pattern. The clinical outcome is shown in Table 3 . In summary, the MCI cases with a positive AD pattern did clinically worse and showed a high conversion rate to AD. Furthermore, from 16 patients with a multi-domain or amnestic MCI, a diagnosis related to a higher risk of developing AD, 14 patients displayed a positive AD pattern in CSF. From the remaining 16 other MCI cases, only 7 patients showed a positive AD pattern. Using the Chi square test this difference is significant (p = 0.0255; p-value with continuity correction) pointing to an association of the former MCI subtypes with an AD pattern in CSF in our cohort.

Table 3. Clinical outcome of MCI cases by peptide pattern.

Number AD OD MCI Remitter
Positve AD-Score 21 14 0 7 0
Negative AD-score 11 2 1 5 3

Clinical outcome of MCI cases (n = 32) followed up for a mean of 57 months. MCI cases with a positive score for the AD-pattern (n = 21) or a negative score for the AD-pattern (n = 11) according to our peptide panel. From 21 MCI patients originally identified as having a positive score for the AD pattern in CSF, only 7 patients are still clinically diagnosed with MCI, while 14 progressed into clinical AD. The other MCI group with negative score for the AD pattern showed a different outcome. Here only 2 patients progressed into AD so far, while 5 patients are still diagnosed with a stable MCI, one patient progressed into a vascular dementia (other dementia, OD), and 3 patients developed a complete remission of cognitive symptoms.

Identification of biomarkers

In Table 4 the identified peptide sequences out of the initial list of 131 potential AD biomarkers are shown: So far we identified 57 sequences deriving from 24 different protein precursors. We identified 2 fragments of amyloid beta A4 protein, 1 fragment of apolipoprotein E, 1 fragment of apolipoprotein J or clusterin, 6 fragments of amyloid-like protein 1 (APLP1), 1 fragment of amyloid-like protein 2 (APLP2), 1 fragment of collagen alpha 1(l) chain, 2 fragments of fibrinogen alpha chain, 1 fragment of complement C4-A, 1 fragment of son of sevenless homolog 2, 1 fragment of cystatin C, 1 fragment of cholecystokinin, 7 fragments of neurosecretory protein VGF, 7 fragments of proSAAS, 5 fragments of neuroendocrin protein 7B2, 7 fragments of chromogranin A, 3 fragments of secretogranin I, and 1 fragment each of segretogranin II–III. We found 1 fragment of integral membrane protein 2B, 1 fragment of osteopontin, 2 fragments of testican-1, and 2 fragments of brevican core protein. Finally, we also identified 1 fragment of phospholemman (FXYD1) and FXYD6.

Table 4. Sequence analysis.

Pr ID Mass [Da] CE-time [min] Sequence Protein name start stop calc. mass [Da]
2065 1013.43 25.18 FMSDTREE Secretogranin-1 430 437 1013.4124
3251 1083.55 25.61 FENKFAVET Integral membrane protein 2B 254 262 1083.5237
7029 1158.62 27.02 EDVGSNKGAIIG Amyloid beta A4 protein 693 704 1158.5881
9404 1183.66 27.49 DPPAIPPRQPP Son of sevenless homolog 2 1171 1181 1183.6350
9730 1186.56 27.21 HELDSASSEVN Osteopontin 273 287 1186.5102
17258 1250.61 27.59 DHDVGSELPPEG ProSAAS 223 234 1250.5415
19245 1265.63 27.22 SpGPDGKTGPpGPA Collagen alpha-1(I) chain 546 559 1265.5888
24081 1300.67 29.70 DELAPAGTGVSRE Amyloid-like protein 1 568 580 1300.6259
24573 1306.74 22.16 VSPAAGSSPGKPPR Cystatin C 21 34 1306.6993
30960 1349.67 28.25 SGEGDFLAEGGGVR Fibrinogen alpha chain 22 35 1349.6212
37415 1404.73 29.49 HDVGSELPPEGVLG ProSAAS 224 237 1404.6885
41974 1448.69 29.41 EAVEEPSSKDVME Chromogranin-A 119 131 1448.6341
44123 1475.77 30.05 HDVGSELPPEGVLGA ProSAAS 224 238 1475.7256
45572 1499.74 29.89 LDDLQPWHSFGAD Amyloid beta A4 protein 615 627 1499.6681
45788 1500.71 22.99 SVPHFSDEDKDPE Neuroendocrine protein 7B2 200 212 1500.6369
47143 1519.76 31.87 DHDVGSELPPEGVLG ProSAAS 223 237 1519.7155
48140 1535.74 30.00 ADSGEGDFLAEGGGVR Fibrinogen alpha chain 20 35 1535.6852
49413 1552.61 30.78 VTEDDEDEDDDKE Testican-1 420 432 1552.5537
51940 1596.83 30.32 KVEQAVETEPEPEL Apolipoprotein E 19 32 1596.7883
53060 1614.84 31.54 DELAPAGTGVSREAVSG Amyloid-like protein 1 568 584 1614.7849
58375 1727.92 32.13 DELAPAGTGVSREAVSGL Amyloid-like protein 1 568 585 1727.8690
60472 1771.97 30.02 SVNPYLQGQRLDNVVA Neuroendocrine protein 7B2 182 197 1771.9217
62126 1816.98 33.53 DHDVGSELPPEGVLGALL ProSAAS 219 240 1816.9207
62500 1820.06 32.23 DVGSELPPEGVLGALLRV ProSAAS 221 242 1820.0044
64448 1867.72 33.07 AVTEDDEDEDDDKEDE Testican-1 419 434 1867.6603
64930 1873.00 21.26 ALHPEEDPEGRQGRLLG Brevican core protein 879 895 1872.9442
66400 1900.07 24.19 SVNPYLQGQRLDNVVAK Neuroendocrine protein 7B2 182 198 1900.0167
66858 1907.99 21.60 ADPAGSGLQRAEEAPRRQ Cholecystokinin 26 43 1907.9562
67973 1927.02 21.00 VAKKSVPHFSDEDKDPE Neuroendocrine protein 7B2 196 212 1926.9323
71613 2028.17 21.62 SVNPYLQGQRLDNVVAKK Neuroendocrine protein 7B2 182 199 2028.1116
71707 2029.13 20.15 ALHPEEDPEGRQGRLLGR Brevican core protein 879 896 2029.0453
72233 2041.99 32.56 ELSAERPLNEQIAEAEED Secretogranin-3 35 52 2041.9440
74137 2085.12 33.75 DELAPAGTGVSREAVSGLLIM Amyloid-like protein 1 568 588 2085.0776
75685 2128.97 26.03 EGQEEEEDNRDSSMKLSF Chromogranin-A 359 376 2128.8855
77519 2179.03 25.31 SGELEQEEERLSKEWEDS Chromogranin-A 322 339 2178.9553
78842 2214.22 26.48 AADHDVGSELPPEGVLGALLRV ProSAAS 217 242 2214.1644
79150 2222.16 26.60 STKLHLPADDVVSIIEEVEE Neurosecretory protein VGF 459 478 2222.1318
84897 2377.25 28.07 DDPDAPLQPVTPLQLFEGRRN Complement C4-A 1429 1449 2377.2026
86638 2423.19 27.03 ESPKEHDPFTYDYQSLQIGGL Phospholemman 21 41 2423.1281
86817 2428.11 27.16 SSQGGSLPSEEKGHPQEESEESN Secretogranin-1 293 315 2428.0262
88199 2471.30 35.56 DELAPAGTGVSREAVSGLLIMGAGGGS Amyloid-like protein 1 568 593 2471.2326
88418 2475.21 27.09 HSGFEDELSEVLENQSSQAELK Chromogranin-A 97 118 2475.1401
90848 2549.29 27.66 VGGLEEERESVGPLREDFSLSSSA Amyloid-like protein 2 671 694 2549.2244
91583 2584.37 35.60 DELAPAGTGVSREAVSGLLIMGAGGGSL Amyloid-like protein 1 568 595 2584.3167
94378 2684.32 21.38 SAAEKEKEMDPFHYDYQTLRIGG FXYD6 19 41 2684.2541
102634 3068.46 30.03 DQTVSDNELQEMSNQGSKYVNKEIQNA Clusterin 22 49 3068.3993
104636 3173.68 22.95 GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAP Neurosecretory protein VGF 26 57 3173.5742
108011 3302.68 23.31 GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPE Neurosecretory protein VGF 26 58 3302.6044
110596 3401.73 23.48 GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEV Neurosecretory protein VGF 26 59 3401.6852
115988 3595.77 23.89 PPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEV Neurosecretory protein VGF 24 59 3595.7907
116478 3614.82 22.01 GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRG Neurosecretory protein VGF 26 61 3614.8077
119503 3685.86 22.21 GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGA Neurosecretory protein VGF 26 62 3685.8449
121774 3768.77 31.84 SGFEDELSEVLENQSSQAELKEAVEEPSSKDVME Chromogranin-A 98 131 3768.7048
122653 3792.76 27.25 HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVm Chromogranin-A 97 130 3792.7160
126695 3921.82 27.74 HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVmE Chromogranin-A 97 131 3921.7586
139272 4319.85 23.64 DPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHS Secretogranin-1 88 130 4319.8711
140319 4349.06 28.17 VPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVS Secretogranin-2 527 566 4349.0419

