Abstract
The functionally important regions of signal proteins participating in their specific interaction and responsible for transduction of hormonal signal into cell are rather short in length, having, as a rule, 8 to 20 amino acid residues. Synthetic peptides corresponding to these regions are able to mimic the activated form of full-size signal protein and to trigger signaling cascades in the absence of hormonal stimulus. They modulate protein-protein interaction and influence the activity of signal proteins followed by changes in their regulatory and catalytic sites. The present review is devoted to the achievements and perspectives of the study of signal protein-derived peptides and to their application as selective and effective regulators of hormonal signaling systems in vitro and in vivo. Attention is focused on the structure, biological activity, and molecular mechanisms of action of peptides, derivatives of the receptors, G protein α subunits, and the enzymes generating second messengers.
1. Introduction
The transduction of signals generated by hormones and hormone-like substances of different nature to intracellular effector proteins controlling the fundamental cellular processes requires coordinated activity of many signal proteins, components of a wide spectrum of G protein-coupled and G protein-independent signaling systems, and has several steps in common. The first step is the recognition and specific binding of ligands with extracellular domains of sensors represented by some families of transmembrane proteins, such as the G protein-coupled receptors (GPCRs) seven times penetrating the plasma membrane, the tyrosine kinase receptors having a single transmembrane region (TM) and intracellular domain possessing the intrinsic tyrosine kinase activity, the natriuretic peptide receptors including the membrane-bound guanylyl cyclases, and natriuretic peptide clearance receptor (NPR-C) lacking cyclase activity. The ligand binding is responsible for alteration of conformation of the extracellular regions of receptor and, in the case of GPCRs, for changes of the three-dimensional structure of receptor transmembrane channel (TMC) participating in formation of the ligand-binding site, which starts to transfer the external signal across the plasma membrane and triggers intracellular signaling cascade [1–3]. In the case of G protein-coupled signaling systems the second step of signal transduction is the interaction of intracellular regions of ligand-activated receptor with α subunit and/or βγ dimer of heterotrimeric G protein in inactive, GDP-bound, state, which induces the GDP/CTP exchange in guanine nucleotide-binding site of Gα subunit and the dissociation of GTP-bound Gα subunit from Gβγ dimer, and the third step is the interaction of GTP-bound Gα subunit or free Gβγ dimeric complex with the enzymes, adenylyl cyclase (AC) and phospholipase C (PLC), generating the second messengers, or with the ionic channels, which significantly amplify the initial signal [4–6]. In the activated state the Gα subunit possesses intrinsic GTPase activity and hydrolyses the bound GTP to GDP, which returns it to the inactive, GDP-bound, state allowing its association with Gβγ dimer to form Gα βγ-heterotrimeric complex [7–10]. In the case of receptors possessing the tyrosine kinase activity the second and the third steps are characterized by the functional interaction between the regulatory and catalytic domains located within multifunctional intracellular tail of these sensor proteins, which leads to triggering the cascade of phosphorylation-dephosphorylation of downstream regulatory and effector proteins [11–13]. It should be mentioned that the binding of ligand with the extracellular domain of natriuretic peptide receptor NPR-C leads to interaction between its short cytoplasmic region and G proteins; the latter, the same as in the case of GPCR, become activated. It seems quite likely that some tyrosine kinase receptors, the epidermal growth factor (EGF) receptor in particular, have a similar mechanism of action [11, 14, 15].
Nowadays it is commonly accepted that the regions of signal proteins participating in their functional interaction and, consequently, responsible for transfer of hormonal signal to cell are rather short and usually contain 8 to 20 amino acid residues [16]. Using different approaches of molecular biology, it is shown that in a majority of cases point mutations in these regions primarily responsible for minimal changes in their conformation drastically influence functional activity of signal proteins and block signal transfer via them. It is not unexpected therefore that the synthetic peptides corresponding to these regions are able to trigger signaling cascades in the absence of hormonal stimulus, modulate protein-protein interaction, and influence the functional activity of signal proteins induced due to changes in their regulatory and catalytic sites. They have been used as important tools in mimicking functional domains of signal proteins, the component of hormonal signaling systems. The present review is devoted to the achievements and perspectives of the study of hormonal signaling systems described in terms of the peptide strategy, a new perspective approach of biochemistry and molecular endocrinology, based on application of synthetic peptides as probes corresponding to functionally important regions of signal proteins, such as receptors of different nature, heterotrimeric G proteins, and the enzymes generating second messengers and responsible for appropriate response of the cell to external signal.
2. The Receptors of the Serpentine Type
As a rule, the serpentine type receptors interact with heterotrimeric G proteins and share a highly conserved transmembrane domain consisting of seven hydrophobic TMs (TM1–TM7) and joined by three extracellular loops, three intracellular loops (ICL1, ICL2, and ICL3), extracellular N-terminal domain, and cytoplasmic C-terminal domain (CTD) [17]. The extracellular loops and N-terminal domain form the external surface of TMC participating in ligand-binding function of the receptor, while the ICLs and CTD interact with a number of signal, regulatory and adaptor proteins, including α and βγ subunits of G protein, RGS-proteins, arrestins, PDZ domain-containing proteins, and G protein-coupled receptor kinases [18, 19].
There are numerous data giving evidence that in a majority of GPCRs the membrane-proximal amino- and carboxyl-terminal regions of ICL3 (N- and C-ICL3), TM3/ICL2 interface containing a highly conserved DRY-motif, and the N-terminal region of CTD (N-CTD) forming in some GPCRs an extra, fourth, loop are involved in the binding and activation of G proteins and, thus, are responsible for signal transduction via ligand-activated GPCR to intracellular effector proteins [1, 16, 20–24] (Figure 1). At present the peptides corresponding to these intracellular regions of over 30 GPCRs have been synthesized and their regulatory, and modulatory influence on cellular signaling studied [16, 21, 25–27]. They are successfully used as functional probes to study GPCR-coupled signaling systems, allowing identification of molecular determinants in intracellular domains of GPCRs responsible for their interaction with G proteins and other signal proteins and elucidation of three-dimensional structure and molecular dynamics of intracellular domains of GPCR in inactive, agonist-free, as well as active, agonist-bound, states, revealing the structural-functional organization of oligomeric protein-protein complexes, including receptor molecules, and the role of these complexes in the regulation and control of signal transduction.
Figure 1.

The regions of GTP-bound Gα i1 subunit (yellow) responsible for its specific interaction with ligand-activated receptor.
One of the first receptors whose structural organization was studied using the peptide strategy is the light-activated sensor protein rhodopsin belonging to the most ancient family of the serpentine type receptors. Proceeding from the data that synthetic peptides corresponding to ICL2, ICL3, and CTD of rhodopsin significantly inhibit interaction between light-activated receptor and Gt protein, transducin, the conclusion was made that the intracellular domains of rhodopsin participate both in binding and in activation of Gt protein, which confirms the results of molecular-genetic and crystallographic studies of other authors [28, 29]. It is shown that effective interaction of peptide with Gt protein needs involvement of different regions of these domains since combination of two or three peptides, derivatives of ICL2, ICL3, and CTD, as compared to one, gives a 30–50 fold decrease of IC50 values for inhibitory effects of peptides on GTPase activity of transducin stimulated by light-activated rhodopsin and leads to complete impairment of coupling between the receptor and Gt protein.
A majority of biologically active GPCR-peptides correspond to ICL3 and ICL2, which is in good agreement with the important role of these loops in productive interaction of GPCR with G proteins and in hormone-induced signal transfer from the receptor ligand-binding site to the enzymes generating second messengers (Table 1). The peptides, derivatives of ICL3 and ICL2 of Gs-coupled β-adrenergic receptors (ARs) and Gi/o-coupled α 2-AR, selectively bind with G proteins, stimulate their functional activity, trigger signaling cascade in the absence of hormonal stimulus, inhibit the activation of their cognate receptors by selective AR agonists, as it is shown for peptides derived from the sequence 259–273 of β 2-AR ICL3 and the sequence 361–373 of α 2-AR ICL3 [30–37]. In the case of the D1- and D2-dopamine receptors (DRs), the 5-hydroxytryptamine receptors (5-HTR) of the type 1 and type 6 as well as the m2- and m4-muscarinic acetylcholine receptors (MChRs), all of which are coupled with Gs (D1-DR, 5-HT6R) or Gi/o proteins (D2-DR, 5-HT1A,1B,1DR, m2/4-MChR), and also m3-MChR coupled with Gq protein it is shown that the peptides, derivatives of the membrane-proximal regions of ICL3, especially C-ICL3, selectively bind and activate G proteins and inhibit their functional interaction with their cognate receptor upon agonist activation [30, 32, 38–44] (Table 1).
Table 1.
The peptides, derivatives of signal proteins, and their biological activity.
| Signal protein | Sequence | Activity | References | |
|---|---|---|---|---|
| α 2-AR (C-ICL3) | RWRGRQNREKRFTC361-373 and its dimeric constrain with N-ICL3-peptide RIYQIAKRRTR233-243 | Both selectively stimulate Gi/o proteins and inhibit α 2-AR agonist-stimulated GTPase activity | [30–32] | |
|
| ||||
| β 2-AR (C-ICL3) | RRSSKFCLKEKKALK259-273 | Selectively stimulates Gs proteins and decreases regulatory effects of β 2-AR agonists | [33–35] | |
|
| ||||
| D1-DR (C-ICL3, I), 5-HT6R (C-ICL3, II) | FKMSFKRETKVLKTLSV260-276 (I); KHSRKALKASL258-268K (II) | Stimulate Gs proteins and AC activity, decrease the stimulating effects of D1-DR (peptide I) and 5-HT6R (II) on AC system | [38, 39] | |
|
| ||||
| D2-DR (N-ICL3, I), 5-HT1AR (N-ICL3, II); 5-HT1BR (C-ICL3, III); 5-HT1DR (N-ICL3, IV; C-ICL3, V); m4-MChR (C-ICL3, VI) | VYIKIYIVLRRRRKRVNTK206-224 (I); LYGRIFRAARFRIRKTVK214-231 (II); ARERKATKTL307-316 (III); LYGRIYVAARSRI213-225 (IV); RKRISAARERKATK285-298 (V); RNQVRKKRQMAARERKVTR382-400 (VI) |
Selectively activate Gi/o proteins and inhibit forskolin-stimulated AC activity in the absence of hormone; inhibit signaling via their cognate Gi/o-coupled receptors | [30, 32, 39–42] | |
|
| ||||
| m3-MChR (C-ICL3) | LVKEKKAAQTLSAILL483-497 | Selectively activates Gq and influences m3-MChR-mediated signaling | [43] | |
|
| ||||
| δ-opioid receptor (ICL3) | MGRLRSVRLLSGSKEKDRSLRRITR237-261 | Blocks δ-agonist-induced PLC activation, Ca2+ release and cAMP signaling | [45] | |
|
| ||||
| Luteinizing hormone receptor; FSH receptor (C-ICL3, II); relaxin receptor RXFP1 (C-ICL3, III); parathyroid hormone receptor (C-ICL3, IV) | FAVQNPELMATNKDTKIAKK551-570 (I), HIYLTVRNPNIVSSSSDTRIAKR533-555 (II), and EIRNQVKKE(Nle)ILAKR615-629 (III) and their short analogs; EYRKLLK402-408 (IV) |
Activate preferably Gs proteins and stimulate the basal AC activity, inhibit agonist-induced signaling via their cognate receptors | [46–52] | |
|
| ||||
| GLP1R (ICL1 and ICL3) | FRHLHCTR169-176; IVIAKLKANLMCKTDIKCRLAK330-351 | Activate preferably Gs and Gi proteins, inhibit hormone- stimulated AC activity | [53] | |
|
| ||||
| V2-vasopressin receptor (ICL3) | Cyclo-QVLIFREIHASLVPGPSERAG-RRRRGRRTGSPSEGAHVSAAMAKT-VRMT225-273 | Decreases the affinity of agonist for the receptor and inhibits vasopressin-stimulated AC activity | [55] | |
|
| ||||
| CB1-cannabinoid receptor (N-ICL3, I; C-ICL3, II, and N-CTD, III) | KAHSHAVRMIQRGTQKS301-317 (I); QVTRPDQARMDIRLAK329-344 (II); RSKDLRHAFRSMFPSCE401-417 (III) | Selectively stimulate different isoforms of the α-subunits of Gi proteins and significantly inhibit AC activity | [56–58] | |
|
| ||||
