Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2012 Dec 1.
Published in final edited form as: Microbes Infect. 2011 Aug 31;13(14-15):1199–1210. doi: 10.1016/j.micinf.2011.08.013

Analysis of the Glycoproteome of Toxoplasma gondii using Lectin Affinity Chromatography and Tandem Mass Spectrometry

Qilie Luo 1,5, Rajendra Upadhya 2, Hong Zhang 2, Carlos Madrid-Aliste 5, Edward Nieves 2,5, Kami Kim 3,4, Ruth Hogue Angeletti 1,5, Louis M Weiss 2,4,*
PMCID: PMC3228262  NIHMSID: NIHMS333113  PMID: 21920448

Abstract

Glycoproteins are involved in many important molecular recognition processes including invasion, adhesion, differentiation, and development. To identify the glycoproteins of Toxoplasma gondii, a proteomic analysis was undertaken. T. gondii proteins were prepared and fractioned using lectin affinity chromatography. The proteins in each fraction were then separated using SDS-PAGE and identified by tryptic in gel digestion followed by tandem mass spectrometry. Utilizing these methods 132 proteins were identified. Among the identified proteins were 17 surface proteins, 9 microneme proteins, 15 rhoptry proteins, 11 heat shock proteins (HSP), and 32 hypothetical proteins. Several proteins had 1 to 5 transmembrane domains (TMD) with some being as large as 608.3 kDa. Both lectin-fluorescence labeling and lectin blotting were employed to confirm the presence of carbohydrates on the surface or cytoplasm of T. gondii parasites. PCR demonstrated that selected hypothetical proteins were expressed in T. gondii tachyzoites. This is data provides a large scale analysis of the T. gondii glycoproteome. Studies of the function of glycosylation of these proteins may help elucidate mechanism(s) involved in invasion improving drug therapy as well as identify glycoproteins that may prove to be useful as vaccine candidates.

Keywords: glycosylation, Toxoplasma, glycoproteome, membrane proteins, lectin chromatography

1. Introduction

Toxoplasma gondii is an obligate intracellular parasite of both humans and domestic animals. Infection in humans is common occurring via food-borne or waterborne transmission and via maternofetal transmission resulting in congenial infection [1, 2]. There are three major life stages of this Apicomplexan: the tachyzoite which is involved in acute infection and dissemination of the parasite in its host, the bradyzoite which is found in tissue cysts and latent infection, and the oocysts which is the sexual stage that develops in the feline gastrointestinal system[3]. Usually people become infected with T. gondii after ingestion of uncooked or undercooked meat products containing bradyzoites, or oocyst/sporozotes from contaminated water or soil[4]. This causes an acute infection, due to tachyzoites, which is occasionally symptomatic, but in the majority of cases resolves resulting in latent infection. Latent infection persists due to the formation of cysts, containing bradyzoites, in muscle, neurons and glia. It is capable of causing severe congenital neurological impairment in acquired in utero [1, 3]. Infection can reactivate from latent tissue cysts in patients with immune suppression, such as HIV infection, resulting in acute infections most often manifesting as encephalitis [4]. Reported T. gondii infection rates can be as high as 70%, depending on the population or geographic area studied[1]. T. gondii can infect all warm-blooded mammals although the definitive hosts are members of the cat family.

Glycosylation, both N-linked and O linked oligosaccharides, is one of the most common and important post-translation modifications seen in eukaryotic proteins [57]. This post translational modification can have significant effects on protein structure and function and is often a developmentally regulated process. Glycosylation pathways occur in the cytosol, endoplasmic reticulum, and the Golgi complex and involve transport steps, processing glycosidases, and glycosyltransferases[8, 9]. Glycosylation is often found on membrane and secreted proteins, being added onto these proteins during transport and synthesis in the ER (N-linked glycosylation) or during passage through the Golgi (O-linked glycosylation) Oligossacchrides greatly affect the physical properties and biological functions of many proteins playing critical roles in correct protein folding as well as cell-cell interactions.

Several studies had suggested that glycosylation was rarely seen in T. gondii proteins and this issue was considered controversial, but recent papers have clearly demonstrated glycoproteins in T. gondii RH strain tachyzoites [1012]. Glycosylation has been demonstrated on proteins in the inner membrane complex associated with motility[10, 12]. Consistent with this observation, tunicamycin treated parasites have been demonstrated to have defects in invasion and motility [10, 12]. The tissue cyst wall (formed by modification of the parasitophorous vacuole by bradyzoites) of T. gondii has been demonstrated to react with the lectins Dolichos biflorus (DBA) and succinyl Wheat Germ Agglutinin (SWGA)[13]. Examination of the T. gondii genome (www.toxodB.org) demonstrates the presence of enzymes for the synthesis of both N-linked (dolichol-linked precursor oligosaccharides) and O-linked (UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferases) modifications[14, 15]. Cell free extracts of T. gondii have been demonstrated to have both N-glycosylation and O-glycosylation activity using synthetic peptide substrates [1517]. In addition, studies using mass spectrometry have defined the presence of Man6(GlcNAc)2, Man7(GlcNAc)2, and Man8(GlcNAc)2 N-glycans in T. gondii [12]. Interestingly, there was an absence of glycans containing sialic acid, galactose and fucose residues in this analysis [12].

The development of new preventative and therapeutic strategies for pathogens should relay on an improved understanding of the interactions between pathogens and their hosts. Surface proteins are a potential target of many compounds aimed at preventing microbial infections and many of these proteins are glycosylated. Moreover, because surface proteins are likely to interact with the host immune system, they often become components of effective vaccines, many of which are based on glycoproteins. T. gondii, like other Apicomplexa, is surrounded by a triple membrane system, termed the pellicle, consisting of the plasmalemma and inner membrane complex. There are several approaches currently in practice to identify surface proteins. The first approach is based on surface protein prediction by genome analysis using algorithms such as PSORT [18]. The method is rapid but is not fully reliable nor is it quantitative. The second approach employs separation of membrane and cell wall fractions from the cytoplasmic fraction followed by the identification of proteins by 2D-gel electrophoresis or 2D-chromatography coupled to mass spectrometry [5]. This approach is reasonably quantitative. Subcellular extraction can simplify this type of analysis and enhance protein identification.

In this report we demonstrate a simple and efficient approach for determining the glycoproteome of T. gondii. A buffer containing detergent and a high salt concentration was utilized to extract surface and organelle glycoproteins using serial lectin affinity chromatography (SLAC). From this fraction, 132 glycoproteins were identified. Several methods were used to confirm the identification and the presence of carbohydrates on the surface or in cytoplasm of T. gondii.

2. Materials and methods

2.1 Host cells and parasites

Toxoplasma gondii RH strain was maintained by serial passage in confluent monolayers of human foreskin fibroblasts (HFF) incubated at 37°C under a 5% CO2 atmosphere in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% (v/v) fetal bovine serum (FBS, Invitrogen, CA), 2mM glutamine and 20mM penicillin streptomycin. Cells were maintained as a contact-inhibited monolayer until required. Infection was maintained by inoculating flasks (T25 or 75) with freshly harvested tachyzoites. Parasites were purified by passing infected cells through a 25 gauge needle and then separated from host cell debris by passage through a 3μm Nucleopore membrane. Parasites were pelleted and then used for either protein or RNA purification. Total RNA was extracted using TRIzol (Invitrogen CA) as per the manufacturer’s recommendations.