Identified sequences of 57 out of the initial set of 131 putative AD biomarkers are listed. Shown are unique internal protein ID (Pr ID), molecular mass (in Dalton), CE-migration time (in minutes), sequence, originating protein name, and calculated mass (in Dalton). Peptides that are utilized in the final AD pattern are highlighted in bold letters.

We have satisfactory mass spectra of all 12 AD biomarkers, which were used in the AD pattern (see Figure S3). However, we are not able to identify all peptides. The greater challenge of peptide identification in comparison to protein identification of classical proteomic studies is the missing availability of peptide mass fingerprint information. Sequencing is hindered by several obstacles associated with MS sequencing of naturally occurring peptides (tryptic digests cannot be utilized because of a loss of connectivity to the original identification parameters [31]). Major obstacles are suboptimal use of proteomics search machines (like MASCOT or OMSSA) for naturally occurring peptides [32], [33] as well as the chemical nature (e.g. post-translational modifications) of the peptides that prevents successful sequencing [19]. To date, sequences could be obtained from 5 of the final 12 best-of-selection of AD biomarkers with the ID 78842: AADHDVGSELPPEGVLGALLRV, ProSAAS precursor [217–242]; ID 77519: SGELEQEEERLSKEWEDS, chromogranin A [322–339], ID 86638: ESPKEHDPFTYDYQSLQIGGL, phospholemman (FXYD1) [21][41]; ID 102634: DQTVSDNELQEMSNQGSKYVNKEIQNA, clusterin/apolipoprotein J [22][49]; and ID 110596: GRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEV, neurosecretory protein VGF [26][59] ( Table 2 ). Annotated mass spectra of these peptides are shown in Figure S3. Uniformly AD patients showed higher detection frequencies and amplitudes for most of these synaptic marker peptides in CSF that point toward alterations in vesicle maturation and transport in AD ( Table 4 ). However, fragments of VGF, a peptide also found in synaptic vesicles, were detected with lower signal amplitude in AD patients.

A subset of the patient cohort (n = 61) could be screened for their apolipoprotein E (ApoE) allelic composition. About 50% carried an ApoE4 allele. The ApoE4 allele variant is a known risk factor for AD found in about 40–50% of all AD cases, while the ApoE4 allele frequency in a normal population is about 10% [34]. Although it is commonly not recommended as a screening test, a positive ApoE4 status predicts AD with a sensitivity of 80% when clinical symptoms of a dementia are present [34]. The allelic status of 27 from 34 patients with clinical AD from our training set could be determined to investigate if the discriminative value of the AD-specific biomarkers changes in relationship to the ApoE4 status. 18 of 27 genotyped AD-patients were showing a positive ApoE4 status with at least one copy. The discriminative value of the 12 biomarkers in the final panel for AD ( Figure 2 ) does not change significantly in view to a positive ApoE4 status. In contrast the N-terminal apolipoprotein E fragment ([19][32]; KVEQAVETEPEPEL) originally included in the primary candidate list or the testican-1 fragments ( Table 4 ) showed significantly better AUC values if patients carried the ApoE4 allele. We excluded affected biomarkers from the final list to avoid contamination with the already known risk factor due to the different allele frequencies in the diagnosis groups.

Discussion

The urgent need of earlier and more precise diagnosis arises with the advent of first treatments [3]. Current treatments of AD may in some cases reduce disease progression, but certainly do not reverse the disease process. In addition, cholinesterase inhibitors or glutamate antagonists are currently applied to only a small fraction of patients [35].

The study focused on the analysis of proteins/peptides in CSF obtained from patients presenting to a memory clinic and suffering from various dementias. CE-MS does not require specific antibodies or specific knowledge about the peptides (e.g. solubility, binding or modifications) and yields a comprehensive display of the peptide populations present in CSF without being subject to selection-biases inherent to alternative proteomic methods like matrix-assisted techniques. The high sensitivity (detection limit in the low fmol to amol range) and reproducibility of the CE-MS technology enables the reliable analysis of >800 different peptides in CSF with molecular weights ranging from 0.8 kDa to about 20 kDa.

Disease specific peptide pattern

From the vast pool of peptides present in CSF, specific biomarkers and subsequent diagnostic models for AD and FTD could be established. The availability of proteome data from patient samples with clear clinical diagnoses enabled the definition of peptides that apparently allow the differentiation of dementias from healthy controls and the differentiation between dementias like AD and FTD in the blinded dataset with high sensitivity and specificity. The MCI data indicate that CE-MS can be utilized to identify incipient AD cases in MCI. Hence this approach may be used for stratification of patients in therapeutic intervention trials. Currently, clinical MCI trials of antidementiva are impaired due to low conversion rates and the inclusion of many patients that will not develop AD in the clinical course. In consequence many MCI trials fail or long term follow up of large patient cohorts are required to reach an acceptable statistical power, making such trials expensive and difficult in design [36].