| Angiotensin II receptor of the type 1 (ICL2, I; N-ICL3, II; C-ICL3, III, N-CTD, IV) | DRYLAIVHPMKSR125-137 (I); TLIWKALKKAYEIQKN216-231 (II); KNKPRNDDIFRI230-241 (III); FLGKKFKKYFLQL304-316 (IV) | Inhibit angiotensin-induced activation of G proteins and the effector enzymes; peptide II selectively activates Gi/o proteins, peptide III Gq/11 proteins | [59–62] | |
| FPR1 (ICL2, I; N-CTD, II) | CVLHPVWTQNHR126-137 (I); FRERLIHALPASLER308-322 (II) | Activate in a PTX-dependent manner Gi proteins; peptide II inhibits high affinity agonist binding to the receptor and its coupling to Gi protein | [63, 64] | |
|
| ||||
| Prostacyclin receptor (ICL1) | SARRPARPSAFAV39-51 | Selectively stimulates Gs proteins and the basal activity of AC | [65, 66] | |
|
| ||||
| Insulin receptor (tyrosine kinase region) | N-stearyl-TRDIYETDYYRK1142-1153 | Increases insulin- and vanadate-stimulated phosphorylation of IR; significantly enhances insulin-induced stimulation of PI3K and MAPK activities | [67] | |
|
| ||||
| Insulin receptor (C-terminal region) | N-stearyl-SSHCQREEAGGRDGG1293-1307 | Enhances insulin-stimulated autophosphorylation; increases insulin-stimulated PI3K and MAPK activities | [68] | |
|
| ||||
| EGF receptor (N-terminal region of the juxtamembrane domain) | RRREIVRKRTLRR646-658 | Activates Gs proteins, influences activity of Gi proteins | [69] | |
|
| ||||
| NPR-C (cytoplasmic domain) | KKYRITIERRNH461-472; RRNHQEESNIGK469-480; RRNHQEESNIGKHRELR469-485; HRELREDSIRSH481-492 and their analogs |
Inhibit the basal, forskolin- and hormone-stimulated AC activity; selectively increase GTP binding activity of Gi1 and Gi2 proteins; stimulate PLCβ3 activity; inhibit hormone-stimulated DNA synthesis in vascular smooth muscle cells; induce smooth muscle contraction | [70–72] | |
|
| ||||
| NPR-C (extreme C-terminal region of the cytoplasmic domain) | GKHRELREDSIRSHFSVA479-496 | Inhibits ANP(4–23)-induced Gi protein activation and cellular responses acting as a competitive inhibitor of ANP(4–23)-mediated signaling | [71] | |
|
| ||||
| Gα t | IKENLKDCGLF340-350 | Stabilizes the active state of opsin and meta-II-rhodopsin and meta-Ib-rhodopsin; | [73–76] | |
|
| ||||
| Gα s | RVFNDARDIIQRMHLRQYELL374-394 and its short analogs | Inhibit transduction of hormonal signal via Gs-coupled receptors | [77] | |
|
| ||||
| Gα s (Switch I and II regions, resp.) | RCRVLTSGIFETKFQVDK199-216; FDVGGQRDERRKWIQ-CFNDVTAIIFV222-247 | Increase the basal and forskolin-stimulated AC2 and AC6 activities; inhibit Gα s-stimulated activity of both AC isoforms; behave as partial agonist | [78] | |
|
| ||||
| Gα s (α3-β5 region) | EALNLFKSIWNNRWL-RTIS268-286 | Inhibits the basal and forskolin-stimulated activities of AC2 and AC6; significantly decreases the Gα s-stimulated enzyme activity | [78] | |
|
| ||||
| AC1 (C1b subdomain) | IKPAKRMKFKTVCYLLVQLMHCRKMF-KA495-522 (pAC28, C1b) | Binds CaM with high affinity in a Ca2+-independent manner; inhibits CaM-stimulated AC activity with IC50 equal to 500 nM | [79, 80] | |
| AC1 (C2a subdomain) | TEEVHRLLRRGS-YRFVCRGKV1024-1044 (pVLG, C2a) | Binds CaM with low affinity in a Ca2+-dependent manner; inhibits CaM-stimulated AC activity with IC50 is 10 μM | [80] | |
|
| ||||
| AC2 (C2 domain) | YTESDVNKEGLECLRLLNEIIADFD-DLL899-926 (α2, I); SKPKFSGVEKIKTIGSTYMAAT927-948 (β2-β3, II); DAINKHSFNDFKLRVGINHGPVIA-GVIGAQK984-1015 (α3-β4, III) |
All peptides inhibit Gα s- and forskolin-stimulated activities of AC2 and AC6; peptides I and III inhibit the basal AC activity; peptide I decreases Mn2+-stimulated activity | [81] | |
|
| ||||
| AC6 (C1 domain) | AAENHCLRIKILGDCYYC427-444 (α2-β2-β3, I); IHSGRVHCGVLGLRKWQFDVWSN-DV487-511 (β4-β5-α4, II) | Both peptides inhibit Gα s- and forskolin-stimulated AC activities; peptide II inhibits the basal activity of both AC2 and AC6 | [81] | |
|
| ||||
| PLCβ1b | N-Myristoyl-TPPNPQALKW1164-1173 (I); GEGSSSVLSESCHEDPSVPPNFTPP-NPQALKW1142-1173 (II) |
Both peptides dissociate the enzyme from membrane and inhibit PLC stimulation by hormones; peptide II prevents cardiomyocytes hypertrophy | [82, 83] | |
|
| ||||
| PLCβ3 | QEENTQL1161-1167 | Significantly inhibits intracellular calcium response to selective agonists of mGluR | [84] | |
|
| ||||
| PLCγ | GLYRKAMRLRYPV724-736, and its N-myristoylated analogs | Specifically inhibit PLC activity and PLC-dependent cellular processes | [85] | |
|
| ||||
| PLCδ1 (IQ-peptide) | VRSQVQHKPKEDKLKLVPELS473-493 | Inhibits PLC activity; binds CaM in Ca2+-independent manner | [86] | |
|
| ||||
| PLCδ1 | N-Myristoyl-TIPWNSLKQGYRHVHLL747-763 | Inhibits FSH-induced Ca2+ influx | [87] | |
|
| ||||
| Regulatory p85-subunit of PI3K (C-terminal region of N-terminal SH2 domain) | WNVGSSNRNKAENLLRGKR11-29 | Exhibits binding specificity and affinity for PI 3,4,5-P3 and inhibits PI 3,4,5-P3-binding to the p85 subunit | [88] | |
|
| ||||
| PKCζ (pseudosubstrate region) | N-Myristoyl-SIYRRGARRWRKL114-126 | Inhibits PKCζ activity; stimulates Akt, ERK1/2, p38 MAPK and eNOS activity | [89] | |
|
| ||||
| PKCη (pseudosubstrate region) | N-Myristoyl-RKRQRAMRRRVHQING156-171 | Inhibits PKCη activity; stimulates eNOS phosphorylation | [89] | |
There are many works demonstrating that the peptides corresponding to ICL3 of GPCRs that are activated by the peptide and protein hormones influence GPCR-signaling with high efficiency and selectivity. The ICL3-peptide 237–261 of the δ-opioid receptor blocks high-affinity binding of δ-agonists, significantly decreases Gi/o-mediated AC inhibition and PLC activation following the stimulation of the δ-opioid receptor, but has no influence on Gs- and Gq-coupled signaling cascades regulated via the same receptor [45]. The peptides corresponding to ICL3 of the luteinizing hormone receptor, the follicle-stimulating hormone (FSH) receptor, the relaxin receptor of the type 1 (RXFP1), the glucagon-like peptide-1 receptor (GLP1Rs) and the parathyroid hormone receptor selectively activate distinct types of G proteins and influence signal transduction via their cognate receptors [46–53] (Table 1).
The cyclic and dimeric forms of GPCR-peptides, as a rule, possess higher activity compared with linear peptides as their three-dimensional structure is more similar to that of the corresponding loop in intact receptor. Among the peptides, derivatives of α 2-AR ICL3, the most potent activator of Gi/o proteins is dimeric constrain formed by cross-linked peptides, derivatives of N- and C-ICL3 [31, 54]. A cyclic peptide 225–273 mimicking the full-length ICL-3 of Gs-coupled V2-vasopressin receptor activates Gs proteins and significantly inhibits the AC activity stimulated both by vasopressin and by guanine nucleotides, its action on vasopressin-regulated AC system being more potent compared with linear analogs [55].
The membrane-proximal N-CTD in some GPCRs forms additional, fourth, intracellular loop and participates in the interaction with GPCR-coupled downstream signal proteins, G proteins in particular. The same refers to peptide 401–417 corresponding to N-CTD of the CB1-cannabinoid receptor, which, like ICL3-peptides 301–317 and 329–344, stimulates GTPγS binding of Gi proteins and inhibits forskolin-stimulated AC activity [56–58] (Table 1). As for N-CTD-peptide 645–653 of FSH receptor and its short analog, they significantly reduce FSH-stimulated estradiol synthesis in cultured Sertoli cells and increase the GDP/GTP exchange of G proteins in the rat testis membranes [46, 47]. The fact that the peptides corresponding to the membrane-proximal regions of ICL2, ICL3, and CTD of the type 1 angiotensin II receptor activate G proteins and inhibit angiotensin II-induced stimulation of their GTPase activity suggests these regions, the same as rhodopsin, to be involved in the interaction with G proteins [59–62]. Concerning N-formyl peptide receptor (FPR1), peptides 119–133, 122–144, 126–137, and 134–150 corresponding to ICL2, TM3/ICL2, and ICL2/TM4 interfaces as well as CTD-peptides 308–322, 319–340, and 322–336 directly interact with the C-terminal region of Gα i/o, inhibit interaction of Gi/o proteins with hormone-activated receptor, and decrease high affinity ligand binding to the receptor, while peptides 210–224, 227–239, and 230–245 corresponding to ICL3, TM5/ICL3, and ICL3/TM6 interfaces have little or no influence on G protein and receptor activities and so do not interfere with their coupling [63, 64]. It is not typical of G protein-binding and -activating surfaces of the receptor to be formed by ICL2 and CTD, so much so as ICL3 is not involved in interaction with G proteins.
Despite the fact that ICL1 in a majority of GPCRs does not participate in interaction with G proteins, peptide 39–51 corresponding to ICL1 of prostacyclin receptor specifically interacts with the C-terminal region of Gα s and, thus, activates Gs protein and stimulates AC activity. All this indicates an important role of ICL1 of this receptor in Gs protein coupling [65, 66] (Table 1). Another example is ICL1 of GLP1R participating, like ICL3, in the interaction with G proteins. The evidence for this stems from the fact that peptide 169–176 corresponding to ICL1 of GLP1R significantly activates Gs and Gi proteins and influences hormone-stimulated AC activity [53].
The action of many GPCR-peptides on G proteins is very selective (Table 1). N-CTD-peptide 401–417 of CB1-cannabinoid receptor decreases significantly the interaction of its cognate receptor with Gα i3 subunit, but not with Gα i1 and Gα i2, whereas peptides 301–317 and 329–344 disturb receptor-mediated activation of Gα i1 and Gα i2 subunits, but not Gα i3 [56, 57]. Peptide 483–497 corresponding to C-ICL3 of Gq-coupled m3-MChR at micromolar concentrations selectively activates Gq but not Gi2 proteins [43], while peptide 260–267 corresponding to C-ICL3 of Gs-coupled D1-DR selectively activates Gs proteins [38]. Peptides 206–224, 214–231, and 213–225 derived from N-ICL3 of D2-DR, 5-HT1AR, and 5-HT1DR and peptides 382–400 and 285–298 derived from C-ICL3 of m4-MChR and 5-HT1DR stimulate preferably Gi/o proteins and have little or no effect on the other G protein types [30, 32, 40–42]. The N-ICL3-peptide 216–231 of the type 1 angiotensin II receptor coupled with the Gi/o and with the Gq/11 proteins selectively activates purified Gi/o proteins, while C-ICL3-peptide 230–241 activates purified Gq/11 proteins [59, 61]. We have shown that peptides 615–629 and 258–268 corresponding to C-ICL3 of the relaxin receptor RXFP1 and 5-HT6R at micromolar concentrations stimulate AC activity and increase the basal level of GTP binding of Gs proteins but do not affect the other types of G proteins, in particular the Gi proteins associated with AC in the inhibitory manner [39]. The treatment of membrane fraction with pertussis toxin (PT) inactivating Gi proteins does not influence the effects of peptides 615–629 and 258–268, whereas the treatment with cholera toxin impairing the function of Gs proteins blocks these effects. In the presence of peptide derived from C-terminal segment of the Gα s subunit the effects of both peptides are significantly decreased. This is due to competition between the full-size Gα s and C-terminal Gα s-peptide for binding with GPCR-peptide, and is the evidence of participation of Gs protein in the mechanism of action of GPCR-peptide. Besides, the peptide corresponding to Gα i C-terminal segment does not affect the activity of peptides 615–629 and 258–268, derivatives of Gs-coupled receptors. The C-ICL3-derived peptide 300–316 of Gi-coupled 5-HT1BR increases GTP binding activity of Gi protein but does not affect the other G proteins. This effect is blocked by PT treatment and reduced in the presence of C-terminal Gα i-peptide [39].
The G protein-interacting regions of GPCRs are usually positively charged and contain BBXXB, BBXB, and the related motifs, where B is a basic amino acid residue (Arg or Lys) and X is another residue [30, 90, 91], specifically interact with the negatively charged C-terminal region of Gα subunits that is of prime importance for recognition and effective interaction of different types of G proteins with ligand-activated GPCR [42, 92–94]. In addition to the extreme C-terminus of Gα, the α4 helix and the α4/β6 loop rich in negatively charged amino acid residues also participate in a receptor-G protein coupling [32]. As a result, the presence of BBXXB and the related motifs in GPCR-peptides, derivatives of receptor intracellular domains, is a very important structural feature required for their effective and selective interaction with G proteins. The substitution of the positively charged Lys221 and Arg222 in C-terminal segment of N-ICL3-peptide 208–226 of Gi/o-coupled D2-DR by alanine residues leads to a 3-fold reduction in its affinity for Gα i/o [42]. Consistent with that, mutant D2-DR with the substitution of segment RRRR217-220 in N-ICL3 by AAAA is not capable of effective interaction with Gi/o proteins and is insensitive to agonist activation. These findings support the view that charge-charge complementation has a very important role in receptor-Gα coupling [95, 96].