2.2 Extraction of T. gondii proteins

T. gondii (2 × 1010) was suspended in 1ml PBS containing 0.5% Nonidt P40 and 500 mM NaCl and protease inhibitor cocktail (Complete Protease Cocktail, Roche Applied Science, Indianapolis, IN) and incubated for 2 hours at 4°C on ice. The tube was then centrifuged at 13600 × g in an Eppendorf microcentrifuge for 16 min and the supernatant collected for lectin affinity chromatography.

2.3. Serial lectin affinity chromatography (SLAC)

Spin columns of Agarose bound to Con A, WGA, or Jaclin (Vector Laboratories, Burlingame, CA) were equilibrated with buffer A (10 mM Tric Cl, pH 7.5, 150 mM NaCl, 1mM CaCl2, 1mM MnCl2). One ml of the T. gondii membrane extraction was first applied to the Con A column, this column was allowed to rotate at 4°C for 2 h and then the ConA column was then spun down (1000 × g for 1 min) and the pass through loaded into WGA column. The WGA column was then handled as noted for the Con A column with the pass-through being loaded onto the Jaclin column. Once the glycoproteins were bound to each column (i.e. ConA, WGA and Jaclin) the columns were washed extensively with buffer A until no proteins could be detected in washes. Elution was then carried out by incubation for 15 min with 200 mM α-methyl mannoside (α-MM) for the Con A column, 500 mM N-acetyglucosamine (NAGlc) for the WGA column, and 800 mM galactose for the Jaclin column, respectively followed by centrifugation (100 × g for 10 min). The eluates were then used for SDS-PAGE and subsequent mass spectrometry. This workflow is outlined in Figure 1. Changing the order of the columns might change where in the purification a protein appeared, as a protein could bind to multiple lectins, however, one would expect a similar overall list of proteins if the columns were used in a different order.

Figure 1.

Figure 1

Schema for glycoprotein enrichment for proteomic analysis of T. gondii by LC-MS/MS.

2.4. SDS-PAGE and in-gel tryptic digestion

Protein eluates (30 μl per lane) were analyzed by electrophoreses in a 7.5 to 17.0 % gradient, 1 mm thick gel using a constant current of 400 mA for 1 h. The resolved proteins were visualized by GelCode Blue (Pierce, IL) and the corresponding bands were excised. The gel bands were destained with 60% acetonitrile solution and then the proteins in the gels were digested with trypsin[19]. Briefly, gel pieces were completely dried down in a vacuum centrifuge, rehydrated with a trypsin solution and allowed to incubate on ice for 45 min. After 45 min, the trypsin supernatant was removed and replaced with approximately 20 μl of digestion buffer without trypsin so that the gel pieces were covered. The gel pieces were kept wet at 37 °C overnight for digestion with mixing.

2.5. LC-MS Analysis

The labeled tryptic peptides were subjected to LC-MS/MS analysis on an LTQ mass spectrometer (Thermo Scientific, San Jose, CA). Chromatographic separation of peptides was performed on a nano HPLC System (LC Packings, San Francisco, CA, USA). The LC eluate from a 75 μm i.d. ×15 cm, PepMap C18 column (Dionex, Marlton, NJ) was directed to a micro-ionspray source. Throughout the LC gradient, MS and MS/MS data were recorded continuously using a 6-sec cycle time. With each cycle, MS data were accumulated for 1 s, followed by three CID acquisitions of 2.5 s each on ions selected by preset selection parameters of the data-dependant acquisition method. In general, the ions selected for CID were the 2 most abundant obtained from the survey MS spectrum, except that singly charged ions were excluded and dynamic exclusion was employed to prevent repetitive selection of the same ions within a preset time. Rolling collision energies were used to adjust automatically for the charge state and the mass/charge value of the precursor ion. Searches were performed using Mascot and a T. gondii protein database (http://toro.aecom.yu.edu/biodefense/) [1921]. In all searches, oxidation of methionine, deamidation of asparagines and glutamine and conversion of glutamine to pyroglutamic acid (N-terminus) were selected as variable modifications and carboxyamidomethylation of cysteine residues was selected as a fixed modification, and a maximum of one missed cleavage. The peptide precursor mass tolerance was +/− 2 Da and the MS/MS product ions, +/− 0.8 Da. The data were also searched against a scrambled decoy database with false discovery rate of 1%.

2.6. Isolation of glycopeptides from intact T. gondii

In other experiments, trypsin was utilized to cut the surface membrane proteins free from T. gondii, (2 hr at 37°C), the T. gondii were then removed by centrifugation (10,000 × g for 3 min). The supernatant containing the liberated glycoproteins was then removed and was allowed to complete its proteolysis until tryptic peptides were obtained (12 hr at 37°C). The supernatant was diluted in buffer A and Con A conjugated beads (lectin affinity chromatography) were used to capture these glycopeptides. The column was washed three times with buffer A, twice with buffer B (25 mM Tris, 10 mM NaCl, pH7.36) and then the bound glycopeptides were released from the beads by incubation for 2 hr at 37 °C in buffer B containing peptide N-glycosidase F (PNGase F) and the column washed with 1 volume of buffer B. The last wash and PNGase F fractions were pooled and then strong cation exchange chromatography (SCX beads) was used to fractionate the deglycosylated peptide mixture into eight fractions by step-gradient elution using standard protocols. Nano-LC-MS/MS was then performed to analyze these eight fractions, and obtain amino acid sequences of the released glycopeptides.

2.7. Lectin blotting

For detection of lectin-binding sites on glycoproteins following SDS-PAGE and transfer to PFA membranes, the following HRP conjugated lectins (EY Laboratories) were used: Con A, high affinity for alpha-D-mannosyl residues; wheat germ agglutinin (WGA), affinity for D-N-acetylglucosamine; Jacalin, high affinity for N-acetylgalactosamine-beta-1,3-galactose. After blocking PFA membranes in 1% BSA/PBS containing 0.2 % Tween 20 for 4 h, they were incubated for 1 h at room temperature with lectins conjugated with HRP in PBS/0.2%BSA/0.2 Tween 20 at the following concentrations: 1 μg/mL Con A, 2 μg/mL WGA, 2μg/mL Jacalin, respectively. All incubations were accompanied by control incubations in the presence of corresponding inhibiting sugars: 0.4 M methyl-mannopyranose for Con A, 0.5 M N-acetylglucosamine for WGA, 0.8 M galactose for Jaclin. After rinsing using TBS/0.2% Tween 20, wash three times for 5 min in the same buffer, and reactive bands were detected according to the manufacturer’s instructions (Amersham Biosciences, Part of GE Healthcare).

2.8. Lectin-fluorescence labeling

For surfacing labeling of parasites, freshly purified T. gondii tachyzoites were suspended in fixation buffer (PBS/3% paraformaldehyde/0.05% glutaraldehyde, pH 7.2) at 105 parasites/ml and were then applied to poly-lysine coated (100 μg/ml) glass coverslips for 30 min. After adherence onto coverslips specimens were rinsed in PBS and placed in blocking solution (PBS/1%BSA/50 mM glycine) for 4h. Lectins (ConA, WGA, Jacalin) conjugated with FITC were diluted 1:200 in PBS and incubated with the coverslips for 1 h at 37°C. Specimens were rinsed five times in PBS for 5 min each time and then briefly rinsed in distilled water. For a negative control slides were incubated with anti mouse IgG -FITC at 1:500 for 1 hour and then rinsed five times in PBS. For a positive control slides were incubated with a mAb to SAG1 (p30 a major T. gondii surface antigen) at 1:500 for 1 hour followed by washing with PBS, then incubation with secondary anti-mouse IgG-FITC at 1:500 for 1 hour and then washed 5 times in PBS. The preparations were then examined on a Leitz Laborlux S fluorescence microscope.