As expected from earlier attempts to define biomarkers for AD [3], [37], [38], and as evident from the AUC values shown in Table 2 , single biomarkers are often of limited diagnostic value. However, the classification model based on a combination of distinct and clearly defined single biomarkers shows a high discriminatory value that cannot be reached when using single biomarkers alone. Already our first attempt to use peptide patterns for diagnostic purposes in a prospective natural clinical sample yielded sensitivity and specificity for AD diagnosis in the range that established methods like the measurement of T-tau, P-tau181, and beta-amyloid1–42 can reach only when combined. Fully developed, the new method should show its strength especially in the differential diagnosis of unclear cases. Having the potential to gather the information included in a multitude of peptides instead of detecting a single marker only, valuable and limited CSF samples can be analyzed more efficient and in-depth. This is in line with other studies, where e.g. levels of CSF beta-amyloid1–42 were lower in AD patients and levels of CSF tau were elevated in AD patients [39] and only the combination of these biomarkers allowed the detection and differentiation of AD from healthy controls with a sensitivity and specificity of greater than 80%. To date, the specificity to differentiate AD from other dementias especially in naturalistic samples, like in our prospective sample, is often considerably lower [3], [4]. Similar approaches like the combination of classical AD markers were recently reported with the aim to identify incipient AD cases in patients suffering from MCI [38] or to predict cognitive decline in nondemented older adults [40]. In addition, Hansson et al. described that concentrations of T-tau, P-tau181, and beta-amyloid1–42 in CSF are associated with future development of AD in patients with MCI [41]. The application of CE-MS allowed the definition of a broader array of yet partially unknown biomarkers, which may have the potential of a more refined and earlier detection of the onset of AD. Interestingly our data also indicate an overlap in FTD and AD pathology especially in patients with primary progressive aphasia, which is line with recent observations made in brain biopsies [42]. This finding could have direct therapeutic impact. While there is currently no treatment option for FTD patients, the presence of AD pathology in this FTD subtype could justify the use of the available AD treatments.

A related approach using several unspecific blood plasma markers for inflammation and apoptosis processes in an ELISA array to identify AD claimed worldwide attention [43], but failed to work [44].

Identification of new AD-biomarkers using CE-MS

To date, we were able to sequence 279 from the 1104 reliable measured peptides and identified 57 peptides of the primary list of 131 potential AD-biomarkers ( Table 4 ) present in cerebrospinal fluid of AD patients. The prevalence of sequences among these potential AD markers related to bioactive peptides derived from prohormones normally stored in neuronal dense-core vesicles is striking. In general, AD patients show higher detection frequencies and amplitudes for these synaptic marker peptides in CSF that could point toward alterations in vesicle maturation and transport in AD.

Cognitive decline in dementias is due to loss of synapses or synaptic functionality meaning loss of neurones, loss of synapses on still functioning neurones, or loss of function on still available synapses. Therefore biomarkers of synaptic function and/or damage or complementary changes in the brain, e.g. immunological responses or cellular stress may be especially suited as AD biomarkers with face validity [45]. Our method identified a set of AD biomarkers that are of synaptic origin: Long known suspects like chromogranin A [37] and some newer like neurosecretory protein VGF (VGF), clusterin (apolipoprotein J), ProSAAS, testican-1, and neuroendocrine protein 7B2. We also found fragments of proteins well known to be associated with AD like the amyloid beta peptides, one fragment of beta-amyloid1–42 and one fragment of a soluble form of APP, one fragment of APLP2 and apolipoprotein E [6], [32]. Maybe most interestingly, we found 6 APLP1-derived ‘A-beta-like peptide’ species [46] among them APL1β28, as putative AD biomarkers with our approach. This non-amyloidogenic peptide fragment is proposed to be a CSF surrogate marker of beta-amyloid production [47], [48] and we also identify them as potential AD biomarkers using a different methodology.

So far we were able to identify 5 biomarkers of our diagnostic AD panel of 12 peptides used in this study:

A fragment of neurosecretory protein VGF was identified. For VGF a role in the regulation of energy balance is currently discussed and knockout mice are thin and hypermetabolic [49]. One may speculate whether there is a connection with the heavy weight losses observed in some AD patients. Furthermore, other proteomic approaches have also found decreased VGF as potential biomarker in CSF of AD patients [9].

Phospholemman (FXYD1) is a 72-residue protein, which is expressed in the CNS, e. g. in the choroid plexus and cerebellum. It is a homolog of the Na+/,K+-ATPase y subunit (FXYD2), a small accessory protein that modulates ATPase activity. It forms ion channels selective for K+, Cl−, and taurine in lipid bilayers and colocalizes with the Na+/K+-ATPase and the Na+/Ca2+-exchanger, which may suggest a role in the regulation of cell volume [50], [51]. Na+/K+-ATPase activity might be altered by amyloid in AD [52]. Interestingly, we also found a fragment of FXYD6 (Phosphohippolin).

Clusterin (also called apolipoprotein J) is a secreted glycoprotein. In the central nervous system, clusterin expression is elevated in neuropathological conditions such as AD, where it is found associated with amyloid-beta (Aβ) plaques. Clusterin also coprecipitates with Aβ from CSF, suggesting a physiological interaction with Aβ and can be found in Lewy Bodies [53]. A recent study using an ELISA found that clusterin is significantly increased in cerebrospinal fluid from Alzheimer patients, but concluded that due to individual overlap between the two groups cerebrospinal fluid clusterin measurement is not suitable as a biochemical marker in the diagnosis of AD [54]. With an AUC value of 0.81 derived from the ROC curve our findings suggest that maybe depending from the technique used clusterin fragments might be useful as AD marker. Two recent studies using 2D gel electrophoresis also found increased levels of clusterin in patients with AD [55], [56]. A genome wide association study also identified clusterin as a risk gen for AD [57].

Chromogranin A, a prohormone that is a major ingredient of large dense core vesicles in neurones, is proteolytically processed into low molecular weight peptides in neurons prior to axonal transport and released into the synaptic cleft where they may act as neurotransmitters. Up-regulation of chromogranin A was reported in AD, it is found in beta-amyloid plaques in AD brain biopsies [58], [59] and was proposed to be a marker for synaptic degeneration [37]. Chromogranins are soluble glycophosphoproteins capable of activating microglial cells and metabotropic glutamate receptors [60]. Chromogranin A might synergistically enhance with beta-amyloid peptides the microglial neurotoxic effect and diminish microglial phagocytic activity in senile plaques [61]. Chromogranin A was recently discovered to bind to mutant superoxid dismutase activity in amyotrophic lateral sclerosis increasing neurotoxicity [62]. Furthermore, chromogranin A fragments may be therefore stimulators of senile plaque development and neuronal toxicity and their concentration changes during AD-treatments could be used as surrogate markers. Compared to initial findings [37] chromogranin A fragments maybe contain more information about the disease process than the intact prohormone and may yield better AD biomarkers. Interestingly, beside 7 chromogranin A fragments, we also found fragments of secretogranin I–III.