The peptide strategy makes it possible to produce analogs of GPCR-peptides with a higher biological activity and to deliver them to the intracellular effector proteins of the target cells, which is very important for their application as a new generation of highly effective and selective GPCR-based drugs. The most perspective way to achieve this goal is modification of GPCR-peptides using either hydrophobic radicals, for example, C12–C18 acyl or steroid group, or hydrophobic TM fragment; they mimic the receptor TM, maintain the peptide conformation close to that in native receptor, and, finally, allow the transfer of peptide across the plasma membrane. Such cell-penetrating lipidated peptides are designated as pepducins. The latter corresponding to ICLs of the protease-activated receptors (PAR1, PAR2, PAR4), the chemokine receptors (CXCR1, CXCR2, CXCR4, CCR5), the sphingosine-1-phosphate (S1P) receptor, the relaxin receptor RXFP1, α 1B-AR, 5-HT1BR, and 5-HT6R function as intracellular agonists or antagonists of their cognate receptors and their action is realized at the stage of specific interaction between the receptor and G protein on the intracellular plasma membrane surface [39, 49, 50, 97–102]. Pepducins can be used to control platelet-dependent hemostasis and thrombosis, tumor growth, invasion, angiogenesis, as well as to prevent some inflammatory diseases [26, 27, 100, 103–109].
With respect to the specificity and efficiency of action on their cognate receptors, pepducins significantly surpass unmodified analogs, which makes them very perspective selective regulators of hormonal signaling systems [39, 50, 98–100, 105, 110, 111]. Peptide Pal-RCLSSSAVANRS295-306 (P1pal-12) corresponding to N-ICL3 of Gq/11- and Gi-coupled PAR1 functions as a selective PAR1 antagonist and inhibits the increase in inositol triphosphate production and concentration of intracellular Ca2+ induced by agonist-activated receptor, significantly decreases platelet aggregation in response to PAR1 agonist SFLLRN and the vasorelaxation caused by other PAR1 agonist TFLLR-amide in the rat aorta, but does not affect the vasorelaxation caused by PAR2 agonist SLIGRL-amide, neither does it inhibit PAR4-dependent platelet aggregation [98, 112]. This peptide has no effect on the aggregation in response to agonists of the thromboxane, ADP, collagen, and GPIb/IX/V receptors the same as the lack of effect on the response to interleukin-8, stromal-derived factor 1α, S1P, monocyte chemotactic protein-1, RANTES (Regulated on Activation Normal T cell ExpreSsed) in endothelial cells, or the migration of recombinantly transfected HEK293 cells to ligands of PAR2, PAR4, CXCR1, CXCR2, CCR5, or S1P receptors [98, 105]. Peptide Pal-RCLSSSAVANRSKKSRALF295-313 (P1pal-19), a derivative of PAR1 ICL3, possesses the activity of PAR1 agonist and, like selective PAR1 agonists TFLLR and SFLLRN, stimulates the Gq and Gi/o proteins and PLCβ activities, produces endothelial NO-dependent relaxation in the rat aorta, and promotes prostaglandin E2 release in the human lung epithelial cells and the rat gastric mucosal epithelial cells [97, 98, 112]. The action of P1pal-19 is very specific to PAR1 and its influence is drastically reduced or completely blocked in cultured cells and the tissues where its cognate receptor is absent or mutant form of PAR1 is expressed.
The ICL3-peptide Pal-SGRRYGHALR274-283 (P4pal-10) of PAR4 functions as an antagonist of its cognate receptor and a partial antagonist of PAR1. It completely inhibits PLCβ stimulation and Ca2+ response induced by PAR4 agonist AYPGKF-amide and decreases the analogous effects of PAR1 agonist SFLLRN-amide by 36%. P4pal-10 completely blocks platelet aggregation induced by PAR4 agonist and partially inhibits PAR1 agonist-induced aggregation, whereas it has no effect on the aggregation of platelets induced by a series of agonists of the GPCRs which do not belong to the PAR family, neither on the migration of human neutrophils to interferon-γ-inducible protein-10, stromal-derived factor 1α, and S1P but completely blocks migration to thrombin activating both PAR1 and PAR4 [98, 111]. ICL1-peptide Pal-ATGAPRLPST103-112 (P4pal-i1) of PAR4 is more selective compared with peptide P4pal-10. It completely blocks the chemotactic response realized via PAR4 and prevents platelet aggregation triggered by PAR4 agonist AYPGKF-amide but does not inhibit the chemotactic response of PAR1 and does not affect platelet aggregation induced by PAR1 agonist SFLLRN-amide [106, 113]. When P4pal-i1 is combined with thrombin inhibitor bivalirudin, inhibition of human platelet aggregation and suppression of arterial thrombosis in guinea pigs increases to a much higher degree than with bivalirudin alone [106]. The data concerning thrombolytic action of peptides P4pal-10 and P4pal-i1 and ICL-peptides of other PARs show that on their basis it is possible to have receptor-selective drugs for antiplatelet therapy [114].
Pepducins have been used to study the role of the chemokine receptors in sepsis and systemic inflammation and are found to improve survival and prevent systemic inflammation and overactivation of the coagulation system in sepsis. Pepducins corresponding to ICL1 and ICL3 of the chemokine receptors CXCR1 and CXCR2 function as selective antagonists of these receptors and inhibit Gs-mediated effects of interleukin-8, a ligand for these receptors, neutrophil chemotaxis toward interleukin-8 in particular, as well as reverse disseminated intravascular coagulation and liver failure in septic mice and prevent the lethal sequel of sepsis. At the same time, pepducins corresponding to ICL1 and ICL2 of the chemokine receptor CXCR4 selectively interact with their cognate receptors and cause a massive leukocytosis consistent with the role of CXCR4 in stromal-derived factor 1α neutrophil homeostasis, while the pepducins do not affect interleukin-8-mediated signaling pathways and have no effect on survival [100, 105].
We showed that peptide QVKKE(Nle)ILAKR619-629K(Pal) corresponding to C-ICL3 of the Gs-coupled relaxin receptor RXFP1 stimulates AC activity and Gs protein GTP binding and inhibits regulatory effects of relaxin on the AC system in the myocardium and brain, which raises no doubt due to a high level of expression of its cognate receptor, but is ineffective in the skeletal muscles where there are no receptors [49, 50]. Palmitoylated peptide KHSRKALKASL258-268K(Pal)A corresponding to C-ICL3 of 5-HT6R is effective in the brain rich in 5-HT6R, but not in respect to the AC system in the myocardium and testes where these receptors are absent or expressed very little [39].
Alongside with high selectivity, pepducins are more efficient compared with their unmodified analogs. Actually, RXFP1-peptide 619–629-K(Pal) stimulates relaxin-sensitive AC system with greater efficiency compared with 15-mer peptide 615–629 lacking fatty acid radical, while unmodified 11-mer peptide is not active in this case [50]. Palmitoylated 5-HT6R-peptide 258–268 has a stronger influence on Gs proteins and AC than its unmodified analog [39]. PAR1-peptide 295–313 lacking hydrophobic radical does not stimulate Ca2+ fluxes while its palmitoylated analog causes a rapid Ca2+ transient [97].
These data give grounds to make a conclusion that modification by hydrophobic radicals is one of the most perspective approaches to enhance both the selectivity and efficiency of GPCR-peptides as regulators of hormonal signaling systems. The main reason for high biological activity of pepducins is the ability of their hydrophobic radical to partition into the plasma membrane and to flip across lipid bilayer, thus shuttling the attached peptide to the intracellular surface of the membrane and mediating the effective interaction of peptide portion of pepducin with the complementary regions of the GPCR or G proteins [115].
3. The Receptors with Tyrosine Kinase Activity
In the 1990s the peptide strategy found wide application with a view to identify signal-protein-interacting regions in two best known receptors possessing tyrosine kinase activity, the insulin receptor (IR) and the EGF receptor. The IR belongs to the family of transmembrane glycoprotein receptors activated by insulin, insulin-like growth factor-1 and other insulin-related peptides, and is composed of two 135-kDa extracellular α subunits which bind the hormone and two 95-kDa transmembrane β subunits with intrinsic tyrosine kinase activity. The main substrates of insulin-stimulated phosphorylated IR are IRS and Shc proteins, but the data are available suggesting that IR is also able to interact with heterotrimeric G proteins and, thus, regulate G protein-dependent signaling cascades [11, 15, 116].
The first data concerning the regions capable of specifically interacting with G proteins appeared in the early 1990s and were obtained with three synthetic peptides, 1039–1061, 1135–1156, and 1319–1333, corresponding to the tyrosine kinase domain (the first two) and the C-terminal domain (the third) located in the cytoplasmic tail of IR β subunit [117]. They contain positively charged BBXXB and the related motifs typical of G protein-activating sequence of GPCRs. Peptide 1039–1061 induces a dose-dependent stimulation of GTP-binding and GTPase activities of Gs proteins, while peptide 1325–1345 containing a site for tyrosine phosphorylation located in the C-terminal domain of IR activates the Gi/o proteins [117], and peptide 1135–1156 containing tyrosine residues critical for IR tyrosine kinase activity stimulates GTP-binding of unusual 67 kDa G protein involved in the insulin signal transduction [118]. The Gi-activating effect of C-terminal peptide 1325–1345 is supported by the data obtained later on direct interaction between insulin-activated IR with Gi2 protein and the blocking of this interaction by PT [116, 119].
To identify IR regions participating in phosphorylation-dephosphorylation cascade, a series of peptides containing the most important tyrosine residues, the targets of tyrosine phosphorylation, and their derivatives with modified tyrosines were synthesized and studied (Table 1). A tris-sulfotyrosyl peptide 1142–1153 corresponding to the major site of autophosphorylation inhibits dephosphorylation of the IR in CHO cells overexpressing the human IR [67, 120]. An N-stearyl derivative of this peptide causes a several-fold increase in insulin- and vanadate-stimulated phosphorylation of IR and leads to a significant enhancement of insulin-induced stimulation of phosphatidylinositol 3-kinase (PI3-K) and mitogen-activated protein kinase (MAPK) activities but has no effect on the basal phosphorylation of IR. Maximal stimulation is observed with 50 μM of N-stearyl peptide 1142–1153. Peptide 1293–1307 corresponding to C-terminal domain of IR enhances insulin-stimulated receptor autophosphorylation but has no detectable effects on the basal phosphorylation of IR and on receptor dephosphorylation [68]. A stearyl analog of peptide 1293–1307 also enhances insulin-stimulated autophosphorylation and, additionally, induces a 2-3-fold increase in both the activity of insulin-stimulated PI3-K, and the level of tyrosine phosphorylation of MAPK in response to insulin. The most pronounced influence of N-stearyl derivatives of peptides 1142–1153 and 1293–1307 on insulin-induced IR autophosphorylation and function, compared with unmodified analogs, suggests that the intrinsic activity of IR undergoes modulation, depending on the presence of a fatty acid-acylated receptor fragment in cells. The expression of a minigene encoding 23-mer peptide 1292–1315, the longest analog of peptide 1293–1307, has no effect on the basal receptor tyrosine phosphorylation level but leads to an increase in insulin-activated IR autophosphorylation that in minigene-transfected CHO cells is about twice as high as in control cells [121]. The stimulating effects of insulin on PI3-K and MAPK activities and thymidime incorporation into DNA are also significantly elevated in cells expressing the minigene. These data indicate that peptides 1142–1153 and 1293–1307 and minigene-expressed peptide 1292–1315 bind to the regions in IR β subunit responsible for the intrinsic activity of the receptor and functional coupling with downstream signaling proteins, such as IRS and Shc proteins, PI3-K and MAPK. The action of the peptides and their lipophilic derivatives is highly specific since the latter are not capable of inhibiting dephosphorylation of EGF receptor and do not influence ligand-induced phosphorylation of both EGF receptor and insulin-like growth factor-1 receptor which functionally and structurally resembles IR [67, 68, 121].
To identify the regions participating in IR tyrosine kinase function, Van Obbergen and colleagues used another approach based on antipeptide antibodies directed against synthetic peptides corresponding to the regions localized in the C-terminal domain of IR, such as 1270–1280, 1294–1317, and 1309–1326 [122–124]. Antipeptide IgG recognizing acid-rich sequence 1270–1280 inhibits both receptor autophosphorylation, at least on Tyr1146, Tyr1150, and Tyr1151, the main targets of IR tyrosine kinase, and the receptor-induced phosphorylation of poly(Glu80Tyr20) and a peptide corresponding to the region 1142–1158 [123]. The antipeptide antibody directed to the region 1294–1317 inhibits phosphorylation of poly(Glu80Tyr20) and synthetic peptides corresponding to the IR autophosphorylation sites but does not inhibit receptor autophosphorylation. In addition, it decreases receptor-mediated phosphorylation of Src homology/collagen and of IRS-1 protein by 52 and 30%, respectively [124]. These data give strong evidence that the C-terminal domain of IR interacts with signal proteins participating in the regulation and modulation of tyrosine kinase activity of the receptor.