For the detection of intracellular lectin binding sites, parasites were fixed in PBS/3% paraformaldehyde, and after adherence onto coverslips rinsed in PBS and subsequently permeabilized using 0.1% Triton X100 for 30 min. After fixation the coverslips were rinsed three times in PBS and were placed into blocking solution (PBS/1%BSA/50 mM glycine), washed with PBS and incubated with 1:200 lectin conjugated with FITC in PBS for 1 h at 37°C. Specimens were then rinsed in five times in PBS for 5 min each time and then briefly rinsed in distilled water. The preparations were then examined on a Leitz Laborlux S fluorescence microscope.

2.9. Hydropathy calculations and transmembrane mapping

All identified proteins were analyzed using the ProtParam program (available at http://www.expasy.ch/sprot/sprot-top.html), which allows the calculation of the grand average of hydrophobicity (GRAVY) value for a given protein. The proteins exhibiting positive GRAVY values were recognized as a hydrophobic. All identified proteins were examined by the TMHMM Server (Prediction of transmembrane helices in proteins; http://www.cbs.dtu.dk/services/TMHMM). The analysis was performed to map TMDs [22].

2.10. Polymerase Chain Reaction (PCR)

A total RNA of 5ug was used for the synthesis of cDNA using AMV reverse transcriptase (TAKARA USA BIO) following the protocol supplied with the reagent. One ul of the resultant cDNA was used as a template in a 50ul PCR reaction using the fast start high fidelity PCR system (Roche Applied Science, IN). Hot start amplification was initiated with 2 min 95°C denaturation, followed by 30 cycles (95°C for 15sec, 53°C for 15 sec, and 72°C for 3 min) of amplification which was terminated by a 72°C extension for 10 min. Gene products were cloned into the PCR8GWTOPO vector (Invitrogen, CA) by TOPO cloning and sequenced at the Einstein Sequencing Facility.

The following oligonucleotide primer pairs were used for proteins identified by SLAC (the ID number of the corresponding gene from ToxodB (www.toxodb.org) is listed followed by the primers used (5′-3′) for RT-PCR for each gene): 55.m00103 (TCATTCACCCCGTTTTT TGTGACTCTTGG::CTGACGTGACGCTGCGTACTGACTG); 41.m01274 (TCGGA CTCGGTCGGTCGAAATGTGC::CTCGGACTCACAAGCCAGTGAATACGTCG), 76.m01589 (GTGTGCCTCAGGCACTGGTGGCTC::GCCTCGCTGCATCGTCTCTCGA), 67.m00007 (TGGCGCATCTGGAGATGCCGGCTG::TCGCCTTGCGGAAACGTGTACGTCC), 49.m03169 (CAGGCGATAGCGCGGGGGGACCGC:: TTCGCTTGGTCTCTGGTAGCCCAGCC), 80.m02161(AGGGCGATCGTGGCATCGACGCAGCAG::GTTGTGTTTGCTGCCTGCAGAGCC GCGCA), 46.m01601 (AAGCCACAAGTTTTGTTCGGTCTTC::AACGTATTTCTTC AAAAGGTTGTCAAGGGTGG), 42.m03584 (TCGTCATCCAGATTGGTACTCGTTTCC::CCCC GTGACGGGGAAGTACGCAGTCAGTTGA), 31.m00928 (AGGACGTCACGTCTCTTGTG TGCATTTGG::CAGCACTTGTTGCATTG CGATTCCAGAAGC), 55.m08219 (AAAGTGACCA CGAAAGGGCTTGCTTT TGC:: CATCCGATGTGAAGAAAGTTCGGTAGTTGG), 50.m00023 (GCTGAAACTGCTCTGTACTAC CAGG::GTATTTGAAGTTCGGAGGCAACACAAACGC), 76.m01543 (TGTGTGTGGTACGGACAGGCACG::TATATTGTCATCTTGCTCGCCAGGA CCTGAAGCG), 59.m03403 (ATCCACACGGGCCTGGATCTGC::GTGAGCAGGAGCACCG GCCGGT)

3. Results

3.1 Glycoprotein identification

T. gondii membrane proteins were separated by SLAC followed by SDS-PAGE (Figs.1 and 2). Among the proteins identified from T. gondii by SLAC as having glycoepitopes were 9 microneme proteins, 7 dense granule proteins, 15 rhoptry proteins, 17 surface proteins, 19 enzymes, 11 heat shock proteins, 20 other proteins, and 32 hypothetical proteins (Table 1 and Supplemental Table 1). This data has been deposited at EPICdB (http://toro.aecom.yu.edu/cgi-bin/biodefense/main.cgi) and ToxodB. (http://toxodb.org/toxo/) [20]. Of these 132 glycoproteins some bound only to con A; some to both WGA and con A, or con A and Jacalin, or WGA and Jacalin; and some to all three lectins (see Table 1 final column). The majority of these proteins were purified using the Con A column. Of interest, is that one of the 32 novel hypothetical proteins, protein (80.m02347), with a molecular weight of 608.3 kDa was predicted by TMHHD to have a single TM helix domain with the majority of its structure being outside the membrane on the surface of the parasite. Table 1 presents all of the SLAC identified proteins organized according to presumed function. The majority of these proteins have predicted N-glycosylation sites (http://www.cbs.dtu.dk/services/NetNGlyc/). It was previously believed that glycosylation was rare in T. gondii proteins; however, our data provide evidence for a large number of previously unrecognized glycoproteins in this organism. Overall, this work demonstrates that SLAC combined with tandem MS is a powerful approach for glycoproteomic analysis in T. gondii and that glycosylation occurs in a significant number of the proteins.

Figure 2. SDS-PAGE of T. gondii glycoproteins isolated by lectin affinity chromatography.

Figure 2

The protein molecular weight standards are shown on the left. The gel band numbers correspond to proteins identified in Table S1 and Table 2. Std: molecular weight standard.

Table 1.