Proprotein convertase subtilisin/kexin type 1 inhibitor (proSAAS) a recently discovered prohormone is found in synaptic vesicles [63]. N-terminal proSAAS fragments are found in the Tau inclusion bodies of Pick disease and other tauopathies [64], [65]. ProSAAS is distributed abundantly in neuroendocrine tissues like pituitary and hypothalamus and other brain regions and is co-localised with prohormone convertase 1 (PC-1). The C-terminal fragments are potent inhibitors of PC-1 belonging to a family of calcium-dependent serin proteases, the major endoproteolytic processing enzymes of the secretory pathway which are responsible for the proteolytic cleavage of a wide variety of peptide precursors including proinsulin [63], [66]. Endogenous binding and inhibiting proteins for PC-1 and PC-2 have been identified as proSAAS and neuroendocrine peptide 7B2, respectively. A recent study using the iTRAQ technique identified proSAAS and chromogranin A fragments as putative AD markers [67]. ProSAAS was also identified as potential AD marker in the study of Finehout and colleagues [55]. So far we identified 7 fragments of proSAAS to be putative AD biomarkers in our approach.

Most interestingly some of the identified potential AD markers like testican-1 and proSAAS are inhibitors of proteases or like neuroendocrine protein 7B2 are required for the function of prohormone convertases. Recent research has demonstrated the critical importance of such protease inhibitors and their neuroproteases for the regulation of specific peptide neurotransmitters and for the production of toxic peptides in major neurodegenerative diseases like AD [68]. Several of the identified biomarkers are involved in vesicular transport and processing of synaptic neuropeptides. A disturbance in maturation and degradation processes of synaptic neuropeptides may be one reason for the cognitive malfunction and subsequent neuronal loss. One may speculate whether abnormal proteolysis caused by enhanced protease inhibitor activities due to the synaptic peptides identified in this study in AD patients might play a role in cognitive impairment and AD pathology well before tangle and plaque formation occur [69]. Hence, proteases like prohormone convertases could become new drug targets in the development of AD treatments. That we do not only identify new biomarkers but also established markers of AD like fragments of amyloid-beta peptides or currently discussed AD-markers like the APLP1 fragments points to the validity and high potential of our method. A limitation of our study is surely the lack of any neuropathological confirmation of our clinical diagnoses that could help to improve the specificity and sensitivity of our pure clinical approach. When fully developed and validated, this powerful new technique, CE-MS, may be especially suited to monitor drug effects on a synaptic level. To date the method already allows the early diagnosis of AD and differential diagnosis of other dementias showing promising practical advantages in respect to current diagnostic approaches like e. g. ELISAs and PET. New analytical proteomic technologies like ours are now becoming mature and can be applied to clinical problems in dementia research like diagnostic and therapeutic biomarker discovery as more and more studies prove [7], [43], [55], [67].

Supporting Information

Figure S1

Reproducibility of the CE-MS measurements. Protein contour plots of 4 CSF-samples obtained by fractionated extraction of six aliquots of cerebrospinal fluid from one patient. The molecular mass (in kDa, logarithmic scale) on the y-axis is plotted against CE-migration time (in min) on the x-axis.

(TIFF)

Figure S2

Comparability of the CE-MS measurements. (A) Contour plot of the entire cerebrospinal fluid proteome. The molecular mass (in kDa, logarithmic scale) on the y-axis is plotted against CE-migration time (in min) on the x-axis. The arrangement of the peptides in distinct lines is obvious. (B) Contour plot of 279 identified peptides. The lines already observed in (A) could be comprehended as a result of the number of positive charges z (at pH 2). (C) By means of several examples for determined peptide sequences the correlation between the effective netto-charge, molecular mass and the CE-migration time is demonstrated. Basic amino acids are colored in red.

(TIFF)

Figure S3

Tandem mass spectra of the AD biomarkers. The mass spectra of all 12 AD biomarkers (see Protein ID) are shown in the following figures. Spectra of the identified peptides are annotated with fragment assignments from the OMSSA (Open Mass Spectrometry Search Algorithm; http://pubchem.ncbi.nlm.nih.gov/omssa) searches. The corresponding sequence is displayed above each spectrum. Identified b-ions are marked in blue and y-ions in red color.

(PDF)

Table S1

AD marker list. Initial set of 131 putative AD biomarkers present with high frequency in CSF of AD are listed. Shown are unique internal protein ID, molecular mass (in Dalton), CE-migration time (in minutes), observed frequency of occurrence and the corresponding mean amplitudes in AD and controls, and unadjusted p-values. Peptides that have an unadjusted p-value limit of 0.01 are highlighted in bold letters.

(XLS)

Table S2

Prospective sample data. Patients (n = 100): Final diagnoses (clinical outcome) before unblinding: AD (52), still MCI (14), mixed dementia (6), vascular dementia (5), FTD (6), depression (6), schizophrenia (3), delusional disorder (1), encephalitis (2), Parkinson dementia (2), alcohol psychosis (1), amyotropic lateral sclerosis (1), Chorea Huntington (1). Scores: cut-off for AD>0, FTD>−0.1, schizophrenia>0.1. Row AD-MS and AD-IM contains the values for AD diagnosis for mass spectrometry and immunochemistry: tp, true positiv; tn, true negative, fp, false positive, fn, false negative for diagnosis AD. File further includes data for gender, age, diagnoses for the prospective patient sample, scores for peptide patterns and the values for the biomarker total tau, phospho181-tau, and beta-amyloid1–42 if available.

(XLS)

Table S3

Neuropsychological tests used to classify MCI according to Petersen et al. [70] and dementia cases. Mini-Mental State Examination (MMSE) [71], Clinical Dementia Rating (CDR) [72], CERAD test battery [73], WMS-R Logical Memory [74], Trail Making Test (TMT) [75], and Clock Drawing Test (CDT) [76].

(XLS)

Table S4

Precision data examples. Precision study for ten cerebrospinal fluid samples which are measured twice.

(XLS)

Table S5

CE-MS raw data of the 176 samples used in the study. Only data that were actually utilized (that are present in at least 40% of the samples of one of the diagnostic groups, see section “Methods”) are shown. The protein IDs of all peptides are given in the first column named “protein ID”, the unique sample IDs constitute the first row. The MS data from each sample are reflected in one column. The number in each cell represents the normalized signal intensity of the mass spectrometric signal of each peptide detected in the sample.