The EGF receptor one time penetrates the membrane and contains a large extracellular domain that consists of two ligand-binding and two cysteine-rich subdomains and the intracellular tyrosine kinase domain. The binding of EGF receptor to EGF causes receptor dimerization and induces phosphorylation of tyrosine residues in tyrosine kinase domain located in the intracellular tail of receptor, which recruits many signaling proteins, such as PI3-K, PLC-γ, PLD, Shc, and Grb2 proteins, phosphotyrosine phosphatase 1, and others, and transduces hormonal signal to different intracellular effector proteins and systems [125]. In 1995 Sun and colleagues revealed that EGF receptor-derived peptide is able to stimulate G proteins [69] (Table 1). This finding coincides very well with the data obtained in the recent years about the direct interaction of different types of G proteins with EGF receptor and their role in EGF-mediated signaling [11, 126, 127]. The synthetic peptide 646–658 corresponding to the membrane-proximal segment of the juxtamembrane domain located in the cytoplasmic tail of EGF receptor stimulates GTP-binding and GTPase activities of Gs protein coupled to this receptor. In addition, it increases the Gi protein GTPase activity without affecting the GTP-binding activity, which suggests that the juxtamembrane domain is able to stimulate Gs proteins and inactivate Gi proteins. Peptide with phosphorylated residue Thr654, the main target for protein kinase C (PKC), does not affect Gs protein and retains the ability to stimulate the GTPase activity of Gi protein. The incorporation of negatively charged phosphate group decreases the net positive charge of peptide and, in addition, destabilizes its helical conformation, which is functionally important for effective interaction of peptide with the Gα s subunit, and, hence, blocks the activation of Gs protein by the phosphorylated peptide. It is supposed that in the case of Gi protein the phosphorylated peptide induces the dissociation of the heterotrimeric complex to give monomeric Gα i subunit and, thus, stimulates its GTPase activity. These data speak in favor of the fact that phosphorylation of tyrosine residues in EGF receptor, as well as of serine and threonine residues in GPCRs, affects selectively their coupling with different types of G proteins, Gs and Gi proteins in particular. It was shown, in addition, that peptide 646–658 with the reverse sequence (RRLTRKRVIERRR) also activates Gs protein, which indicates that orientation of peptide 646–658 is of no importance for its interaction with G protein and the main role in this process is given to the secondary structure of peptide (α helix is optimal) and spatial distribution of positively charged amino acids [69]. As has been shown recently using the other biochemical approaches, Gα i1 and Gα i3 form the complex with ligand-activated EGF receptor and are required for phosphorylation of Grb2-associated binding protein 1 and its subsequent interaction with p85 subunit of PI3-K in response to EGF, whereas the coupling between EGF receptor and Gs protein leads to activation of cAMP-dependent signaling pathways [11, 127]. Thus, the peptide strategy came to be a starting point for further investigations in which the role of G proteins in the tyrosine kinase receptor-mediated signaling has been established.
A new era of application of the peptide strategy in the study of structural-functional organization of the tyrosine kinase receptors is connected with quantitative proteomics using pull-down experiments with pairs of phosphorylated and nonphosphorylated synthetic peptides, corresponding to phosphotyrosine-containing sites in the intracellular domains of these receptors [13, 128, 129]. The receptors possessing tyrosine kinase activity have, as a rule, several docking sites for each of the interacting proteins-partners. The EGF receptor and the related to it ErbB4 receptor have, for example, four to seven docking sites for Grb2 protein three to four sites for Shc protein, while ErbB3 receptor lacking the functional kinase domain has a large number of binding sites for PI3-K. Using a series of synthetic peptides corresponding to tyrosine phosphorylation sites of EGF and ErbB4 receptors, the new recognition motifs for Shc protein were detected. It was shown that the STAT5 protein, a latent cytoplasmic transcription factor, is a new partner of both receptors; it specifically interacts with Tyr978- and Tyr998-containing sites of EGF receptor and with Tyr984-containing site of ErbB4 receptor. It should be pointed out that both phosphorylated and nonphosphorylated forms of peptides are used to study the role of tyrosine phosphorylation for effective and selective interaction of these receptors with their partners [129]. The assay based on the interaction between receptor-derived phosphotyrosine-containing peptides and proteins-partners is extremely specific and capable of conforming the binding motifs identified so far and detecting new target sequences, which is confirmed by the fact that all identified binding partners contain either SH2- or PTB-domains specifically interacting with phosphotyrosine-containing motifs, and phosphotyrosines not expected to have binding partners do not show any proteins with significant ratios. This assay is very sensitive, since the peptide-protein interaction screen is validated for binding constants as low as at least 5 μM, but it is likely to work with much lower affinity interactions [128, 129].
4. Natriuretic Peptide Clearance Receptor
The natriuretic peptide receptor of C-type (NPR-C) belongs to natriuretic peptide receptors but lacks gyanylyl cyclase catalytic domain. It is a disulfide-linked homodimer having a single TM, a large extracellular domain of 440 amino acids, and a short 37-amino acid cytoplasmic tail. The binding of the NPR-C with atrial natriuretic peptide (ANP) and its several fragments induces the activation of Gi proteins and inhibition of AC activity and NPR-C-mediated decrease in cAMP levels contributes to the activation of PLC signaling [130].
A 37-mer peptide corresponding to the cytoplasmic tail of NPR-C and a similar peptide with 10 additional N-terminal amino acids derived from receptor TM in a GTP-dependent manner inhibit AC activity in the cardiac membranes with K i of about 1 nM [131]. Preincubation of the membranes with PT blocks AC inhibitory effect of peptides, which suggests that the latter, like ANP, inhibit the enzyme activity via PT-sensitive Gi/o proteins. To identify in the cytoplasmic domain of NPR-C the segments responsible for inhibition of AC activity the series of 8–18-mer peptides corresponding to different regions of this domain were synthesized and examined as regulators of the Gi/o proteins and AC activities [70, 132]. These peptides contain typical Gi/o-activating sequences and have two basic amino acids at the N terminus and BBXB or BBXXB motifs at the C terminus [30, 133].
Pagano and Anand-Srivastava showed that positively charged peptides 461–472, 469–480, 469–485, and 481–492 in a concentration-dependent manner inhibit the basal AC activity with K i between 0.1 and 10 nM and significantly decrease forskolin-, glucagon- and isoproterenol-stmulated AC activity in A-10 vascular smooth muscle cells and their inhibitory effects are completely attenuated by PT treatment [70] (Table 1). These peptides inhibit the stimulation of DNA synthesis induced by angiotensin II, endothelin, and arginine vasopressin but do not influence the basal level of DNA synthesis in these cells [72]. It was also shown that peptide 461–472 inhibits both the phosphorylation of ERK1/2 and AKT protein kinases and the increase of Gα i subunit expression induced by vasoactive peptide hormones. In addition, in the presence of this peptide the inhibitory effects of PD-98059, a MEK inhibitor, and of wortmannin, a PI3-K inhibitor, on hormone-induced DNA synthesis are potentiated. These data suggest that positively charged peptides containing Gi/o-activating sequences, irrespective of their location within NPR-C cytoplasmic domain, inhibit proliferative responses of the muscle cells to vasoactive peptide hormones realized via Gi/o protein and MAPK/PI3-K/AKT signaling pathways [72].
Murthy and Makhlouf [132] synthesized and studied the related peptides 467–482, 469–485, and 479–496 corresponding to the N-terminal, middle, and C-terminal regions of the intracellular domain of NPR-C. Peptide 469–485, the same as the selective NPR-C agonist ANP(4–23), significantly increases the GTP binding to Gα i1 and Gα i2 subunits but not to Gα i3, Gα s, and Gα q/11 subunits, stimulates phosphoinositide hydrolysis by activating PLCβ3 via the Gβγ subunits of both Gi1 and Gi2 proteins with an EC50 of 1.3 μM, and inhibits forskolin-stimulated AC activity by 64% in solubilized tenia coli smooth muscle membranes. In the presence of this peptide the stimulatory effects of ANP(4–23) on Gi1 and Gi2 proteins binding and the PLCβ3 activity are increased by 187, 289, and 43%, respectively. Peptide 467–482 with a partial C-terminal BBXXB-motif is a less effective activator of the Gi1 and Gi2 proteins and PLCβ3. Peptide 479–496 does not influence the basal level of G protein binding and PLC activity but decreases the stimulatory effects of both ANP(4–23) and peptide 469–485 on Gi1 and Gi2 proteins binding and PLCβ3 activity. Peptide 469–485 induces contraction in saponin-permeabilized smooth muscle cells and enhances the ability of ANP(4–23) to induce contraction. Peptide 479–496 has no effect on contraction but inhibits ANP(4–23)-induced contraction. It follows that peptide 479–496 inhibits Gi protein activation and cell responses mediated by ANP(4–23) and peptide 469–485, suggesting that the positively charged motif KHRELR491-496 localized at the C-terminus of this peptide mediates binding but not activation of G protein, thus, causing peptide 479–496 to act as a competitive inhibitor of Gi protein activation [132]. Summing up, using the synthetic peptides the selective Gi protein-binding and -activating determinants within cytoplasmic tail of NPR-C participating in activation of PLC-dependent signaling cascades responsible for muscle contraction were identified, which coincides very well with the later mutational and deletion studies [71].
5. Heterotrimeric G Proteins
Heterotrimeric G proteins consisting of α, β, and γ subunits are divided according to the nature of α subunit into four main families, Gs/olf, Gi/o, Gq/11, and G12/13, based on structural and functional similarity [134]. In mammals there are 21 Gα subunits encoded by 16 genes, six Gβ subunits encoded by five genes, and 12 Gγ subunits. Gβ and Gγ subunits form a functionally active Gβγ-heterodimeric complex; it anchors in the membrane and does not dissociate under nondenaturing conditions. Gs proteins activate AC and calcium channels, Gi proteins inhibit AC and activate potassium channels, Go proteins stimulate PLC, activate potassium channels, and inactivate calcium channels, Gq/11 proteins activate PLC, and G12/13 proteins stimulate Rho/Rho kinase activity [4, 5, 10].
Several different regions of Gα subunit are implicated in recognition of GPCRs and are responsible for the specificity of receptor-G protein interaction, but the extreme C-terminal region is of special importance for effective and selective interaction of different types of G proteins with ligand-activated GPCR [7, 42, 92, 94]. This negatively charged region of Gα binds with positively charged intracellular regions of GPCRs. It seems quite likely that GPCRs use C-terminal region as a “latch” to alter the conformation of the α5 helix of Gα subunit (Figure 2). The conformational changes of the α5 helix give rise to a change in the conformation of the β6/α5 loop, destabilize its contacts with the guanine ring of GDP, and lead to the GDP/GTP exchange [135]. In addition to the extreme C-terminus of Gα, the α4 helix, and the α4/β6 loop, both localized close to the C-terminus, also directly participate in a receptor-G protein coupling and in the case of Gα i subunit determine its specificity [32]. It was shown that an anionic cluster of Gα i subunit α4 helix, especially negatively charged Glu308 and uncharged Gln304, directly interact with the positively charged region in ICL-3 of Gi-coupled D2-DR, and 5-HT1AR [32, 94]. The replacement of the residues in Gα i1 subunit by the corresponding residues in Gα s (Q304R and E208L) leads to uncoupling mutant Gα i1 to D2-DR, whereas the replacement of α4 helix residues in Gα s by the corresponding residues in Gα i1 (R342Q and L346E) induces, on the contrary, activation of mutant Gα s by D2-DR. It was shown also that peptides derived from N-ICL-3 of Gi-coupled D2-DR, 5-HT1AR and α 2B-AR give a 1.5–2.5-fold increase of GTP binding of the wild type of Gα i1 but have no effect on Gα i1 with paired mutation Q304R/E208L. At the same time, having no influence on the GDP/GTP exchange of the wild type of Gα s they significantly increase GTP binding of the Gα s with mutation R342Q/L346E [32]. The fact that all Gα i/o, unlike the other types of Gα subunits, have an anionic cluster in the α4 helices gives grounds to suggest that positively charged intracellular regions of Gi/o-coupled GPCRs interact with two anionic regions of Gα i/o, the C-terminus and the α4 helix, while the same regions of Gs- and Gq/11-coupled GPCRs only with the C-terminus. Thus, the extreme C-terminus, the α4 helix and the α4/β6 loop of Gα subunit are responsible for its selective interaction with receptor and account for the ability of synthetic peptides corresponding to these regions to influence signal transduction via the cognate Gα subunit.
Figure 2.

The intracellular regions of G protein-coupled receptor of the serpentine type (yellow) participating in the interaction with heterotrimeric G proteins.
Among the peptides derived from C-terminal region of the Gα subunits the best studied is the peptide 340–350 of transducin Gα t subunit [135, 136] (Table 1). This peptide binds with photoactivated rhodopsin, meta-II-rhodopsin, and stabilizes the active signaling meta-II-rhodopsin conformation, thus mimicking the effects of transducin [73, 75]. Peptide 340–350 also interacts with meta-Ib-rhodopsin, another intermediate of light-activated receptor, forming a complex with inactive GDP-bound transducin, and with active G-protein-binding state of opsin, the ligand-free form of rhodopsin, stabilized at low pH [74, 76].
The peptide interacts with the inner segments of TM5, TM6, TM7, and the N-terminus of the additional helix 8 of active forms of opsin [137–139]. The interaction between peptide 340–350 with Lys341 replaced by leucine and the inner surface of TMC of rhodopsin leads to destruction of a hydrogen bond network which includes the side chains of Arg135 and Glu134 from the conserved E(D)RY motif localized in TM3/ICL2 interface and the side chains of Glu247 and Thr251 localized in cytoplasmic end of TM6. These events provoke the outward movement of TM6 and the formation of TM5–TM6 pair is stabilized by new interactions between the side chains of Glu247 and Thr251 of the TM6 that are released from Arg135 and the side chain of Lys231 of the TM5. The peptide binding to rhodopsin is supposed to be rate-limited by the outward movement of TM6 [135]. The contacts with inner surface of the TM5 and TM6 induce a α-helical conformation in peptide 340–350(K341L) with a C-terminal reverse turn. The carbonyl groups in the reverse turn constitute the centre of a hydrogen-bonded network, which links the two receptor regions containing the E(D)RY motif and the conserved NPxxY(x)5,6F motif connecting the TM7 and the helix 8.