The glycoproteins identified from T. gondii using lectin affinity chromatography.

gene id Release 6 Name Protein Name Percent Coverage MOWSE Mw (kDA) Gel Band
MICRONEME PROTEINS
NR-2062142 TGME49_091890 microneme TgMIC1 46 4723 48.6 ConA21
WGA7
JAC12
20.m00002 TGME49_001780 microneme protein, putative TgMIC2 11 49 124.8 ConA12
641.m00002 TGME49_119560 MIC3 microneme protein TgMIC3 26 400 37.9 ConA13
25.m00006 TGME49_008030 micronemal protein 4 TgMIC4 23 303 63 ConA17
WGA5
JAC9
NR-4704627 TGME49_018520 microneme protein, putative TgMIC6 19 50 36.6 ConA29
WGA12
JAC17
NR-118500931 TGME49_004130 perforin-like protein 1; PLP1 44 5922 124.6 ConA8
20.m03849 TGME49_004130 membrane-attack complex/perforin domain-containing protein; PLP1 18 95 117.3 ConA16
55.m00005 TGME49_055260 apical membrane antigen 1, putative AMA1 38 112 63 ConA16
JAC9
20.m00387 TGME49_004050 subtilase family serine protease, putative TgSUB1 5 42 132.6 JAC1
DENSE GRANULE PROTEINS
42.m00015 TGME49_027620 28kd antigen GRA2 (or p28) 30 313 19.8 JAC18
NR-161913 TGME49_027620 28kd antigen; GRA2 (or p28) 20 70 28 JAC22
NR-22652337 TGME49_027280 dense granule protein, putative GRA3 17 396 24.2 ConA29
42.m00013 TGME49_027280 Dense granule protein 3 GRA3 16 61 22.2 WGA12
63.m00002 TGME49_075440 dense granule antigen GRA6 27 49 24 ConA27
20.m00005 TGME49_003310 granule antigen protein GRA7 86 701 25.8 ConA28
NR-2062409 TGME49_003310 29kD excretory dense granule protein GRA7 34 88 25.8 ConA29
JAC16
RHOPTRY PROTEINS
NR-897823 TGME49_109590 rhoptry protein ROP1 18 1323 42.6 ConA20
NR-563627 TGME49_015780 rhoptry protein 2 ROP 2 (ROP2A) 32 1585 64 ConA19
NR-52788873 TGME49_095110 rhoptry protein 4 ROP4 (ROP4/7 locus) 28 289 64 ConA17
JAC11
NR-134035971 TGME49_108080 rhoptry protein 5 ROP5 13 80 60.8 ConA22
JAC10
551.m00238 TGME49_108080 rhoptry protein 5 ROP5 28 2991 60.9 ConA17
WGA5
83.m02145 TGME49_095110 rhoptry protein ROP7 (ROP4/7 locus) 16 415 103.8 ConA18
42.m03584 TGME49_027810 rhoptry protein 11 ROP11 7 48 58 ConA21
NR-71559154 TGME49_112270 rhoptry protein 13 ROP13 9 51 44.8 ConA25
55.m08219 TGME49_062730 rhoptry protein 16 ROP16 17 1271 76.2 JAC13
NR-84618297 TGME49_005250 rhoptry protein 18 ROP18 21 276 62.3 ConA19
583.m00597 TGME49_110010 rhoptry neck protein 1 TgRON1 8 43 118.8 ConA13
NR-71559160 TGME49_100100 rhoptry neck protein 2 TgRON2 31 389 155.5 ConA7
583.m00636 TGME49_111470 rhoptry neck protein 5 TgRON5 27 190 56.2 ConA22
JAC13
583.m00011 TGME49_114500 subtilisin-like protease TgSUB2 TgSUB2 9 57 141.5 ConA8
JAC7
33.m02185 TGME49_014080 toxofilin 21 83 27.1 JAC17
SURFACE PROTEINS
76.m01626 TGME49_085870 SRS domain-containing surface antigen, putative; SRS20A 68 459 34.9 ConA27
44.m00008 TGME49_033450 GPI-anchored surface protein SRS29A (or SRS1) 21 100 44.2 ConA22
NR-123186979 TGME49_033460 major surface antigen 1 SRS29B (SAG1 or p30) 25 55 32.5 ConA26
NR-50082488 TGME49_033460 unnamed protein product SRS29B (SAG1 or p30) 66 701 26.7 ConA27
NR-22219177 TGME49_033460 unnamed protein product; SRS29B (SAG1 or p30) 86 29783 29.8 ConA28
NR-129348 TGME49_033460 major surface antigen P30 precursor; SRS29B (SAG1 or p30) 55 2728 26.7 WGA11
JAC16
NR-10723 TGME49_033460 major surface antigen P30 precursor; SRS29B (SAG1 or p30) 69 6669 34.8 ConA29
44.m00010 TGME49_033480 SRS domain-containing protein SRS29C (or SRS2 or p35) 16 105 39.1 ConA25
NR-2305260 TGME49_033480 SAG1-related sequence 2 SRS29C (or SRS2 or p35) 20 367 39.3 ConA26
NR-5901701 TGME49_033480 P35 surface protein, putative; SRS29C (or SRS2 or p35) 11 54 28.5 ConA26
WGA9
NR-161926 TGME49_071050 surface antigen P22; SRS34A (SAG2A or p22) 48 3605 19 ConA31
JAC19
57.m01840 TGME49_067140 SRS domain-containing protein; SRS38B 7 68 40.9 ConA26
583.m00001 TGME49_108840 conserved hypothetical protein; SRS51 (or SRS3) 19 270 38 ConA28
583.m05672 TGME49_115320 SRS domain-containing protein; SRS52A 33 47 34.2 ConA28
NR-13447088 TGME49_108010 surface protein, putative 40 844 41.7 ConA25
641.m01520 TGME49_119550 transmembrane protein, putative 14 58 76.1 ConA14
129.m00256 TGME49_099110 cleft lip and palate transmembrane protein 1, putative 9 65 68 ConA15
ENZYMES
50.m03211 TGME49_048160 ATP-dependent DNA helicase II, 70 kDa subunit, putative; Ku70 1, 8 304 94.5 ConA4
52.m01559 TGME49_053030 alpha-glucosidase II, putative 18 140 183.2 ConA4
42.m00006 TGME49_028170 serine/threonine protein phosphatase, putative 25 218 170.7 ConA5
JAC2
113.m00789 TGME49_097650 serine/threonine protein phosphatase, putative 3 50 69 ConA15
NR-133990372 TGME49_028170 serine/threonine protein phosphatase, putative 40 2048 168.2 ConA7
44.m02735 TGME49_032600 patatin-like phospholipase domain-containing protein 8 56 70.8 ConA8
JAC5
583.m05329 TGME49_110080 long-chain-fatty-acid-CoA ligase, putative 10 64 138.6 ConA12
38.m01100 TGME49_019130 glutathione reductase, putative 24 58 64 ConA14
80.m02253 TGME49_089940 uroporphyrinogen decarboxylase, putative 4 50 56.2 ConA17
33.m00007 TGME49_015260 carbamoyl phosphate synthetase II 4 44 186.9 ConA17
83.m00004 TGME49_094200 putative glucose-6-phosphate-1-dehydrogenase 23 80 62.7 ConA18
WGA6
41.m01273 TGME49_020940 ribosomal RNA large subunit methyltransferase J, putative 3 68 82.2 ConA18