(XLS)

Footnotes

Competing Interests: PZ is an employee of Mosaiques Diagnostics GmbH. HM is founder and shareholder of Mosaiques Diagnostics GmbH. MK is an employee of Thermo Fisher Scientific GmbH. KW serves on the scientific advisory board of Mosaiques Diagnostics and Therapeutics AG. HJ, TJR, and SA are scientists at the Department of Psychiatry of the University of Hamburg and have nothing to declare. This does not alter the authors' adherence to all the PLoS ONE policies on sharing data and materials.

Funding: This work was supported by grant No. 0313347 from the BioProfile Initiative and grant No. 01EW0909 to HJ by the German Federal Ministry of Education and Research in the frame of the ERA-NET NEURO project “ADtest: Role of proteases and their inhibitors in pathophysiology and diagnosis of Alzheimer Disease”. The Memory Clinic of the Department of Psychiatry and Psychotherapy at the University Hospital Hamburg-Eppendorf is a member of the German National Dementia Competence Network. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. HJ had full access to all of the data in the study and takes responsibility for the integrity of the data and the accuracy of the data analysis.

References

  • 1.Wimo A, Jonsson L, Winblad B. An estimate of the worldwide prevalence and direct costs of dementia in 2003. Dement Geriatr Cogn Disord. 2006;21:175–181. doi: 10.1159/000090733. [DOI] [PubMed] [Google Scholar]
  • 2.Hebert LE, Scherr PA, Beckett LA, Albert MS, Pilgrim DM, et al. Age-specific incidence of Alzheimer's disease in a community population. JAMA. 1995;273:1354–1359. [PubMed] [Google Scholar]
  • 3.Blennow K, de Leon MJ, Zetterberg H. Alzheimer's disease. Lancet. 2006;368:387–403. doi: 10.1016/S0140-6736(06)69113-7. [DOI] [PubMed] [Google Scholar]
  • 4.Hulstaert F, Blennow K, Ivanoiu A, Schoonderwaldt HC, Riemenschneider M, et al. Improved discrimination of AD patients using beta-amyloid(1–42) and tau levels in CSF. Neurology. 1999;52:1555–1562. doi: 10.1212/wnl.52.8.1555. [DOI] [PubMed] [Google Scholar]
  • 5.Mayeux R. Evaluation and use of diagnostic tests in Alzheimer's disease. Neurobiol Aging. 1998;19:139–143. doi: 10.1016/s0197-4580(98)00014-1. [DOI] [PubMed] [Google Scholar]
  • 6.Davies L, Wolska B, Hilbich C, Multhaup G, Martins R, et al. A4 amyloid protein deposition and the diagnosis of Alzheimer's disease: prevalence in aged brains determined by immunocytochemistry compared with conventional neuropathologic techniques. Neurology. 1988;38:1688–1693. doi: 10.1212/wnl.38.11.1688. [DOI] [PubMed] [Google Scholar]
  • 7.Choudhary J, Grant SG. Proteomics in postgenomic neuroscience: the end of the beginning. Nat Neurosci. 2004;7:440–445. doi: 10.1038/nn1240. [DOI] [PubMed] [Google Scholar]
  • 8.Bergquist J, Palmblad M, Wetterhall M, Hakansson P, Markides KE. Peptide mapping of proteins in human body fluids using electrospray ionization Fourier transform ion cyclotron resonance mass spectrometry. Mass Spectrom Rev. 2002;21:2–15. doi: 10.1002/mas.10016. [DOI] [PubMed] [Google Scholar]
  • 9.Carrette O, Demalte I, Scherl A, Yalkinoglu O, Corthals G, et al. A panel of cerebrospinal fluid potential biomarkers for the diagnosis of Alzheimer's disease. Proteomics. 2003;3:1486–1494. doi: 10.1002/pmic.200300470. [DOI] [PubMed] [Google Scholar]
  • 10.Haubitz M, Wittke S, Weissinger EM, Walden M, Rupprecht HD, et al. Urine protein patterns can serve as diagnostic tools in patients with IgA nephropathy. Kidney Int. 2005;67:2313–2320. doi: 10.1111/j.1523-1755.2005.00335.x. [DOI] [PubMed] [Google Scholar]
  • 11.Haubitz M, Good DM, Woywodt A, Haller H, Rupprecht H, et al. Identification and validation of urinary biomarkers for differential diagnosis and dvaluation of therapeutic intervention in ANCA associated vasculitis. Mol Cell Proteomics. 2009;8:2296–2307. doi: 10.1074/mcp.M800529-MCP200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Rossing K, Mischak H, Dakna M, Zürbig P, Novak J, et al. Urinary proteomics in diabetes and CKD. J Am Soc Nephrol. 2008;19:1283–1290. doi: 10.1681/ASN.2007091025. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Weissinger EM, Wittke S, Kaiser T, Haller H, Bartel S, et al. Proteomic patterns established with capillary electrophoresis and mass spectrometry for diagnostic purposes. Kidney Int. 2004;65:2426–2434. doi: 10.1111/j.1523-1755.2004.00659.x. [DOI] [PubMed] [Google Scholar]
  • 14.Schiffer E, Vlahou A, Petrolekas A, Stravodimos K, Tauber R, et al. Prediction of muscle-invasive bladder cancer using urinary proteomics. Clin Cancer Res. 2009;15:4935–4943. doi: 10.1158/1078-0432.CCR-09-0226. [DOI] [PubMed] [Google Scholar]
  • 15.Theodorescu D, Wittke S, Ross MM, Walden M, Conaway M, et al. Discovery and validation of new protein biomarkers for urothelial cancer: a prospective analysis. Lancet Oncol. 2006;7:230–240. doi: 10.1016/S1470-2045(06)70584-8. [DOI] [PubMed] [Google Scholar]
  • 16.Theodorescu D, Schiffer E, Bauer HW, Douwes F, Eichhorn F, et al. Discovery and validation of urinary biomarkers for prostate cancer. Proteomics Clin Appl. 2008;2:556–570. doi: 10.1002/prca.200780082. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Decramer S, Wittke S, Mischak H, Zürbig P, Walden M, et al. Predicting the clinical outcome of congenital unilateral ureteropelvic junction obstruction in newborn by urinary proteome analysis. Nat Med. 2006;12:398–400. doi: 10.1038/nm1384. [DOI] [PubMed] [Google Scholar]
  • 18.Metzger J, Chatzikyrkou C, Broecker V, Schiffer E, Jäntsch L, et al. Diagnosis of subclinical and clinical acute T-cell mediated rejection in renal transplant patients by urinary proteome analysis. Proteomics Clin Appl. 2011 doi: 10.1002/prca.201000153. in press. [DOI] [PubMed] [Google Scholar]
  • 19.Zürbig P, Renfrow MB, Schiffer E, Novak J, Walden M, et al. Biomarker discovery by CE-MS enables sequence analysis via MS/MS with platform-independent separation. Electrophoresis. 2006;27:2111–2125. doi: 10.1002/elps.200500827. [DOI] [PubMed] [Google Scholar]
  • 20.Mischak H, Apweiler R, Banks RE, Conaway M, Coon JJ, et al. Clinical Proteomics: a need to define the field and to begin to set adequate standards. Proteomics Clin Appl. 2007;1:148–156. doi: 10.1002/prca.200600771. [DOI] [PubMed] [Google Scholar]
  • 21.WHO. International Statistical Classification of diseases and Heathly Related Problems (The) ICD-10. 2004. WHO, Geneva.
  • 22.McKhann G, Drachman D, Folstein M, Katzman R, Price D, et al. Clinical diagnosis of Alzheimer's disease: report of the NINCDS-ADRDA Work Group under the auspices of Department of Health and Human Services Task Force on Alzheimer's Disease. Neurology. 1984;34:939–944. doi: 10.1212/wnl.34.7.939. [DOI] [PubMed] [Google Scholar]