The analogs of C-terminal peptide 340–350(K341L) can stabilize meta-II-rhodopsin when they are covalently bound to one of the two native reactive cysteine residues, Cys140 and Cys316, localized on the intracellular surface of rhodopsin. Using synthetic peptides that differ in localization of a chemical crosslinking group, either at the N-terminus or the C-terminus of peptide 340–350(K341L), it was shown that the N-terminus of peptide analog M-23S is crosslinked to Cys140 and the C-terminus of peptide analog B23S-IA to Cys316 [75]. The peptide M-23S crosslinking to the Cys140 localized on the cytoplasmic tip of TM3 and the peptide B23S-IA crosslinking to Cys316 localized in N-terminus of helix 8 are both necessary for stabilization of meta-II-rhodopsin. At the same time, peptide B23S-IA stabilizes the more compact meta-IIa-rhodopsin whereas peptide M-23S stabilizes meta-IIb-rhodopsin, protonation form of meta-II-rhodopsin capable of activating the G protein [75].
Using IR-spectroscopy it was shown that negatively charged residues in the peptide 340–350 have a very important role in its interaction with rhodopsin [140]. Free carboxyl groups of Glu342 and Asp346 residues in Gα t C-terminal peptide subunit participate in specific binding with positively charged intracellular regions of rhodopsin. The elimination of the N-terminal positively charged amino group by N-acylation of peptide 340–350 and delocalization of its positive charge replacing lysines by arginines increase the affinity of modified peptide for meta-II-rhodopsin, whereas amidation of the C-terminal negatively charged carboxyl group, on the contrary, reduces it [141]. The substitution of positively charged lysine by uncharged leucine greatly increases the affinity of peptide 340–350(K341L), designated as 23S, for meta-II-rhodopsin and stabilizes its conformation [142]. Highly conservative in Gα t and Gα i/o subunits Cys347 residue, the target for ADP-ribosylation by PT, is involved in a hydrophobic interaction between peptide and meta-II-rhodopsin, since with the substitution of this cysteine by amino butyric acid, where the methylene-sulfhydryl group is replaced by an ethyl group the activity of the C-terminal peptide is maintained, whereas substitution by alanine gives a 3-fold reduction in the meta-II-rhodopsin stabilizing activity of the peptide. Alongside with this, the modification of cysteine SH-group by ribosyl radical brings about changes in the conformation of C-terminal region in full-size Gα t subunit as well as of peptide 340–350, which disturbs their interaction with rhodopsin.
It was shown that peptides, derivatives of C-terminal sites of the Gα s, very different in length disturb by the competitive mechanism the functional interaction of receptors and Gs proteins and change the affinity of receptors for hormones [66, 77, 143–151]. The expression of 83-mer polypeptide derived from C-terminal region of the Gα s induces the inhibition of β 2-AR- and D1A-DR-mediated cAMP production in HEK293 cells [146]. Short synthetic peptides corresponding to progressively longer segments of the Gα s C-terminus, 384–394, 382–394, 380–394, 378–394(C379A), 376–394(C379A), and 374–394(C379A), stimulate specific binding of selective agonist CGS21680 to the Gs-coupled A2A-adenosine receptor in the rat striatal membranes both in the presence and in the absence of GTPγS, a nonhydrolysable GTP analog, which uncouples G proteins from receptors (Table 1). The most effective peptides are 378–394(C379A), 376–394(C379A), and 374–394(C379A), and the shortest peptide 384–394 is less active [77]. In accordance with the results of the study of Gα s crystal structure of the Gα s, the α5-helix responsible for effective interaction with the receptors involves the region from Asp368 to Leu394 [152]. Thus, the peptide containing 17 and more amino acid residues have a stronger propensity to assume an α-helical conformation compared with the shortest peptides. The NMR analysis of 11-mer 384–394 and 21-mer 374–394(C379A) peptides was made and showed that both peptides demonstrate a marked propensity to form α-helical structure in hexafluoroacetone/water, a mixture with structure stabilizing properties, peptide 384–394 having the shortest α-helix between Arg389 and Leu394, and peptide 374–394(C379A), the longest α-helix spanning region from Asp381 to Leu394 [77, 153]. The addition of the most active 21-mer 374–394(C379A) peptide causes an increase of the number of binding sites but does not stabilize the high-affinity state of the A2A-adenosine receptor. Peptide 374–394(C379A) inhibits agonist-stimulated AC activity by 35% and does not have a significant effect on the basal and forskolin-stimulated activities. This is the evidence that the peptide disrupts the signal transduction on the stage of coupling between agonist-activated A2A-adenosine receptor and Gs protein and does not interact directly with catalytic unit of AC [77].
A 37-mer peptidic constrain (A42) containing a 16-mer membrane-permeable sequence (MPS) of penetratin, derived from the homeodomain of the Drosophila melanogaster transcription factor Antennapedia that translocates through membranes, and a 21-mer peptide 374–394(C379A) was designed and shown to have no affect on cell viability but to significantly inhibit adenosine receptor-mediated cAMP accumulation in PC12 cells with an EC50 of 5 μM and decrease A2A-adenosine receptor- and β-AR-mediated cAMP production in human cell line HMEC-1 [151]. The maximal efficacy of NECA, a selective agonist of A2A-adenosine receptor, is substantially reduced in the presence of A42 peptide suggesting that it competes with Gα s for the interaction with receptor. The A42 peptide does not directly modulate AC activity and does not affect Gi- and Gq-coupled receptor signaling, which indicates that the specific target for peptide is the receptor Gs-binding and -activating surface. Using NMR analysis it was shown that A42 peptide is arranged in two stretches of α-helical structure encompassing sequences 3–10 and 18–36. Even in a membrane-mimicking environment and in conjugation with MPS, the segment 18–36 has the secondary structure resembling those of peptide 374–394(C379A) and of C-terminal region in full-size Gα s [151]. The helix 18–36 is amphipathic and has a polar surface lined by Asp378, Arg390, Asp381, and Arg385 and two hydrophobic surfaces formed by less polar residues Ile382, Ile383, Met386, His387, Tyr391, and Leu393. The N-terminal penetratin fragment of A42 peptide also possessing α-helical structure has hydrophobic and hydrophilic residues forming clustered surfaces at the N-terminus and in the center of the fragment and is responsible for peptide internalization by endocytosis.
The peptide strategy can be used to study the functional role of distinct amino acid residues in the C-terminus of Gα s. The leucine residue localized at position (−2) is absolutely invariant in C-terminal regions of all Gα subunits. The substitution of this leucine (Leu393) with Ala, Phe, Lys, and D-Leu in C-terminal peptide 384–394 from the Gα s C-terminus gives modified peptides possessing much lower activity compared with unmodified peptide [147]. However, the peptides in which Leu393 was replaced by Asp and Thr retain a residual activity. The conformational analysis of peptides indicates that the side chain of Leu393, together with side chains of Ile382 and Met386, is involved in formation of a hydrophobic surface that is very important for effective interaction with the cognate receptor.
Minigene plasmids encoding 11-mer peptides corresponding to the C-terminal regions of Gα i, Gα o, Gα q, Gα 12, and Gα 13 have been successfully used to discern the contribution of different types of G proteins to signal transduction via m2-MChR and thrombin receptors [154–156]. Plasmid minigene vectors encoding the C-terminal sequence of Gα serve as competitive inhibitors presumably by blocking the G protein-binding site on the GPCR that normally binds the G protein. A minigene vector expressing the Gα i1/2 C-terminal peptide specifically inhibits Gi1/2 protein inwardly rectifying K+ channel activity following agonist stimulation of the m2-MChR and decreases thrombin-induced inhibition of AC activity in endothelial cells [154, 155]. The minigene vectors expressing the Gα o and Gα q C-terminal peptides in a competitive manner block the coupling between Go and Gq proteins and the human thromboxane A2 receptor (TXA2R); they significantly decrease thrombin-stimulated intracellular Ca2+ level and inhibit the stimulatory effects of thrombin on PLC activity; as a result PI 1,4,5-P3 production is blocked [155, 156]. The minigenes encoding the C-terminal peptides of G12 and G13 proteins decrease thrombin-stimulated stress fiber formation that is mediated via G12/13 protein family [155]. A minigene encoding mutated C-terminal sequence of Gq protein, in which two C-terminal residues, Ala and Val, are replaced by the Thr and Lys, has a little effect on thrombin-induced PLC activity, and even partially restores the response of the enzyme decreased in the presence of wild Gα q C-terminal peptide [155]. A minigene expressing 15-mer peptide of Gα q C-terminal region, the same as 11-mer peptide, inhibits thrombin-stimulated PLC activity, and, in addition, specifically binds to ligand-free TXA2R with high affinity (K d is 17 μM) and to agonist-activated receptor with low affinity (K d is 240 μM) [157]. It is a clear indication that the C-terminal region of Gα q binds to TXA2R without agonist, which suggests the existence of a preoccupied G protein-binding site on the intracellular domains of ligand-free TXA2R. The action of minigenes is very specific, being realized that provided hormonal responses are mediated via their cognate G proteins. The above is the evidence that the use of minigene-based peptide strategy not only confirms the view that each G protein can control certain signaling events but also emphasizes, in addition, the specificity of the GPCR-G protein interface. Thus, the minigenes encoding Gα C-terminal regions appear to be a powerful tool for dissecting out the G protein that mediates a given physiological function following thrombin activation.
As mentioned above for Gα s-derived A42 peptidic constrain containing the MPS, the efficiency of Gα C-terminal peptides depends on the ability of the latter to penetrate the plasma membrane. A shorter peptide 350–359 corresponding to the extreme C terminus of Gα q modified by MPS corresponding to Kaposi fibroblast growth factor signal region inhibits 5-HT2CR-mediated signaling in cultured choroids plexus epithelial cells significantly decreasing serotonin-stimulated PLC activity, whereas its unmodified membrane-impermeable analog is unable to disrupt the functional coupling between agonist-activated 5-HT2CR and Gq protein [145]. A peptide 385–394, derivative of the C terminus of Gα s, modified by this MPS at the N-terminus significantly decreases, to almost basal level, β 2-AR agonist-induced stimulation of AC activity in astrocytes, whereas the nonconjugated analog that is unable to penetrate the plasma membrane has low inhibitory activity. It should be pointed out that Kaposi fibroblast growth factor-derived MPS alone is inactive; therefore its contribution in the blockade of any signal cascade tested is hardly of great importance. However, it is not always the case. We showed that several polycationic peptides used as MPSs can have influence on the activity of the components of hormonal signaling systems, G proteins and AC in particular, and their action must be taken into account in developing cell-penetrating conjugates on the basis of these peptides [51, 158–160].
The interaction of G proteins with the effector enzymes, AC in particular, is also very important for deciphering the molecular mechanisms of GPCR-mediated signal transduction. Proceeding from the data that the crystal structure of Gα s complexed with the soluble functional fragments of AC shows three regions localized in Gα s, all having a direct contact with the enzyme [161], three peptides 199–216, 222–247, and 268–286 corresponding to these regions were synthesized and their influence on the activity of the types 2 and 6 ACs studied [78] (Table 1). An 18-mer peptide 199–216 encoding the Switch I region from Gα s stimulates the basal and forskolin-stimulated activities of AC2 as well as AC6, and forskolin does not appear to shift the peptide concentration-effect curves. This peptide also inhibits the Gα s-stimulated activity of both isoforms of the enzymes by about 30% and, thus, behaves as a partial agonist. At the same time, the analogous peptide with the substitutions G206P, I207D, E209K, and K211A has no effect on AC2 and AC6 activities. The residue Ile207 of Gα s makes a contact with AC while the residues Gly206, Glu209, and Lys211 are responsible for appropriate local conformation of the Switch I region. Peptide 222–247 encoding the Switch II region, the same as peptide 199–216, stimulates the basal activity of both AC isoforms making it 2-3 times higher, significantly increases forskolin-stimulated AC activity, and inhibits Gα s-stimulated AC activity by 30–35%. Peptides 199–224 and 204–229 encoding the Switch II regions of the Gα i and Gα q, respectively, that structurally are very similar to the Switch II region of Gα s are not capable of stimulating the AC activity [78]. The effects of peptides 199–216 and 222–247 on the activity of AC2 are additive at lower concentrations giving a left-shifted curve but are not additive at saturating concentrations. A different effect is observed for AC6 where peptide 222–247 lowers the effect of peptide 199–224. In the case of AC2 the stimulating effect of peptide 199–224 is stronger compared with that of peptide 222–247 while in the case of AC6 the effect of peptide 222–247 predominates. Now a suggestion can be put forward that the molecular mechanisms underlying interaction of the Switch regions of Gα s and AC isoforms are not all alike. Peptide 268–286 corresponding to α3-β5 region that interacts with the C-terminal tail as well as with the central cytoplasmic loop of AC inhibits the basal and forskolin-stimulated activities of both enzymes by about 30% and, in addition, significantly decreases the Gα s-stimulated AC activity. Potent inhibition of the Gα s-stimulated activity by peptide 268–286 indicates that α3-β5 is involved in stabilization of the appropriate orientation of the Switch regions required for effective AC activation. The peptide with the highly conservative residues Trp277 and Trp280 replaced by Arg and Lys, respectively, has no influence on AC activity [78]. Studying the Gα s-derived peptides, specific functions of different regions of Gα s directly contacting AC were revealed.