27.m00003 TGME49_011680 putative protein disulfide isomerase 33 97 52.8 ConA19
WGA6
55.m04808 TGME49_059010 vacuolar ATP synthase subunit D, putative 33 106 44.9 ConA22
20.m03680 TGME49_001840 eukaryotic aspartyl protease, putative; TgASP1 23 153 66.9 ConA27
28.m00308 TGME49_012310 vacuolar ATP synthase 16 kDa proteolipid subunit, putative 16 103 17.5 ConA32
57.m01692 TGME49_064650 SRS domain-containing, N-acetylglucosamine-phosphate mutase, putative 29 3655 324.2 WGA1
TgTigrScan_3843 TGME49_078850 glucose-6-phosphate dehydrogenase, putative 12 196 197.8 JAC5
44.m02735 TGME49_032600 patatin-like phospholipase domain-containing protein 12 81 70.8 JAC5
HEAT SHOCK PROTEINS
49.m00060 TGME49_044560 heat shock protein 90, putative; HSP90 23 70 99.1 ConA1
WGA3
JAC5
80.m00001 TGME49_088380 heat shock protein 90; HSP90 9 43 89.5 ConA3
583.m00009 TGME49_111720 heat shock protein 70, putative; HSP70 16 301 73.2 ConA9
WGA4
JAC4
59.m00003 TGME49_073760 heat shock protein 70, putative; HSP70 22 508 72.8 ConA14
WGA4
JAC8
NR-3323502 TGME49_073760 heat shock protein, putative; HSP70 23 508 72.3 ConA14
JAC7
50.m00085 TGME49_051780 heat shock protein 70kD, putative; HSP70 17 43 70.6 ConA14
WGA4
JAC8
NR-12248795 TGME49_073760 hsp70; HSP70 39 421 73.4 ConA15
42.m03533 TGME49_026830 DnaK family protein; HSP70 33 617 101.6 ConA7
49.m00030 TGME49_040600 TCP-1/cpn60 chaperonin family protein, putative 30 84 72.2 ConA15
50.m00006 TGME49_047550 heat shock protein, putative; HSP60 11 86 60.9 ConA17
WGA5
JAC9
55.m00016 TGME49_058390 DnaJ protein, putative 19 61 44.6 ConA23
OTHERS
NR-2209250 TGME49_035470 myosin A, putative; TgMyoA 30 379 93.2 ConA11
25.m00007 TGME49_009030 actin 39 224 41.9 JAC13
59.m00006 TGME49_070240 cyst matrix protein 12 48 62.4 ConA15
46.m01699 TGME49_036540 RRM domain-containing protein 21 377 65.7 ConA18
76.m00016 TGME49_094800 elongation factor 1-alpha, putative 23 304 49 ConA20
50.m05680 TGME49_050770 eukaryotic translation initiation factor 4A 20 48 46.6 ConA20
50.m00069 TGME49_049270 thioredoxin, putative 18 148 46.9 ConA22
42.m00047 TGME49_025800 ABC transporter, putative 35 46 35.6 ConA24
38.m00002 TGME49_018410 60S acidic ribosomal protein P0 28 111 34.1 ConA25
64.m00002 TGME49_076140 ADP-ribosylation factor, arf, putative 37 147 21 ConA30
49.m00025 TGME49_039890 SCP-like extracellular domain-containing protein 15 178 26.6 ConA31
55.m00221 TGME49_063700 40s ribosomal protein S14, putative 25 91 16.3 ConA32,
JAC20
541.m01147 TGME49_105010 RNA binding protein, putative 24 84 24.4 ConA32
583.m00614 TGME49_109740 small nuclear ribonucleoprotein, putative 17 43 28.2 ConA33
59.m03439 TGME49_069180 crooked neck-like protein 1, putative 6 53 93.7 WGA6
76.m01689 TGME49_087170 kinesin motor domain-containing protein, putative 14 49 142.3 WGA7
42.m00069 TGME49_026410 elongation factor 1-beta, putative 28 64 36 WGA10
641.m01588 TGME49_120600 glycine-rich protein 2, putative 30 323 23 WGA15
80.m02347 TGME49_092020 cysteine repeat modular protein, putative 6, 7 593 608.3 ConA1
641.m01513 TGME49_119340 kelch motif domain-containing protein 18 77 44 JAC15
HYPOTHETICAL PROTEINS
20.m03804 TGME49_003520 hypothetical protein 6 43 256.2 ConA4
42.m00026 TGME49_023920 hypothetical protein 14 61 214.7 ConA6
50.m07132 TGME49_047210 hypothetical protein, conserved 7 57 50.7 ConA6
55.m00103 TGME49_058870 hypothetical protein 17 94 88.1 ConA9
80.m02216 TGME49_089500 hypothetical protein 34 2170 100.2 ConA11
20.m00331 TGME49_002200 hypothetical protein 22 84 80.1 ConA13
583.m05446 TGME49_111710 hypothetical protein 22 345 133 ConA15
49.m00054 TGME49_043930 hypothetical protein 12 1155 101.3 ConA16
JAC8
41.m01274 TGME49_020950 hypothetical protein 16 146 35.4 ConA17
76.m01589 TGME49_085180 hypothetical protein 22 158 66.1 ConA18
41.m01337 TGME49_022100 hypothetical protein 11 82 128.2 ConA19
67.m00007 TGME49_079100 hypothetical protein 38 214 47.7 ConA20
49.m03169 TGME49_039740 hypothetical protein 20 63 44.7 ConA22
80.m02161 TGME49_088650 hypothetical protein 43 1289 47.8 ConA23
583.m05736 TGME49_116250 hypothetical protein 32 308 44.7 ConA24
20.m08222 TGME49_003990 hypothetical protein, conserved 17 91 25.5 ConA24
80.m02287 TGME49_090730 hypothetical protein, conserved 48 1777 37.2 ConA25
46.m01601 TGME49_034380 hypothetical protein 17 144 39.4 ConA26
31.m00928 TGME49_013280 hypothetical protein 25 359 20.8 ConA30
41.m00025 TGME49_022880 hypothetical protein 3 47 27.5 ConA31
583.m05298 TGME49_109600 hypothetical protein 4 45 106.5 WGA3
NR-95007087 TGME49_095100 hypothetical protein 5 43 152.2 WGA10
583.m00652 TGME49_112420 hypothetical protein 5 57 85.9 WGA12
JAC13
69.m00143 TGME49_079420 hypothetical protein 33 2572 144.6 JAC1
42.m03456 TGME49_025860 hypothetical protein 15 604 102.4 JAC3
50.m00023 TGME49_045610 hypothetical protein, conserved 20 378 79.1 JAC13
76.m01543 TGME49_083540 hypothetical protein, conserved 34 2959 47.1 JAC15
59.m03403 TGME49_068760 hypothetical protein 18 320 32 JAC17
583.m05643 TGME49_114840 hypothetical protein, conserved 9 131 228.8 ConA3
50.m03374 TGME49_050820 hypothetical protein, conserved 6 52 259.3 ConA3
WGA4
31.m00856 TGME49_012790 hypothetical protein 6 268 230.5 JAC3
NR-35187725 TGME49_015980 hypothetical protein, conserved 10 339 20.2 WGA14