  • 23.Petersen RC. Mild cognitive impairment as a diagnostic entity. J Intern Med. 2004;256:183–194. doi: 10.1111/j.1365-2796.2004.01388.x. [DOI] [PubMed] [Google Scholar]
  • 24.The Lund and Manchester Groups. Clinical and neuropathological criteria for frontotemporal dementia. The Lund and Manchester Groups. J Neurol Neurosurg Psychiatry. 1994;57:416–418. doi: 10.1136/jnnp.57.4.416. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Lewczuk P, Kornhuber J, Wiltfang J. The German Competence Net Dementias: standard operating procedures for the neurochemical dementia diagnostics. J Neural Transm. 2006;113:1075–1080. doi: 10.1007/s00702-006-0511-9. [DOI] [PubMed] [Google Scholar]
  • 26.You JS, Gelfanova V, Knierman MD, Witzmann FA, Wang M, et al. The impact of blood contamination on the proteome of cerebrospinal fluid. Proteomics. 2005;5:290–296. doi: 10.1002/pmic.200400889. [DOI] [PubMed] [Google Scholar]
  • 27.Good DM, Zürbig P, Argiles A, Bauer HW, Behrens G, et al. Naturally occurring human urinary peptides for use in diagnosis of chronic kidney disease. Mol Cell Proteomics. 2010;9:2424–2437. doi: 10.1074/mcp.M110.001917. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Jantos-Siwy J, Schiffer E, Brand K, Schumann G, Rossing K, et al. Quantitative Urinary Proteome Analysis for Biomarker Evaluation in Chronic Kidney Disease. J Proteome Res. 2009;8:268–281. doi: 10.1021/pr800401m. [DOI] [PubMed] [Google Scholar]
  • 29.Check E. Proteomics and cancer: Running before we can walk. Nature. 2004;429:496–497. doi: 10.1038/429496a. [DOI] [PubMed] [Google Scholar]
  • 30.Petricoin EF, Ardekani AM, Hitt BA, Levine PJ, Fusaro VA, et al. Use of proteomic patterns in serum to identify ovarian cancer. Lancet. 2002;359:572–577. doi: 10.1016/S0140-6736(02)07746-2. [DOI] [PubMed] [Google Scholar]
  • 31.Chalmers MJ, Mackay CL, Hendrickson CL, Wittke S, Walden M, et al. Combined top-down and bottom-up mass spectrometric approach to characterization of biomarkers for renal disease. Anal Chem. 2005;77:7163–7171. doi: 10.1021/ac050983o. [DOI] [PubMed] [Google Scholar]
  • 32.Fliser D, Novak J, Thongboonkerd V, Argiles A, Jankowski V, et al. Advances in urinary proteome analysis and biomarker discovery. J Am Soc Nephrol. 2007;18:1057–1071. doi: 10.1681/ASN.2006090956. [DOI] [PubMed] [Google Scholar]
  • 33.Mischak H, Julian BA, Novak J. High-resolution proteome/peptidome analysis of peptides and low-molecular-weight proteins in urine. Proteomics Clin Appl. 2007;1:792–804. doi: 10.1002/prca.200700043. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Mulder C, Scheltens P, Visser JJ, Van Kamp GJ, Schutgens RB. Genetic and biochemical markers for Alzheimer's disease: recent developments. Ann Clin Biochem. 2000;37(Pt 5):593–607. doi: 10.1258/0004563001899898. [DOI] [PubMed] [Google Scholar]
  • 35.Bullock R. New drugs for Alzheimer's disease and other dementias. Br J Psychiatry. 2002;180:135–139. doi: 10.1192/bjp.180.2.135. [DOI] [PubMed] [Google Scholar]
  • 36.Jelic V, Kivipelto M, Winblad B. Clinical trials in mild cognitive impairment: lessons for the future. J Neurol Neurosurg Psychiatry. 2006;77:429–438. doi: 10.1136/jnnp.2005.072926. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Blennow K, Davidsson P, Wallin A, Ekman R. Chromogranin A in cerebrospinal fluid: a biochemical marker for synaptic degeneration in Alzheimer's disease? Dementia. 1995;6:306–311. doi: 10.1159/000106963. [DOI] [PubMed] [Google Scholar]
  • 38.Borroni B, Di LM, Padovani A. Predicting Alzheimer dementia in mild cognitive impairment patients. Are biomarkers useful? Eur J Pharmacol. 2006;545:73–80. doi: 10.1016/j.ejphar.2006.06.023. [DOI] [PubMed] [Google Scholar]
  • 39.Sunderland T, Linker G, Mirza N, Putnam KT, Friedman DL, et al. Decreased beta-amyloid1-42 and increased tau levels in cerebrospinal fluid of patients with Alzheimer disease. JAMA. 2003;289:2094–2103. doi: 10.1001/jama.289.16.2094. [DOI] [PubMed] [Google Scholar]
  • 40.Fagan AM, Roe CM, Xiong C, Mintun MA, Morris JC, et al. Cerebrospinal fluid tau/beta-amyloid(42) ratio as a prediction of cognitive decline in nondemented older adults. Arch Neurol. 2007;64:343–349. doi: 10.1001/archneur.64.3.noc60123. [DOI] [PubMed] [Google Scholar]
  • 41.Hansson O, Zetterberg H, Buchhave P, Londos E, Blennow K, et al. Association between CSF biomarkers and incipient Alzheimer's disease in patients with mild cognitive impairment: a follow-up study. Lancet Neurol. 2006;5:228–234. doi: 10.1016/S1474-4422(06)70355-6. [DOI] [PubMed] [Google Scholar]
  • 42.Knibb JA, Xuereb JH, Patterson K, Hodges JR. Clinical and pathological characterization of progressive aphasia. Ann Neurol. 2006;59:156–165. doi: 10.1002/ana.20700. [DOI] [PubMed] [Google Scholar]
  • 43.Ray S, Britschgi M, Herbert C, Takeda-Uchimura Y, Boxer A, et al. Classification and prediction of clinical Alzheimer's diagnosis based on plasma signaling proteins. Nat Med. 2007 doi: 10.1038/nm1653. [DOI] [PubMed] [Google Scholar]
  • 44.Soares HD, Chen Y, Sabbagh M, Roher A, Schrijvers E, et al. Identifying early markers of Alzheimer's disease using quantitative multiplex proteomic immunoassay panels. Ann N Y Acad Sci. 2009;1180:56–67. doi: 10.1111/j.1749-6632.2009.05066.x. [DOI] [PubMed] [Google Scholar]
  • 45.Wiltfang J, Lewczuk P, Riederer P, Grunblatt E, Hock C, et al. Consensus paper of the WFSBP Task Force on Biological Markers of Dementia: the role of CSF and blood analysis in the early and differential diagnosis of dementia. World J Biol Psychiatry. 2005;6:69–84. doi: 10.1080/15622970510029786. [DOI] [PubMed] [Google Scholar]
  • 46.Bayer TA, Cappai R, Masters CL, Beyreuther K, Multhaup G. It all sticks together–the APP-related family of proteins and Alzheimer's disease. Mol Psychiatry. 1999;4:524–528. doi: 10.1038/sj.mp.4000552. [DOI] [PubMed] [Google Scholar]
  • 47.Okochi M, Tagami S, Takeda M. Analysis of APL1beta28, a surrogate marker for Alzheimer Abeta42, indicates altered precision of gamma-cleavage in the brains of Alzheimer disease patients. Neurodegener Dis. 2010;7:42–45. doi: 10.1159/000283481. [DOI] [PubMed] [Google Scholar]
  • 48.Yanagida K, Okochi M, Tagami S, Nakayama T, Kodama TS, et al. The 28-amino acid form of an APLP1-derived Abeta-like peptide is a surrogate marker for Abeta42 production in the central nervous system. EMBO Mol Med. 2009;1:223–235. doi: 10.1002/emmm.200900026. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Levi A, Ferri GL, Watson E, Possenti R, Salton SR. Processing, distribution, and function of VGF, a neuronal and endocrine peptide precursor. Cell Mol Neurobiol. 2004;24:517–533. doi: 10.1023/b:cemn.0000023627.79947.22. [DOI] [PubMed] [Google Scholar]