6. Adenylyl Cyclases
Mammalian membrane-bound ACs producing the second messenger cAMP in response to Gs protein stimulation are represented by at least nine different isoforms (AC1–AC9) and possess two hydrophobic transmembrane regions, each built up by six TM and two pseudosymmetric cytosolic domains C1 and C2 that comprise subdomains Ca and Cb. All AC subtypes are stimulated by GTP-bound Gα s and diterpene forskolin, AC1 by Ca2+-calmodulin (CaM), AC2 by Gβγ-dimer, while AC5, and AC6 are inhibited by submicromolar concentrations of Ca2+ and AC1, AC5 and AC6 by GTP-bound Gα i subunit. Synthetic peptides are widely used for identification of the regions in AC cytoplasmic domains involved in the functional interaction with the regulatory proteins and responsible for the enzyme activity [79–81] (Table 1).
To determine the role of various interaction regions within the C1 and C2 domains of the AC2 and AC6 in the basal and Gα s-, forskolin- and Mn2+-stimulated activities, five peptides corresponding to different interface regions involved in interaction with each other were synthesized [81]. Two peptides, 427–444 and 487–511, correspond to α2-β2-β3 and β4-β5-α4 regions of the C1 domain of AC6, and three peptides, 899–926, 927–948, and 984–1015, to α2, β2-β3, and α3-β4 regions of the C2 domain of AC2, respectively. All these peptides inhibit both Gα s- and forskolin-stimulated activities of full-length AC2 and AC6 expressed in Hi5 cells. Peptides 487–511 and 984–1015 also inhibit basal activity by 30%. Peptide 899–926 encoding C2 domain α2 region inhibits the basal and Mn2+-stimulated activities of AC2 and AC6 by 52–59%, and Gα s- and forskolin-stimulated activities of the enzymes by 55–63 and 71–80%, respectively. The other peptides do not affect Mn2+-stimulated activities significantly. The peptides with the replacement of residues most important in the interaction with other amino acids in the C1 and C2 domains, such as 427–444(R434D, K436D, I437P), 487–511(G498P, K501E, Q503R), 899–926(E910K, R913P, N916A, E917K, L926S), 927–948(K936D, I937F, K938D, T939F, I940F), and 984–1015(H989D, F991K, N992K, K995G, I1010D, G1011D, A1012Q, Q1013K) have no influence on the enzyme activity. Thus, the peptide strategy suggests that the AC activity stimulated by different regulators involves distinct interface interactions in the full-length enzyme, which indicates that the AC may have multiple catalytically competent configurations [81].
To identify CaM-binding regions in CaM-regulated AC1 and to decipher the molecular mechanisms of CaM regulatory action on the enzyme activity, the peptides corresponding to C1b subdomain region 495–522 (pAC28) of AC1 and C2a subdomain region 1024–1044 (pVLG) of AC1 were synthesized [79, 80]. The peptide pAC28 exhibits a high affinity for CaM binding (K d, 2 nM) and inhibits CaM-stimulated AC activity with IC50 equal to 500 nM [79]. The peptide pVLG binds CaM with low affinity and inhibits CaM-stimulated AC activity with IC50 equal to 10 μM, which points to a minor role of the region 1024–1044 in CaM-mediated stimulation of AC1 activity compared with the region 495–522. However, despite its rather high affinity for CaM, the peptide pAC28 binds to CaM in a Ca2+-independent manner, although the modulation of AC1 activity by CaM is known to be very Ca2+-dependent. At the same time, the peptide pVLG binds to CaM in a Ca2+-dependent manner. These data speak in favor of the fact that CaM requires not only Ca2+-independent C1b subdomain region 495–522 but also Ca2+-dependent C2a subdomain region 1024–1044 to stimulate AC1. When two CaM-critical residues of the peptide pVLG, Val1027 and Leu1030, are replaced by alanines, the specific binding of modified peptide pAAG with CaM is significantly reduced and the peptide pAAG competes with AC for CaM less efficiently than the peptide pVLG, pointing to a sequence dependence of the region 1024–1044 for binding to CaM. Thus, despite the structural and functional variety and different recognizing motifs on AC, CaM, like Gα s and Gβγ subunits, and forskolin, modulates the enzyme activity according to a two-site-interaction mechanism [80]. The peptide pVLG, in addition to inhibiting CaM-stimulated AC activity, also decreases the basal activity of AC1. The peptide pAAG having the inactive amino acid substitutions is also able to inhibit the enzyme activity. This is likely to be due to the interaction of peptide 1024–1044 with complementary region forming catalytic and/or regulatory sites of AC1 in CaM-free state.
7. The Family of Phospholipases C
Inositol-specific PLCs are the family of Ca2+-dependent multidomain enzymes, represented in mammalian cells by several isoforms, such as PLCβ, PLCγ, PLCδ, PLCε, PLCζ, and PLCη. They catalyze the hydrolysis of phosphatidylinositol 4,5-diphosphate (PI 4,5-P2) to yield diacylglycerol and phosphatidylinositol 1,4,5-triphosphate (PI 1,4,5-P3), which are important secondary messengers. PI 1,4,5-P3 binds to its receptor in the endoplasmic reticulum to open Ca2+ channels which increases the intracellular level of Ca2+ and activates calcium-sensitive enzymes, such as protein kinase C (PKC) [162, 163]. The PLC activity is regulated by many hormones and growth factors that realize their effects through GPCRs, receptor tyrosine kinases, and small G-proteins of the Ras and Rho families. These enzymes are implicated in intracellular signal transduction, vesicle transport, endocytosis, exocytosis, regulation of the ionic channels functions, mitosis, and cytoskeletal reorganization.
The family of PLCβ, the major effectors of Gq proteins, consists of four members different in their response to G proteins. The PLCβ1, for instance, is activated by GTP-bound Gα q subunit and is insensitive to Gβγ dimer, and the activity of PLCβ2, on the contrary, is regulated by Gβγ dimer. The PLCβ1 is expressed as two splice variants, PLCβ1a and PLCβ1b, differing only in the extreme C-terminal sequences, 75 amino acid residues in PLCβ1a and 32 in PLCβ1b. The PLCβ1a is localized in the cytoplasm, whereas PLCβ1b is associated with the sarcolemmal membrane, but deletion of the entire unique 31-mer sequence causes cytosolic localization of mutant PLCβ1b. Using synthetic peptides it was found that the critical role in association with the membrane has a short 10-mer C-terminal segment of PLCβ1b that determines functional activity of the enzyme [82] (Table 1). A myristoylated peptide corresponding to this segment of PLCβ1b enriched by proline residues induces the dissociation of the enzyme from the sarcolemmal membrane and inhibits its response to α 1-AR agonists with EC50 of 12 μM, whereas the same peptide from the C-terminus of PLCβ1a taken as control is ineffective. Later it was shown that a 32-mer C-terminal peptide of PLCβ1b competes with full-size enzyme for sarcolemmal localization and inhibits PLC activity stimulated by bsoth α 1-AR agonist norepinephrine and expressing constitutively active Gα q [83]. A 32-mer PLCβ1b-peptide significantly decreases a substantial hypertrophic response induced by phenylephrine and mutant Gα q subunit. So, PLCβ1b-peptides preventing the enzyme association with the sarcolemma and inhibiting signal transduction via Gq-coupled receptors downstream of Gq activation may provide useful therapeutic agents for the treatment of hypertrophy and other cardiomyocyte damages. The inhibition of hypertrophic signal transduction may be also achieved using the peptides, derivatives of Gα q, that are able to prevent pressure overload hypertrophy and to delay the progression of heart failure [164, 165]. However, the inhibition of Gq-coupled signaling pathways involved in control of fundamental cellular processes at the level of Gq protein far from being an ideal strategy because it can induce numerous dysfunctions in these pathways and, therefore, the selective inhibition or stimulation of GPCR or the enzyme, the generators of second messengers, PLCβ1 in particular, is preferable in this case.
The PLCβ-peptides are used for identification of the G protein-interacting regions in PLCβ [145, 166]. The PLCβ1-peptide 1053–1084 modified at the N-terminus by MPS corresponding to Kaposi fibroblast growth factor signal region in a dose-dependent manner inhibits GTPγS-dependent activation of PLCβ1 in both purified PLCβ1 and crude membrane preparations containing the intact enzyme, which indicates the disruption of the functional interaction between PLCβ1 and Gα q in active, GTP-bound, form [145]. Peptides 564–583 and 574–593 corresponding to the central region of PLCβ2 specifically bind to Gβγ and inhibit Gβγ-mediated stimulation of the enzyme activity [166]. Moreover, peptide 564–583 is more active compared with peptide 574–593, which speaks in favor of the fact that region 564–583 contains all determinants required for effective Gβγ dimer binding. The modification of peptide 564–583 with MPS does not influence their binding properties but increases its ability to block Gβγ-mediated activation of the enzyme activity in cultured cells [145].
The PLCβ-peptides are appropriate tools for identification of the enzyme isoforms participating in signal transduction triggered by different hormones that activate Gq- and Gi/o-coupled GPCRs [84, 145]. The PLCβ1-peptide 1053–1084 modified by MPS blocks, down to the basal level, serotonin-induced phosphatidylinositol hydrolysis in cultured choroids plexus epithelial cells, where Gq-coupled 5-HT2CR is the main mediator of serotonin stimulation. The inhibitory effect of peptide MPS-1053–1084 is dose-dependent with IC50 equal to 55 μM. The PLCβ2-peptide MPS-564–583 does not significantly influence 5-HT2CR-mediated stimulation of phosphatidylinositol hydrolysis. These data indicate that serotonin-induced activation of the 5-HT2CR leads to the release of active Gα q subunit and its interaction with PLCβ1 specifically regulated by Gα q, but not with PLCβ2 regulated by Gβγ dimer [145]. The same happens in the case of metabotropic glutamate receptors (mGluRs). At concentration 300 μM peptide MPS-1053–1084 significantly inhibits phosphatidylinositol hydrolysis stimulated by 3,5-dihydrophenylglycine, a specific agonist of the types 1 and 5 mGluR (mGluR1 and mGluR5), in primary cultures of astrocytes where Gq-coupled mGluR5 is expressed. In contrast, the treatment of the cells with peptide MPS-564–583 does not decrease the stimulation of mGluR-mediated phosphatidylinositol hydrolysis. These data suggest that mGluR5-mediated signaling is involved in PLCβ1 activated by Gα q [145].
Microinjection of heptapeptide 1161–1167 corresponding to the extreme C-terminal region of PLCβ3 in the cytoplasm of the HN33 hippocampal cells leads to a significant decrease of calcium signaling induced by mGluR agonist N-1,3-cyclopentanedicarboxylic acid [84] (Table 1). Injection with the same C-terminal peptides of other PLCβ isozymes, such as PLCβ1, PLCβ2, and PLCβ4, does not cause any changes in the calcium signaling. As according to the available data, the C-terminus of the PLCβ3 binds to adaptor and regulatory proteins, a PDZ domain-containing multimodular scaffolding protein Shank/ProSAP in particular, mediating the interaction between ligand-activated mGluR, Gq protein, and PLCβ3 at highly specialized submembranous sites, it can be assumed that peptide 1161–1167 competes with the enzyme for binding with these proteins and, thus, inhibits the transduction of a hormonal signal from the receptor to the enzyme [84].
The membrane-permeable PLCβ-peptides, specifically binding Gα q and Gβγ, can be used to study the involvement of these subunits in PLC-independent signaling pathways [145]. Pretreatment of HEK cells expressing the Gi/o-coupled α 2A-AR with PLCβ2-peptide MPS-564–583 that specifically binds Gβγ dimer completely blocks the activation of MAPK by epinephrine through α 2A-AR, while the PLCβ1-peptide MPS-1053–1084 specifically interacting with Gα q does not affect α 2A-AR-mediated MAPK activation. Unlike this, pretreatment of HEK cells expressing the Gq-coupled thrombin receptor with MPS-1053–1084 blocks the subsequent activation of PLCβ by thrombin receptor-activating peptide, but peptide MPS-564–583 in this case is ineffective. These data show that activation of MAPK cascade by α 2A-AR agonists is mediated through Gβγ subunits released from the Gi/o proteins, while the PLCβ activation by thrombin receptor agonists involves Gα q, but not Gβγ, which coincides with the data obtained using the other methods [145].
Studying synthetic peptides corresponding to different loci of PLCδ1, putative CaM-binding motif 473–493 of IQ type (VQXXXKXXXXK) was identified in the X/Y linker region of the enzyme that was not detected in the other PLC isoforms [86] (Table 1). Peptide 473–493 in a competition manner inhibits the binding of CaM with PLCδ1, but only in two cases, either in the absence of or at low concentrations of Ca2+. The binding of CaM to peptide 473–493 is, indeed, inversely related to Ca2+ concentration, while the peptide coprecipitates PLCδ1 irrespective of Ca2+ concentration. The incubation of PLCδ1 with 10–100 μM of the peptide causes a 22–53% reduction in the ability of PLCδ1 to catalyze hydrolysis of PI 4,5-P2. The results obtained with peptide 473–493 show that CaM binds with putative IQ motif located within the catalytic site of PLCδ1 and inhibits the enzyme activity [86].