3.2. Glycopeptide Isolation from Intact T. gondii

A total of 30 T. gondii glycoproteins were identified using an approach which employed trypsin to “shave” surface proteins off of T. gondii followed by completion of the proteolysis of the liberated proteins until tryptic peptides were obtained. The glycopeptides were then purified by Con A lectin affinity chromatography and the bound glycopeptides released from the affinity column by PNGase F and analyzed by mass spectrometry. As expected, most of the identified glyoproteins were putative membrane proteins based on BLAST similarities (Table 2), some, however, were enzymes and hypothetical proteins of unknown function and localization. All of the proteins had N-linked glycoprotein domains (indicated by bold type in Table 2) consistent with the presence of glycoepitopes in these proteins. This simplified approach of “protein shaving”, could prove to have significant utility for the identification of unknown or previously unsuspected T. gondii surface membrane proteins.

Table 2.

The glycoproteins identified from T. gondii using “membrane shaving” PNGF technique

EPICdB ID ToxodB version 6.0 Identified Peptide Protein Name
TgGlmHMM_0006 TGME49_037860 QMNISLAAA SAFR DNA polymerase I, putative
TgTigrScan_4836 TGME49_118470 AGNVGLNLTR DNA repair protein, putative
TgTigrScan_1309 TGME49_117700 NQTTASSAQLR enoyl-CoA hydratase, putative
TgGlmHMM_1305 TGME49_017680 GVNVTIDR hypothetical protein, conserved
TgGlmHMM_0380 TGME49_097110 NLTNVYMNAFAGTQPSR kinesin motor domain containing protein
541.m01146 TGME49_104990 AHAQSVNATSTLPQ HSEK guanylate binding protein, putative
49.m00054 TGME49_043930 TMNSEGVISDGLQSQLPVNHTR hypothetical protein TGME49_043930
TgTigrScan_5612 TGME49_014560 AIGENGSCMHKSTSPAR hypothetical protein TGME49_014560
TgTigrScan_5939 TGME49_019320 NYTSEALR GAP50 membrane anchor for myosin XIV
TgGlmHMM_4009 TGME49_058770 QRENGSGSSQLPGAANGR UDP-N-acetyl-D-galactosamine:polypeptide
N-acetylgalactosaminyltransferase T2
TgTigrScan_7263 TGME49_005410 MEALSNESRSSFHDVCDETAQK RNA pseudouridylate synthase, putative
TgGlmHMM_2200 TGME49_112480 MEANSSSSSLPSVQK uracil phosphoribosyltransferase
129.m00256 TGME49_099110 NNTTLYVHVR cleft lip and palate transmembrane protein 1, putative
TgTigrScan_4899 TGME49_000250 CWKTSKCVFMoHFNNDGCTLSGINATAQTDANSK PAN domain-containing protein
TgGlmHMM_0029 TGME49_087480 NASPSATSGLLKQLK hypothetical protein TGME49_087480
TgTigrScan_5651 TGME49_110750 GNETALMPK hypothetical protein, conserved
TgTigrScan_0391 TGME49_042890 ENQSANACIENNR hypothetical protein TGME49_042890
TgTigrScan_5004 |TGME49_082030 EQIVEKNDTLELHDR hypothetical protein TGME49_082030
57.m03967 TGME49_066660 NLTARQEGLSK hypothetical protein TGME49_066660
TgTigrScan_1934 TGME49_047260 GGAQNASEAIRTESDK retinoblastoma-binding protein, putative
TgTigrScan_7907 TGME49_115760 TNTEGNATPVDSQSSPPSK hypothetical protein, conserved
TgGlmHMM_0680 TGGT1_018880 NLSTTPSAVQTEER conserved hypothetical protein
TgTigrScan_4198 TGME49_002980 LATQQVTAQTSNVSQALGDRK hypothetical protein TGME49_002980
TgTwinScan_3338 TGME49_080730 NRSLCAGGAAAEAAVAQK nucleotide-binding protein, putative
TgTigrScan_4829 TGME49_118370 AMNPSSPPHPNHPVDNVSQ hypothetical protein TGME49_118370
TgTigrScan_2810 TGME49_066670 LASQSMPTDAENTSFTLQGGSVGMGLGGRER hypothetical protein TGME49_066670
TgGlmHMM_0694 TGME49_002540 TEQGTALLTGAPPSANELEAASAMANPT‘“NSS”’R 3′,5′-cyclic nucleotide phosphodiesterase, putative
TgTigrScan_5174 TGME49_079340 NQQETEMNGSPHNAAR hypothetical protein TGME49_079340
TgTigrScan_4790 TGME49_120590 EMENVSGDARAGGIGASDK glycosyl hydrolases family 35 domain-containing protein
TgTigrScan_7969 TGME49_095710 SPTSQGNNASAVCRASRAPSGQEAEMR ubiquitin-transferase domain-containing protein

3.3. Detection of lectin binding in T. gondii using florescence microscopy

FITC-conjugated Con A, WGA, and Jacalin were used to examine the microscopic localization of these lectins in RH strain tachyzoites (i.e. a lectin IFA technique). Con A produced a bright and uniform staining on the entire surface of every tachyzoites (see Fig. 3A) as did WGA and Jacalin. When these organisms were permeablized with 0.1% Triton X-100 diffuse staining of the cytoplasm was seen. No specific structures (i.e. micronemes, rhoptries, dense granules, etc.) were uniquely stained by any of these lectins. This suggests that glycoepitopes binding these lectins are present in both membrane bound and cytoplasmic proteins (Fig. 3A).

Figure 3. Lectin binding to T. gondii.

Figure 3

A. Fluorescence microscopy of lectin-stained T. gondii. Con A-FITC, WGA-FITC, and Jacalin-FITC was employed to examine both fixed and permeabized (0.2% Triton X100) T. gondii. There was no change in staining with permabilization. All three lectins bound to the parasite consistent with the presence of glycoproteins. Negative control: antimouse-FITC, Positive control: mAb to SAG1 (p30) with secondary anti-mouse IgG-FITC. Bar length in each panel is 5 μm.

B. Lectin overlay with ConA,, WGA and Jacalin. Blots were probed with horseradish peroxidase conjugated Con A, WGA, and jacalin, respectively. Numerous bands were present demonstrating the presence of both N- and O-glycoroteins in T. gondii tachyzoites. No bands were seen when the sugars binding each lectin (e.g. α-methyl mannoside for ConA, N-acetylglucosamnine for WGA and galactose for jacalin) were added to the elution buffer.

3.4. Detection of glycoproteins using lectin-blotting

Further information on the presence of glycoproteins in T. gondii was obtained by employing HRP-conjugated lectins Con A, WGA, and Jacalin. Following SDS-PAGE and transfer to nitrocellulose, the same lectins used for fluorescence studies were used to probe the three different fractions obtained after NP-40 extraction of T. gondii tachyzoites (Fig. 3B). This lectin overlay procedure demonstrated multiple bands in the solubized membrane preparations. Binding of the lectins to these proteins could be blocked by the addition of the corresponding saccharide used for SLAC elution in the lectin-HRP binding solution. These results demonstrate that the membrane protein preparation contains glycoproteins with both mannose and N-acetylglucosamine modifications.

3.5. PCR validation

To test for the presence of expression of hypothetical proteins identified by mass spectrometric techniques, we chose 13 candidate proteins which were annotated as hypothetical proteins in the T. gondii genome database. Of these, 8 were eluted with α-methyl mannoside from the ConA column and 4 were identified in the galactose eluted fraction from the jacalin column. A forward and reverse primer was designed to the beginning and end of the target gene coding region as predicted in the T. gondii database. As shown in Fig. 4, out of 13 target genes there were specific PCR products of the predicted size for 12 of the candidate genes confirming their expression at the transcriptional level in T. gondii RH strain validating the presence and active expression of the majority of the genes corresponding to the hypothetical proteins identified by mass spectrometry.

Figure 4. RT-PCR of the genes corresponding to hypothetical glycoproteins identified by mass spectrometry.

Figure 4

Lanes 1–8 and lane 13 are the gene products in which the corresponding protein was eluted from Con A column by α methyl mannoside and the lanes 9–12 belongs to gene products corresponds to proteins eluted from jacalin column by galactose. Lane 1: 55.m00103, Lane 2: 41.m01274, Lane 3: 76.m01589, Lane 4: 67.m00007, Lane 5: 49.m03169, Lane 6: 80.m02161, Lane 7: 46.m01601, Lane 8: 42.m03584, Lane 9: 31.m00928, Lane 10: 55.m08219, Lane 11: 50.m00023, lane 12:76.m01543, Lane 13: 59.m03403. Std: DNA ladder.