  • 50.Feschenko MS, Donnet C, Wetzel RK, Asinovski NK, Jones LR, et al. Phospholemman, a single-span membrane protein, is an accessory protein of Na,K-ATPase in cerebellum and choroid plexus. J Neurosci. 2003;23:2161–2169. doi: 10.1523/JNEUROSCI.23-06-02161.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Geering K. FXYD proteins: new regulators of Na-K-ATPase. Am J Physiol Renal Physiol. 2006;290:F241–F250. doi: 10.1152/ajprenal.00126.2005. [DOI] [PubMed] [Google Scholar]
  • 52.Dickey CA, Gordon MN, Wilcock DM, Herber DL, Freeman MJ, et al. Dysregulation of Na+/K+ ATPase by amyloid in APP+PS1 transgenic mice. BMC Neurosci. 2005;6:7. doi: 10.1186/1471-2202-6-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Calero M, Rostagno A, Frangione B, Ghiso J. Clusterin and Alzheimer's disease. Subcell Biochem. 2005;38:273–298. [PubMed] [Google Scholar]
  • 54.Nilselid AM, Davidsson P, Nagga K, Andreasen N, Fredman P, et al. Clusterin in cerebrospinal fluid: analysis of carbohydrates and quantification of native and glycosylated forms. Neurochem Int. 2006;48:718–728. doi: 10.1016/j.neuint.2005.12.005. [DOI] [PubMed] [Google Scholar]
  • 55.Finehout EJ, Franck Z, Choe LH, Relkin N, Lee KH. Cerebrospinal fluid proteomic biomarkers for Alzheimer's disease. Ann Neurol. 2007;61:120–129. doi: 10.1002/ana.21038. [DOI] [PubMed] [Google Scholar]
  • 56.Sihlbom C, Davidsson P, Sjogren M, Wahlund LO, Nilsson CL. Structural and quantitative comparison of cerebrospinal fluid glycoproteins in Alzheimer's disease patients and healthy individuals. Neurochem Res. 2008;33:1332–1340. doi: 10.1007/s11064-008-9588-x. [DOI] [PubMed] [Google Scholar]
  • 57.Harold D, Abraham R, Hollingworth P, Sims R, Gerrish A, et al. Genome-wide association study identifies variants at CLU and PICALM associated with Alzheimer's disease. Nat Genet. 2009;41:1088–1093. doi: 10.1038/ng.440. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Munoz DG. Chromogranin A-like immunoreactive neurites are major constituents of senile plaques. Lab Invest. 1991;64:826–832. [PubMed] [Google Scholar]
  • 59.Rangon CM, Haik S, Faucheux BA, Metz-Boutigue MH, Fierville F, et al. Different chromogranin immunoreactivity between prion and a-beta amyloid plaque. Neuroreport. 2003;14:755–758. doi: 10.1097/00001756-200304150-00019. [DOI] [PubMed] [Google Scholar]
  • 60.Taylor DL, Diemel LT, Cuzner ML, Pocock JM. Activation of group II metabotropic glutamate receptors underlies microglial reactivity and neurotoxicity following stimulation with chromogranin A, a peptide up-regulated in Alzheimer's disease. J Neurochem. 2002;82:1179–1191. doi: 10.1046/j.1471-4159.2002.01062.x. [DOI] [PubMed] [Google Scholar]
  • 61.Twig G, Graf SA, Messerli MA, Smith PJ, Yoo SH, et al. Synergistic amplification of beta-amyloid- and interferon-gamma-induced microglial neurotoxic response by the senile plaque component chromogranin A. Am J Physiol Cell Physiol. 2005;288:C169–C175. doi: 10.1152/ajpcell.00308.2004. [DOI] [PubMed] [Google Scholar]
  • 62.Urushitani M, Sik A, Sakurai T, Nukina N, Takahashi R, et al. Chromogranin-mediated secretion of mutant superoxide dismutase proteins linked to amyotrophic lateral sclerosis. Nat Neurosci. 2006;9:108–118. doi: 10.1038/nn1603. [DOI] [PubMed] [Google Scholar]
  • 63.Fricker LD, McKinzie AA, Sun J, Curran E, Qian Y, et al. Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing. J Neurosci. 2000;20:639–648. doi: 10.1523/JNEUROSCI.20-02-00639.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Kikuchi K, Arawaka S, Koyama S, Kimura H, Ren CH, et al. An N-terminal fragment of ProSAAS (a granin-like neuroendocrine peptide precursor) is associated with tau inclusions in Pick's disease. Biochem Biophys Res Commun. 2003;308:646–654. doi: 10.1016/s0006-291x(03)01391-3. [DOI] [PubMed] [Google Scholar]
  • 65.Wada M, Ren CH, Koyama S, Arawaka S, Kawakatsu S, et al. A human granin-like neuroendocrine peptide precursor (proSAAS) immunoreactivity in tau inclusions of Alzheimer's disease and parkinsonism-dementia complex on Guam. Neurosci Lett. 2004;356:49–52. doi: 10.1016/j.neulet.2003.11.028. [DOI] [PubMed] [Google Scholar]
  • 66.Mzhavia N, Qian Y, Feng Y, Che FY, Devi LA, et al. Processing of proSAAS in neuroendocrine cell lines. Biochem J. 2002;361:67–76. doi: 10.1042/0264-6021:3610067. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.Abdi F, Quinn JF, Jankovic J, McIntosh M, Leverenz JB, et al. Detection of biomarkers with a multiplex quantitative proteomic platform in cerebrospinal fluid of patients with neurodegenerative disorders. J Alzheimers Dis. 2006;9:293–348. doi: 10.3233/jad-2006-9309. [DOI] [PubMed] [Google Scholar]
  • 68.Hook VY. Neuroproteases in peptide neurotransmission and neurodegenerative diseases: applications to drug discovery research. BioDrugs. 2006;20:105–119. doi: 10.2165/00063030-200620020-00005. [DOI] [PubMed] [Google Scholar]
  • 69.Kuki K, Maeda K, Takauchi S, Kakigi T, Maeda S, et al. Neurochemical and pathological alterations following infusion of leupeptin, a protease inhibitor, into the rat brain. Dementia. 1996;7:233–238. doi: 10.1159/000106885. [DOI] [PubMed] [Google Scholar]
  • 70.Petersen RC, Doody R, Kurz A, Mohs RC, Morris JC, et al. Current concepts in mild cognitive impairment. Arch Neurol. 2001;58:1985–1992. doi: 10.1001/archneur.58.12.1985. [DOI] [PubMed] [Google Scholar]
  • 71.Folstein MF, Folstein SE, McHugh PR. “Mini-mental state”. A practical method for grading the cognitive state of patients for the clinician. J Psychiatr Res. 1975;12:189–198. doi: 10.1016/0022-3956(75)90026-6. [DOI] [PubMed] [Google Scholar]
  • 72.Morris JC. The Clinical Dementia Rating (CDR): current version and scoring rules. Neurology. 1993;43:2412–2414. doi: 10.1212/wnl.43.11.2412-a. [DOI] [PubMed] [Google Scholar]
  • 73.Thalmann B, Monsch AU, Bernasconi F, Berres M, Schneitter M, et al. Die CERAD Neuropsychologische Testbatterie - Ein gemeinsames minimales Instrumentarium zur Demenzabklärung. Basel: Memory Clinic, Geriatrische Universitätsklinik Basel; 1998. [Google Scholar]
  • 74.Härting C, Markowitsch HJ, Neufeld H, Calabrese P, Deisinger K. Deutsche Adaptation der revidierten Fassung der Wechsler-Memory Scale (WMS-R) Göttingen: Verlag Hans Huber, Bern; 2000. [Google Scholar]
  • 75.Reitan RM. Trail Making Test (TMT) Göttingen: Hogrefe Verlag, Bern; 1979. [Google Scholar]
  • 76.Shulman KI, Shedletsky R, Silver IL. Challenge of time: Clock-drawing and cognitive function in the elderly. Int J Ger Psychiatr. 1986;1:135–140. [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Figure S1