In Sertoli cells FSH induces an immediate Ca2+ influx via a Gs/AC/cAMP-independent signaling pathway involving PLCδ1 and tissue transglutaminase possessing GTP-binding and GTPase activities and designated as Gα h [167]. The myristoylated peptide corresponding to region 747–763 of PLCδ1 in a competition manner inhibits the enzyme activity acting on the stage of coupling between FSH-stimulated Gα h protein and PLCδ1, while U73122, a specific nonpeptidic inhibitor of PLC, directly interacts with the enzyme and blocks its translocation from cytosol to the plasma membrane, which is necessary for PI 1,4,5-P3 production (Table 1). The pretreatment of rat Sertoli cells with 0.1 and 1 μM of the peptide leads to a 50 and 90% reduction of FSH-induced intracellular PI 1,4,5-P3 generation and to a 35 and 70% reduction of the FSH-evoked Ca2+ influx, which demonstrates a critical role of Gα h/PLCδ1/PI 1,4,5-P3 pathway in the FSH-induced Ca2+ influx in Sertoli cells [87, 167]. The action of the peptide is pathway-specific, since it does not interfere with FSH-induced activation of Gs/AC signaling pathway leading to an increase of the intracellular cAMP level.
The PLCγ participates in the signal cascades involving tyrosine kinase receptors, that is, brain-derived neurotrophic factor receptors and nerve growth factor receptors, and nonreceptor tyrosine kinases, for example, B-cell receptors and T-cell receptors, as the sensor components, and scaffolding molecules, Bruton's tyrosine kinase in particular, that mediate the functional coupling between ligand-activated receptor proteins and PLCγ [168]. As is known, the PLCγ contains adjacent to its SH2 and SH3 domains a PLC inhibitor (PCI) region, including a positively charged segment YRKMRLRY, that strongly suppresses PI 4,5-P2 hydrolyzing activity. Synthetic peptides identical to the PCI region inhibit the enzyme activity induced not only by PLCγ, but also by PLCβ and PLC-δ [169]. In addition, they inhibit Ca2+-dependent PLC activation in digitonin-permeabilized cells and agonist- and GTPγS-dependent PLC activation in purified plasma membranes [170]. The modification of PCI-peptide 724–736 by the conjugating myristic acid at the N-terminus increases its PLC inhibitory effects in vitro [85] (Table 1). The K i values are 120 and 3.5 μM for unmodified peptide 724–736 and its myristoylated analog, respectively. Myristoylated peptide 724–736 at concentrations in the sub-micromolar range significantly suppresses in vitro PI 1,4,5-P3 formation induced by hormones and growth factors (EGF, PDGF, bombesin) in Swiss 3T3 fibroblasts (the IC50 values are rather low, approximately 1 μM) and strongly inhibits cell proliferation induced by these stimuli in vivo in erbB-, v-raf- and B-raf-transformed NIH 3T3 cells, neutrophils, isolated pancreatic cells, and Swiss 3T3 fibroblasts. This indicates that myristoylation of PCI-peptides leads to structural alteration, resulting in their effective entry into substrate-containing vesicles and close association with PLC. The inhibitory effects on the basal PLC activity and hormone-stimulated PI 1,4,5-P3 formation and proliferation of N-myristoylated peptide 724–736 with the replacement of the Tyr726 and Tyr734 by phenylalanines are much less potent than the effects of the original myristoylated peptide. This gives grounds to say that biological activity of PCI-peptides depends to a large extent on tyrosine residues [85]. There is one thing to be mentioned at this point that unmodified peptide 724–736 with the Y726F/Y734F replacement is not active at all.
8. Phosphatidylinositol 3-Kinase
Heterodimeric PI3-K consisting of regulatory p85 and catalytic p110 subunits generates phosphoinositide second messengers, such as phosphatidylinositol 3,4,5-triphosphate (PI 3,4,5-P3) and phosphatidylinositol 3,4-diphosphate (PI 3,4-P2), and regulates an array of signaling pathways through the membrane recruitment and activation of downstream effector proteins [171]. It was shown that C-terminal SH2 domain of PI3-K p85α subunit contains PI 3,4,5-P3-binding region 18–29 and displays discriminative affinity for this phosphoinositide, depending on the length of acyl chain and the charge density on the phosphoinositol ring of PI 3,4,5-P3. Peptide 11–29 including the region selectively binds PI 3,4,5-P3 with K d of 30 μM, as in the case of the full-length C-terminal SH2 domain, but has the binding affinity for other phosphoinositides, PI 3,4-P2 in particular, which is one to two orders of magnitude lower compared with PI 3,4,5-P3 [88] (Table 1). This peptide in a dose-dependent manner inhibits the binding of [3H]di-C8-PI 3,4,5-P3 to the full-length C-terminal SH2 domain of PI3-K p85α subunit immobilized onto streptavidin-coated beads with IC50 of 62 μM. On the addition of PI 3,4,5-P3 the contribution of α-helical conformation in the peptide structure increases significantly. Besides, confirming the fact that the binding site for PI 3,4,5-P3 is localized within region 11–29, these findings suggest that the other regions of p85 subunit are not involved in this binding [88].
9. Protein Kinase C
The family of the PKCs, intracellular serine/threonine protein kinases, includes classical forms of the enzymes (PKCα, PKCβ, and PKCγ) undergoing activation in the presence of diacylglycerol and calcium ions, novel isoforms of PKC (δ, ε, η, θ) independent of Ca2+ regulation, and atypical PKC isoforms (ζ, ι) independent of diacylglycerol and Ca2+ [172]. All PKCs possess C-terminal serine/threonine protein kinase domain linked to a regulatory domain including an inhibitory region, designated as the pseudosubstrate site [173]. As is known, PKCs are inactive in the absence of activating agents owing to an intramolercular interaction between a short inhibitory sequence located in the pseudosubstrate site and the substrate-binding region of the catalytic domain. Synthetic peptides corresponding to pseudosubstrate inhibitory sequence selectively decrease functional activity of PKC [174, 175]. To penetrate into cell pseudosubstrate peptides were subjected to modification using MPS derived from Antennapedia protein or HIV-1 TAT protein and hydrophobic fatty acid radicals [89, 176, 177]. As a rule, such modification has no influence on cellular processes, neither does it change the spectrum of inhibitory properties of pseudosubstrate peptides. However, cell-permeable pseudosubstrate peptides from PKCα/β, PKCη, PKCζ, and kinase domain of EGF receptor modified by myristoyl radical, in addition to inhibiting PKC activity, possess the ability to activate ERK1/2 and p38 MAPK, the components of MAPK cascade, and the intracellular enzymes (AKT kinase, in particular) involved in endothelial nitric oxide synthase activation and NO production [89, 178] (Table 1). Because an increase of endothelial nitric oxide synthase activity seems beneficial in the case of many diseases such as ischemic stroke, hypertension, and atherosclerosis, PKC-derived myristoylated peptides have a good chance to be used as pharmacological compounds for acute activation of the enzyme.
10. The Molecular Mechanisms of Action of Intracellular Signal Protein-Derived Peptides
According to the present view, there may be three molecular mechanisms of action of signal protein-derived peptides, all including different models of the competition relationships between the peptide and its cognate signal proteins.
The first mechanism is based on the competition between the peptide and its cognate full-length signal protein for the interaction with the other functionally and structurally complementary signal and proteins, components of signaling cascade. According to this mechanism, GPCR-peptide directly interacts with G protein subunits, Gα or Gβγ; Gα-peptide with the Gβγ-dimer complex, the receptor or the enzyme generating the second messenger; AC-derived peptide with G protein or AC-competent regulatory proteins, CaM in particular; and so on. This creates conditions for GPCR-peptide corresponding to G protein-activating region of the receptor to activate G proteins in a dose-dependent manner and trigger coupled to them signaling cascades and in a competition manner to disturb functional interaction between its cognate ligand-activated receptor and G proteins, decreasing or completely blocking the signal transduction. Then GPCR-peptide will function as antagonist of GPCR-signaling. A peptide corresponding to the extreme C-terminal region of Gα subunit binds to G protein-activating region of GPCR and selectively inhibits the transduction of hormonal signal from ligand-activated receptor to its cognate G proteins, acting also as antagonist of signal transduction. The peptide, derivative of the C-terminal region of the PLCβ3, competes with the full-size enzyme for binding with adaptor and regulatory proteins, including scaffolding protein Shank/ProSAP, which leads to destabilization of functionally active receptor-Gq protein–PLCβ3 complex and to inhibition of hormone-induced stimulation of phosphoinositide hydrolysis [84].
The second mechanism includes the interaction of synthetic peptide with complementary regions of protein homologous to it. According to Covic and colleagues, this mechanism accounts for the ability of pepducins to activate or, contrary to this, to inhibit signal transduction via their cognate receptor [97]. When pepducin acts as agonist, it binds to the high-affinity activating site formed by the intracellular regions of GPCR and, thus, stabilizes or induces the active state of receptor, which makes it possible for the latter to interact effectively with G proteins and trigger signaling cascade. When pepducin acts as antagonist, it binds to lower-affinity inhibiting site that blocks the interaction between ligand-activated receptor and G protein and prevents the transduction of signal to G protein. According to this two-site mechanism, GPCR-peptide specifically interacts with complementary regions of its cognate receptor that in intact receptor have contacts with the region homologous to the peptide affecting their mobility and rearrangement. The peptides corresponding to various regions within the C1 and C2 domains of the AC2 and AC6 differ in the ability to influence the basal and forskolin-, Gα s- and Mn2+-stimulated activities, which indicates that these peptides interact with different complementary regions forming catalytic and regulatory site of the enzyme.
The data obtained in our and the other authors' investigations show that the receptor specificity of GPCR-peptides and the dependence of their action on the receptors homologous to them unambiguously speak in favor of the second mechanism of action of GPCR-peptides [26, 39, 50, 97]. The receptor specificity and the need in cognate receptor are likely to be both responsible for participation of the cognate receptor in realization of regulatory effects of GPCR-peptides, which resembles the action of signal protein-derived peptides carried out by the second mechanism.
The data about high receptor specificity of pepducins, the lipidated GPCR-peptides, are mentioned before. Studying 5-HTR-derived peptides we found that they affect only their cognate 5-HTR and practically do no influence the activity of structurally close to them 5-HTRs [39]. 5-HT6R-peptide 258–268 reduces the stimulating effects of serotonin and, to a greater extent, EMD-386088, a selective 5-HT6R agonist, on AC activity and Gs proteins GTP binding. At the same time, the agonists of the other types of 5-HTR, which are also able to stimulate AC system, still have such effects. The inhibitory effect of peptide 258–268 on serotonin signaling is blocked in the presence of 5-HT6R antagonists SB-271046 and methiothepin but is retained in the presence of antagonists of the other types of 5-HTR. 5-HT1BR-peptide 300–316 decreases AC inhibiting effects of serotonin and 5-HT1R agonists, especially of selective 5-HT1BR agonist 5-nonyloxytryptamine, and their stimulating effects on the Gi proteins, while the effects of agonists of the other types of 5-HTR in the presence of this peptide do not change. 5-HT1BR antagonists reduce or completely block the effects of peptide 300–316, whereas the antagonists of the other types of 5-HTR in this case are not effective [39].
As mentioned above, the action of P1pal-19 corresponding to N-ICL3 of PAR1 on PLCβ and the other downstream effector enzymes is partially or completely blocked in cultured cells and tissues where the cognate PAR1 is absent. Peptide P1pal-19 and its analogs are ineffective in the presence of the mutant PAR1 entirely devoid of CTD. It follows that activation of the G proteins by P1pal-19 requires the presence of the CTD of the receptor and it may provide a binding site for PAR1-derived pepducins [98]. Peptide 615–629 derived from relaxin receptor RXFP1 stimulates the basal AC activity in the rat myocardium and brain with abundant RXFP1 receptors, but it does not affect the enzyme activity in the skeletal muscles [50], where relaxin regulates AC via the receptor of a different type [179]. The action of 5-HTR-peptides on AC system is well expressed in the brain, the main target of serotonin, and rather little in the muscle and reproductive tissues, where the 5-HTRs are expressed weakly or not at all [39].
The third mechanism of action of signal protein-derived peptides is based on their ability to influence the stability of homo- and heteromeric complexes formed by their cognate proteins, which in many cases accounts for the functional activity of these proteins. It is shown that the cyclic peptide 225–273 constructed on the basis of a full-size ICL3 of the V2-vasopressin receptor induces a significant inhibition of the bioluminescence resonance energy-transfer signal between constrains V2 receptor-luciferase and V2 receptor-yellow fluorescent protein, indicating that it modifies the distance and/or orientation between these constrains engaged in formation of dimeric complex and, thus, causes a dose-dependent decrease in specific binding of [Arg8]-vasopressin as a result of transition of the receptor high-affinity to low-affinity state and inhibits vasopressin-induced stimulation of AC activity [55]. Peptide 260–276 corresponding to C-ICL3 of D2-DR also affects the stability of the heterodimeric complex between D1- and D2-DR, which leads to alteration of dopamine signaling in the brain [32, 40, 42]. There is a view that peptide competes with its corresponding region in intact D2-DR containing a positively charged segment RRRRKR217-222 for binding to the anionic site located in CTD of D1-DR and prevents the D1/D2-heterodimerization. So, GPCR-peptides change the stability of receptor complex and are capable of acting either as positive allosteric regulators inducing the appropriate cellular response to agonist even at a very low concentration or as negative allosteric regulators blocking partially or completely this response.
Concerning the mechanism of action of signal protein-derived peptides realized in the cell, it is likely be a combination of the above mechanisms, depending on the structure of the peptide and localization of the region homologous to it in cognate protein, the modification of peptides by hydrophobic radicals and functional groups, the ability of signal proteins to form intermolecular complex, and other things. Finally, the choice between the first and the second mechanisms has a direct relation to the affinity of peptide for the proteins homologous to it or the proteins-partners functionally interacting with the latter. If the affinity of synthetic peptide for complementary regions of the cognate protein is higher than that for those of other proteins, the preference is given to the second mechanism; if the affinity for complementary regions of other proteins specifically interacting with the cognate protein is above that for the latter, the first mechanism comes into action, as a rule. The affinity depends not only on structural-functional features of synthetic peptides and full-length signal proteins but also on the physical-chemical properties of the medium (pH, salts, polar and non-polar solvents, etc.), the presence of hydrophobic surfaces, microenvironment of signal proteins, and other factors.