4. Discussion

The identification of an entire proteome, regardless of its origin, is a daunting task for several reasons. The dynamic range of current instrumentation is limited by fluctuating protein expression levels, which may span more than six orders of magnitude. In addition, the limited sensitivity and ability of contemporary proteomics to characterize proteins with high molecular masses, extreme isoelectric points, or extremes in hydrophobicity precludes complete coverage of a given proteome. One approach to circumvent these difficulties is to reduce sample complexity by fractionation. The enrichment of proteins from a selected part of proteome is expected to facilitate the identification of low abundance proteins and assist characterization of proteins related to specific organelles or structures. Fractionation of tachyzoites using the non-ionic detergent NP-40 and 500 mM NaCl demonstrated that the majority of glycoproteins were identified in the NP-40-soluble, hydrophobic, fraction, which is enriched for membrane proteins; however, it should be appreciated that this method may not detect all of the integral glycoproteins. In addition, while the method used should limit protein complex formation during SLAC it is still feasible that some of the identified proteins may have been purified due to their binding to glycoprotein(s) which bound to the columns.

In the current manuscript we present several lines of evidence that indicate the presence of a significant number of glycoproteins in T. gondii tachyzoites. This data confirmed that a significant number of proteins involved in invasion and motility are probably glycoproteins. This is consistent with observations from other investigators [1013, 15, 16, 23] as well as the presence of the enzymatic machinery for both N-linked and O-linked glycosylation in the T. gondii genome (www.toxodB.org)[14]. Both lectin overlay (i.e. lectin blotting) and lectin IFA techniques confirmed the presence of glycoproteins and provided independent validation of the SLAC results. In addition, it has been previously reported that tunicamycin treatment of T. gondii decreased the number of proteins purified by ConA affinity chromatography [12]. Many of the glyoproteins that were identified were membrane-associated proteins. We identified several surface antigens (SAGs and SRS domain proteins) by SLAC as being probable glycoproteins. By microscopy, ConA, WGA and jacalin fluorescent conjugates labeled the surface of T. gondii.

T. gondii has several specialized organelles associated with invasion and its ability to establish a parasitophorous vacuole in which it replicates within its host cell [1, 3, 24]. The apical end of this parasite contains an elaborate cytoskeletal structure and regulated secretory organelles, the micronemes and rhoptries, which function in host cell invasion discharging their contents from the apical end of the parasite. Microneme proteins are released first, upon contact with the host cell and are thought to function in host cell and are thought to function in host cell recognition and attachment. The content of rhoptries are released next and may function in the formation of the parasitophorous vacule (PV). Another secretory vacuole, the dense granules, discharge from the apical, lateral, and posterior surfaces of the parasite. Dense granule proteins are released next during the formation of the parasitophorous vacuole. Several of the glycoproteins we identified were from these organelles, suggesting that this post translational modification may be important in the process of invasion and establishment of the parasitophorous vacuole. This is consistent with data on the ability of tunicamycin to inhibit invasion[10, 12]. In addition, many of the identified proteins in these structures had TMDs, suggesting that they were membrane associated. Microneme proteins (MIC) 1, 2, 3, 4, 6 were identified as glycoproteins and MIC 2 and MIC6 also had predicted TMDs. Fifteen rhoptry proteins (ROPs and RONs) were identified as glycosylated and four have at least one TMD. This is consistent with a previous publication that also found evidence for glycosylation in RON2 and AMA [12], which are key components in the moving junction formed during cell invasion. Seven dense granule proteins (GRA) proteins were identified as glycoproteins and four GRAs have two TMD. Consistent with these findings, it had been previously demonstrated that GRA2 is O-glycosylated[25], Several cytoskeletal components were also identified as glycoproteins consistent with data that demonstrated that membrane anchor myosin XIV (GAP50) and TgMyoA were glycoproteins and involved in the effect of tunicamycin on invasion [10, 12]. These data are suggestive that glycoproteins are components of the glideosome. Our data confirmed that myosin, despite lacking an obvious ER motif, is consistently purified by lectin affinity chromatography. In other eukaryotes there are examples of proteins being glycosylated without such ER motifs [26, 27]. Overall, our data suggest that glycoproteins are key constituents in host-parasite interactions during invasion and establishment of the parasitophorous vacuole.

Heat shock- or stress induced activation of a set of heat shock protein genes is a characteristic of eukaryotic and prokaryotic cells. The heat shock proteins have been implicated as chaperons for protein folding and transport [2830]. Heat shock proteins fall into several subfamilies, the low molecular weight (16–35 kDa) or small heat shock proteins (smHsps), the hsp60 family, the hsp70 family (68–78 kDa), and the high molecular weight (89–110 kDa) heat shock protein families (hsp90 and hsp100) [28, 29]. In recent years, it has become clear that heat shock proteins are not just restricted to stress responses, but are also regulated developmentally [28, 29]. In protozoan systems, a link between heat shock proteins and development and intracellular survival has been established [29]. We identified 11 heat shock proteins as possible glycoproteins. In examination of the identified protein gene predictions, there appear to be two different types of hsp90 one with TMD and one without TMD, five isotypes of hsp70 of which one has TMD and two hsp60s one with and one without a TMD. Consistent with our data Tomavo and his collaborators also have demonstrated that a number of heat shock proteins were present in their analysis of N-glycosylation in T. gondii [12].

Overall, this work clearly demonstrates that SLAC combined with tandem MS is a powerful approach for glycoproteomics in T. gondii and that glycosylation is not a rare modification but occurs in a significant number of the proteins of this important human and veterinary pathogen.

Supplementary Material

01

Supplemental Table 1. Details of the peptides identified from T. gondii using lectin affinity chromatography and mass spectrometry.

Acknowledgments

Supported by NIH/NIAID grant AI31744 (LMW), NIH/NIAID contract HHSN266200400054C, NIH/NIAID R01AI087625 (KK) and and RC4AI092801 (KK)

Footnotes

Publisher's Disclaimer: This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final citable form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain.