Reproducibility of the CE-MS measurements. Protein contour plots of 4 CSF-samples obtained by fractionated extraction of six aliquots of cerebrospinal fluid from one patient. The molecular mass (in kDa, logarithmic scale) on the y-axis is plotted against CE-migration time (in min) on the x-axis.

(TIFF)

Figure S2

Comparability of the CE-MS measurements. (A) Contour plot of the entire cerebrospinal fluid proteome. The molecular mass (in kDa, logarithmic scale) on the y-axis is plotted against CE-migration time (in min) on the x-axis. The arrangement of the peptides in distinct lines is obvious. (B) Contour plot of 279 identified peptides. The lines already observed in (A) could be comprehended as a result of the number of positive charges z (at pH 2). (C) By means of several examples for determined peptide sequences the correlation between the effective netto-charge, molecular mass and the CE-migration time is demonstrated. Basic amino acids are colored in red.

(TIFF)

Figure S3

Tandem mass spectra of the AD biomarkers. The mass spectra of all 12 AD biomarkers (see Protein ID) are shown in the following figures. Spectra of the identified peptides are annotated with fragment assignments from the OMSSA (Open Mass Spectrometry Search Algorithm; http://pubchem.ncbi.nlm.nih.gov/omssa) searches. The corresponding sequence is displayed above each spectrum. Identified b-ions are marked in blue and y-ions in red color.

(PDF)

Table S1

AD marker list. Initial set of 131 putative AD biomarkers present with high frequency in CSF of AD are listed. Shown are unique internal protein ID, molecular mass (in Dalton), CE-migration time (in minutes), observed frequency of occurrence and the corresponding mean amplitudes in AD and controls, and unadjusted p-values. Peptides that have an unadjusted p-value limit of 0.01 are highlighted in bold letters.

(XLS)

Table S2

Prospective sample data. Patients (n = 100): Final diagnoses (clinical outcome) before unblinding: AD (52), still MCI (14), mixed dementia (6), vascular dementia (5), FTD (6), depression (6), schizophrenia (3), delusional disorder (1), encephalitis (2), Parkinson dementia (2), alcohol psychosis (1), amyotropic lateral sclerosis (1), Chorea Huntington (1). Scores: cut-off for AD>0, FTD>−0.1, schizophrenia>0.1. Row AD-MS and AD-IM contains the values for AD diagnosis for mass spectrometry and immunochemistry: tp, true positiv; tn, true negative, fp, false positive, fn, false negative for diagnosis AD. File further includes data for gender, age, diagnoses for the prospective patient sample, scores for peptide patterns and the values for the biomarker total tau, phospho181-tau, and beta-amyloid1–42 if available.

(XLS)

Table S3

Neuropsychological tests used to classify MCI according to Petersen et al. [70] and dementia cases. Mini-Mental State Examination (MMSE) [71], Clinical Dementia Rating (CDR) [72], CERAD test battery [73], WMS-R Logical Memory [74], Trail Making Test (TMT) [75], and Clock Drawing Test (CDT) [76].

(XLS)

Table S4

Precision data examples. Precision study for ten cerebrospinal fluid samples which are measured twice.

(XLS)

Table S5

CE-MS raw data of the 176 samples used in the study. Only data that were actually utilized (that are present in at least 40% of the samples of one of the diagnostic groups, see section “Methods”) are shown. The protein IDs of all peptides are given in the first column named “protein ID”, the unique sample IDs constitute the first row. The MS data from each sample are reflected in one column. The number in each cell represents the normalized signal intensity of the mass spectrometric signal of each peptide detected in the sample.

(XLS)


Articles from PLoS ONE are provided here courtesy of PLOS

RESOURCES