References

  • 1.Weiss LM, Kim K. Toxoplasma gondi: The Model Apicomplexan: Perspectives and Methods. Elsevier (Academic Press); Amsterdam; Boston: 2007. [Google Scholar]
  • 2.Tenter AM, Heckeroth AR, Weiss LM. Toxoplasma gondii: from animals to humans. Int J Parasitol. 2000;30:1217–1258. doi: 10.1016/s0020-7519(00)00124-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Dubey JP. Advances in the life cycle of Toxoplasma gondii. Int J Parasitol. 1998;28:1019–1024. doi: 10.1016/s0020-7519(98)00023-x. [DOI] [PubMed] [Google Scholar]
  • 4.Wong SY, Remington JS. Biology of Toxoplasma gondii. AIDS. 1993;7:299–316. doi: 10.1097/00002030-199303000-00001. [DOI] [PubMed] [Google Scholar]
  • 5.Marino K, Bones J, Kattla JJ, Rudd PM. A systematic approach to protein glycosylation analysis: a path through the maze. Nat Chem Biol. 2010;6:713–723. doi: 10.1038/nchembio.437. [DOI] [PubMed] [Google Scholar]
  • 6.Vagin O, Kraut JA, Sachs G. Role of N-glycosylation in trafficking of apical membrane proteins in epithelia. Am J Physiol Renal Physiol. 2009;296:F459–469. doi: 10.1152/ajprenal.90340.2008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Tian E, Ten Hagen KG. Recent insights into the biological roles of mucin-type O-glycosylation. Glycoconj J. 2009;26:325–334. doi: 10.1007/s10719-008-9162-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Bill RM, Revers L, Wilson IBH, editors. Protein glycosylation. Kluwer Academic Publishers; Boston: 1998. [Google Scholar]
  • 9.Taylor ME, Drickamer K, editors. Introduction to glycobiology. Oxford University Press; Oxford; New York: 2006. [Google Scholar]
  • 10.Luk FC, Johnson TM, Beckers CJ. N-linked glycosylation of proteins in the protozoan parasite Toxoplasma gondii. Mol Biochem Parasitol. 2008;157:169–178. doi: 10.1016/j.molbiopara.2007.10.012. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Garenaux E, Shams-Eldin H, Chirat F, Bieker U, Schmidt J, Michalski JC, Cacan R, Guerardel Y, Schwarz RT. The dual origin of Toxoplasma gondii N-glycans. Biochemistry. 2008;47:12270–12276. doi: 10.1021/bi801090a. [DOI] [PubMed] [Google Scholar]
  • 12.Fauquenoy S, Morelle W, Hovasse A, Bednarczyk A, Slomianny C, Schaeffer C, Van Dorsselaer A, Tomavo S. Proteomics and glycomics analyses of N-glycosylated structures involved in Toxoplasma gondii--host cell interactions. Mol Cell Proteomics. 2008;7:891–910. doi: 10.1074/mcp.M700391-MCP200. [DOI] [PubMed] [Google Scholar]
  • 13.Zhang YW, Halonen SK, Ma YF, Wittner M, Weiss LM. Initial characterization of CST1, a Toxoplasma gondii cyst wall glycoprotein. Infect Immun. 2001;69:501–507. doi: 10.1128/IAI.69.1.501-507.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Samuelson J, Banerjee S, Magnelli P, Cui J, Kelleher DJ, Gilmore R, Robbins PW. The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A. 2005;102:1548–1553. doi: 10.1073/pnas.0409460102. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Stwora-Wojczyk MM, Kissinger JC, Spitalnik SL, Wojczyk BS. O-glycosylation in Toxoplasma gondii: identification and analysis of a family of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferases. Int J Parasitol. 2004;34:309–322. doi: 10.1016/j.ijpara.2003.11.016. [DOI] [PubMed] [Google Scholar]
  • 16.Dieckmann-Schuppert A, Bause E, Schwarz RT. Glycosylation reactions in Plasmodium falciparum, Toxoplasma gondii, and Trypanosoma brucei brucei probed by the use of synthetic peptides. Biochim Biophys Acta. 1994;1199:37–44. doi: 10.1016/0304-4165(94)90093-0. [DOI] [PubMed] [Google Scholar]
  • 17.Stwora-Wojczyk MM, Dzierszinski F, Roos DS, Spitalnik SL, Wojczyk BS. Functional characterization of a novel Toxoplasma gondii glycosyltransferase: UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-T3. Arch Biochem Biophys. 2004;426:231–240. doi: 10.1016/j.abb.2004.02.013. [DOI] [PubMed] [Google Scholar]
  • 18.Nakai K, Horton P. PSORT: a program for detecting sorting signals in proteins and predicting their subcellular localization. Trends Biochem Sci. 1999;24:34–36. doi: 10.1016/s0968-0004(98)01336-x. [DOI] [PubMed] [Google Scholar]
  • 19.Che FY, Madrid-Aliste C, Burd B, Zhang H, Nieves E, Kim K, Fiser A, Angeletti RH, Weiss LM. Comprehensive proteomic analysis of membrane proteins in Toxoplasma gondii. Mol Cell Proteomics. 2011;10:M110.00745. doi: 10.1074/mcp.M110.000745. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Madrid-Aliste CJ, Dybas JM, Angeletti RH, Weiss LM, Kim K, Simon I, Fiser A. EPIC-DB: a proteomics database for studying Apicomplexan organisms. BMC Genomics. 2009;10:38. doi: 10.1186/1471-2164-10-38. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Dybas JM, Madrid-Aliste CJ, Che FY, Nieves E, Rykunov D, Angeletti RH, Weiss LM, Kim K, Fiser A. Computational analysis and experimental validation of gene predictions in Toxoplasma gondii. PLoS One. 2008;3:e3899. doi: 10.1371/journal.pone.0003899. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Chen Y, Yu P, Luo J, Jiang Y. Secreted protein prediction system combining CJ-SPHMM, TMHMM, and PSORT. Mamm Genome. 2003;14:859–865. doi: 10.1007/s00335-003-2296-6. [DOI] [PubMed] [Google Scholar]
  • 23.Odenthal-Schnittler M, Tomavo S, Becker D, Dubremetz JF, Schwarz RT. Evidence for N-linked glycosylation in Toxoplasma gondii, Biochem J. 1993;291:713–721. doi: 10.1042/bj2910713. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Dubey JP, Lindsay DS, Speer CA. Structures of Toxoplasma gondii tachyzoites, bradyzoites, and sporozoites and biology and development of tissue cysts. Clin Microbiol Rev. 1998;11:267–299. doi: 10.1128/cmr.11.2.267. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Mercier C, Lecordier L, Darcy F, Deslee D, Murray A, Tourvieille B, Maes P, Capron A, Cesbron-Delauw MF. Molecular characterization of a dense granule antigen (Gra 2) associated with the network of the parasitophorous vacuole in Toxoplasma gondii. Mol Biochem Parasitol. 1993;58:71–82. doi: 10.1016/0166-6851(93)90092-c. [DOI] [PubMed] [Google Scholar]
  • 26.Blachly-Dyson E, Stevens TH. Yeast carboxypeptidase Y can be translocated and glycosylated without its amino-terminal signal sequence. J Cell Biol. 1987;104:1183–1191. doi: 10.1083/jcb.104.5.1183. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Silve S, Monod M, Hinnen A, Haguenauer-Tsapis R. The yeast acid phosphatase can enter the secretory pathway without its N-terminal signal sequence. Mol Cell Biol. 1987;7:3306–3314. doi: 10.1128/mcb.7.9.3306-3314.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Tutar L, Tutar Y. Heat shock proteins; an overview. Curr Pharm Biotechnol. 2010;11:216–222. doi: 10.2174/138920110790909632. [DOI] [PubMed] [Google Scholar]
  • 29.Shonhai A. Plasmodial heat shock proteins: targets for chemotherapy. FEMS Immunol Med Microbiol. 2010;58:61–74. doi: 10.1111/j.1574-695X.2009.00639.x. [DOI] [PubMed] [Google Scholar]
  • 30.Csermely P, Korcsmáros T, Sulyok K, editors. Stress responses in biology and medicine: stress of life in molecules, cells, organisms, and psychosocial communities. Blackwell Pub. (New York Academy of Sciences); Boston, Mass: 2007. [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

01

Supplemental Table 1. Details of the peptides identified from T. gondii using lectin affinity chromatography and mass spectrometry.

RESOURCES