11. Conclusion
Many approaches are used now to study hormonal signaling systems and to develop specific and selective regulators controlling their functional activity; the peptide strategy, however, has some advantages compared to the others. First, the length of biologically active signal protein-derived peptides does not usually precede 15–20 amino acid residues, and they can be synthesized in a short time and in quantum satis, using the solid-phase method, purified to homogeneity by reversed phase HPLC and characterized by mass-spectrometry, amino acid analysis, and other appropriate methods. Second, to enhance biological activity and selectivity of the action of peptides and to obtain their analogs with higher stability to hydrolytic enzymes, signal protein-derived peptides are subjected to different modifications, such as selective blocking of free functional groups of amino acids, substitution of L- by D-amino acids and of natural amino acids by rare, nonnatural, amino acids, synthesis of cyclic and branched forms of peptides and their di- and oligomeric constrains, and attachment to them of hydrophobic radicals. Third, to obtain cell-penetrating forms of peptides, the latter can be cross-linked either with the MPS represented by short polycationic segment containing five or more arginine residues, the amphiphilic helix having hydrophilic positively charged side with lysine residues, often-applicable sequence 48–60 of HIV-1 TAT protein and signal sequence of Kaposi fibroblast growth factor, or modified by the hydrophobic moiety such as hydrophobic TM helical segment, hydrophobic fatty acid, and steroid radicals mimicking TM of intact signal protein. In the recent years in the synthesis of peptides wide application has found the minigene approach, a new biotechnology method in the frame of the peptide strategy. This approach is very perspective for the synthesis of very long peptides corresponding to full-length subdomains of signal proteins as well as of chimeric constrains including combination of regions derived from different signal proteins, but it is not applicable for obtaining modified by D- and nonnatural amino acids, branched and oligomeric as well as cell-penetrating forms of the signal protein-derived peptides, and cannot be used with all cell types. At the same time, a further modification of the minigene approach with the aim to expand its applicability must go on, especially because it allows creation of a whole library of signal-protein-derived peptides for deciphering a complex network of intracellular signal cascades and their selective regulation and modulation. It is of special importance that the minigene approach can be used to control the function of the central nervous system, where small minigene-expressing peptides may serve as selective intracellular regulators and modulators of neuronal signal transmission.
It should be said in conclusion that on the addition to peptides derived from signal proteins, the components of hormone-sensitive signaling systems, some peptides generated from nonsignal proteins are also able to selectively regulate and modulate cell signaling, acting as a kind of bioactive molecules within cells [180]. These peptides are released in large amount by proteasomes and other extralysosomal proteolytic systems and before complete degradation can interfere with signal protein interaction, thereby affecting signal transduction, gene regulation, metabolism, protein targeting, and apoptosis. In pathological conditions a change in the composition of these intracellular nonsignal protein-derived peptides can have influence on the activity of hormonal signaling systems, especially their downstream components, and lead to disturbances in cell homeostasis.
Acknowledgments
This work was supported by Grant no. 09-04-00746 from the Russian Foundation of Basic Research. The author is grateful to Inga Menina for linguistic assistance.
Abbreviations
- AC:
Adenylyl cyclase
- ANP:
Atrial natriuretic peptide
- AR:
Adrenergic receptor
- CaM:
Calmodulin
- CTD:
C-terminal domain
- DR:
Dopamine receptor
- EGF:
Epidermal growth factor
- FSH:
Follicle-stimulating hormone
- GLP1R:
Glucagon-like peptide-1 receptor
- GPCR:
G protein-coupled receptor
- 5-HTR:
5-hydroxytryptamine receptors
- ICL1, ICL2, and ICL3:
The first, second and third intracellular loops;
- IR:
Insulin receptor
- MAPK:
Mitogen-activated protein kinase
- MChR:
Muscarinic acetylcholine receptor
- mGluR:
Metabotropic glutamate receptor
- MPS:
Membrane-permeable sequence
- N-CTD:
N-terminal region of CTD
- N- and C-ICL3:
N- and C-terminal regions of ICL3
- NPR-C:
Natriuretic peptide clearance receptor of C-type
- PAR:
Protease-activated receptor
- PCI:
PLC inhibitor
- PI3-K:
Phosphatidylinositol 3-kinase
- PI 3,4-P2 and PI 4,5-P2:
Phosphatidylinositol 3,4- and 4,5-diphosphates;
- PI 1,4,5-P3 and PI 3,4,5-P3:
Phosphatidylinositol 1,4,5- and 3,4,5-triphosphate
- PKC:
Protein kinase C
- PLC and PLD:
Phospholipases C and D
- PT:
Pertussis toxin
- S1P:
Sphingosine-1-phosphate
- TM:
Transmembrane region
- TMC:
Transmembrane channel
- TXA2R:
Thromboxane A2 receptor.
References
- 1.Conner AC, Simms J, Barwell J, Wheatley M, Poyner DR. Ligand binding and activation of the CGRP receptor. Biochemical Society Transactions. 2007;35(4):729–732. doi: 10.1042/BST0350729. [DOI] [PubMed] [Google Scholar]
- 2.Hofmann KP, Scheerer P, Hildebrand PW, et al. A G protein-coupled receptor at work: the rhodopsin model. Trends in Biochemical Sciences. 2009;34(11):540–552. doi: 10.1016/j.tibs.2009.07.005. [DOI] [PubMed] [Google Scholar]
- 3.Zheng H, Loh HH, Law PY. Agonist-selective signaling of G protein-coupled receptor: mechanisms and implications. International Union of Biochemistry and Molecular Biology Life. 2010;62(2):112–119. doi: 10.1002/iub.293. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Smrcka AV. G protein βγ subunits: central mediators of G protein-coupled receptor signaling. Cellular and Molecular Life Sciences. 2008;65(14):2191–2214. doi: 10.1007/s00018-008-8006-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Dupré DJ, Robitaille M, Rebois RV, Hébert TE. The role of Gβγ subunits in the organization, assembly, and function of GPCR signaling complexes. Annual Review of Pharmacology and Toxicology. 2009;49:31–56. doi: 10.1146/annurev-pharmtox-061008-103038. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Woehler A, Ponimaskin EG. G protein-mediated signaling: same receptor, multiple effectors. Current Molecular Pharmacology. 2009;2(3):237–248. doi: 10.2174/1874467210902030237. [DOI] [PubMed] [Google Scholar]
- 7.Cabrera-Vera TM, Vanhauwe J, Thomas TO, et al. Insights into G protein structure, function and regulation. Endocrine Reviews. 2003;24(6):765–781. doi: 10.1210/er.2000-0026. [DOI] [PubMed] [Google Scholar]
- 8.McCudden CR, Hains MD, Kimple RJ, Siderovski DP, Willard FS. G-protein signaling: back to the future. Cellular and Molecular Life Sciences. 2005;62(5):551–577. doi: 10.1007/s00018-004-4462-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Johnston CA, Siderovski DP. Receptor-mediated activation of heterotrimeric G-proteins: current structural insights. Molecular Pharmacology. 2007;72(2):219–230. doi: 10.1124/mol.107.034348. [DOI] [PubMed] [Google Scholar]
- 10.Sprang SR, Chen Z, Du X. Structural basis of effector regulation and signal termination in heterotrimeric Gα proteins. Advances in Protein Chemistry. 2007;74:1–65. doi: 10.1016/S0065-3233(07)74001-9. [DOI] [PubMed] [Google Scholar]
- 11.Patel TB. Single transmembrane spanning heterotrimeric G protein-coupled receptors and their signaling cascades. Pharmacological Reviews. 2004;56(3):371–385. doi: 10.1124/pr.56.3.4. [DOI] [PubMed] [Google Scholar]
- 12.Plum L, Schubert M, Brüning JC. The role of insulin receptor signaling in the brain. Trends in Endocrinology and Metabolism. 2005;16(2):59–65. doi: 10.1016/j.tem.2005.01.008. [DOI] [PubMed] [Google Scholar]
- 13.Morandell S, Stasyk T, Skvortsov S, Ascher S, Huber LA. Quantitative proteomics and phosphoproteomics reveal novel insights into complexity and dynamics of the EGFR signaling network. Proteomics. 2008;8(21):4383–4401. doi: 10.1002/pmic.200800204. [DOI] [PubMed] [Google Scholar]
- 14.Shpakov AO. The homology of the primary structure of the third cytoplasmic domains in rhodopsin-type receptors and of the cytoplasmic tail in the β-subunit of the insulin receptor. Tsitologiia. 1996;38(11):1179–1190. (Rus). [PubMed] [Google Scholar]
- 15.Pertseva MN, Shpakov AO, Plesneva SA, Kuznetsova LA. A novel view on the mechanisms of action of insulin and other insulin superfamily peptides: involvement of adenylyl cyclase signaling system. Comparative Biochemistry and Physiology. 2003;134(1):11–36. doi: 10.1016/s1096-4959(02)00160-4. [DOI] [PubMed] [Google Scholar]
- 16.Shpakov AO, Pertseva MN. The peptide strategy as a novel approach to the study of G protein-coupled signaling systems. In: Grachevsky NO, editor. Signal Transduction Research Trend. New York, NY, USA: Nova Science Publishers; 2007. pp. 45–93. [Google Scholar]
- 17.Palczewski K, Kumasaka T, Hori T, et al. Crystal structure of rhodopsin: a G protein-coupled receptor. Science. 2000;289(5480):739–745. doi: 10.1126/science.289.5480.739. [DOI] [PubMed] [Google Scholar]
- 18.Bockaert J, Marin P, Dumuis A, Fagni L. The “magic tail” of G protein-coupled receptors: an anchorage for functional protein networks. Federation of the Societies of Biochemistry and Molecular Biology Letters. 2003;546(1):65–72. doi: 10.1016/s0014-5793(03)00453-8. [DOI] [PubMed] [Google Scholar]
- 19.Schwartz TW, Frimurer TM, Holst B, Rosenkilde MM, Elling CE. Molecular mechanism of 7TM receptor activation—a global toggle switch model. Annual Review of Pharmacology and Toxicology. 2006;46:481–519. doi: 10.1146/annurev.pharmtox.46.120604.141218. [DOI] [PubMed] [Google Scholar]
- 20.Bourne HR. How receptors talk to trimeric G proteins. Current Opinion in Cell Biology. 1997;9(2):134–142. doi: 10.1016/s0955-0674(97)80054-3. [DOI] [PubMed] [Google Scholar]
- 21.Wess J. G-protein-coupled receptors: molecular mechanisms involved in receptor activation and selectivity of G-protein recognition. Federation of American Societies for Experimental Biology Journal. 1997;11(5):346–354. [PubMed] [Google Scholar]
- 22.Shpakov AO. Molecular basis of the functional coupling of receptors to GTP-binding proteins. Membrane and Cell Biology. 1996;9(5):467–487. [Google Scholar]
- 23.Shpakov AO. The molecular determinants in the serpentine type receptors, responsible for its functional coupling with the heterotrimeric G-protein. Tsitologiia. 2002;44:242–258. (Rus). [PubMed] [Google Scholar]
- 24.Fanelli F, De Benedetti PG, Raimondi F, Seeber M. Computational modeling of intramolecular and intermolecular communication in GPCRs. Current Protein and Peptide Science. 2009;10(2):173–185. doi: 10.2174/138920309787847554. [DOI] [PubMed] [Google Scholar]
- 25.Taylor JM, Neubig RR. Peptides as probes for G protein signal transduction. Cellular Signalling. 1994;6(8):841–849. doi: 10.1016/0898-6568(94)90017-5. [DOI] [PubMed] [Google Scholar]
- 26.Miller J, Agarwal A, Devi LA, et al. Insider access: pepducin symposium explores a new approach to GPCR modulation. Annals of the New York Academy of Sciences. 2009;1180(1):E1–E12. doi: 10.1111/j.1749-6632.2009.05326.x. [DOI] [PubMed] [Google Scholar]
- 27.Tressel SL, Koukos G, Tchernychev B, Jacques SL, Covic L, Kuliopulos A. Pharmacology, biodistribution, and efficacy of GPCR-based pepducins in disease models. Methods in Molecular Biology. 2011;683:259–275. doi: 10.1007/978-1-60761-919-2_19. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Phillips WJ, Cerione RA. A C-terminal peptide of bovine rhodopsin binds to the transducin α-subunit and facilitates its activation. Biochemical Journal. 1994;299(2):351–357. doi: 10.1042/bj2990351. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Yeagle PL, Alderfer JL, Albert AD. Structure determination of the fourth cytoplasmic loop and carboxyl terminal domain in bovine rhodopsin. Molecular Vision. 1996;2:p. 12. [PubMed] [Google Scholar]
- 30.Okamoto T, Nishimoto I. Detection of G protein-activator regions in M4 subtype muscarinic, cholinergic, and α 2-adrenergic receptors based upon characteristics in primary structure. Journal of Biological Chemistry. 1992;267(12):8342–8346. [PubMed] [Google Scholar]
- 31.Wade SM, Dalman HM, Yang SZ, Neubig RR. Multisite interactions of receptors and G proteins: enhanced potency of dimeric receptor peptides in modifying G protein function. Molecular Pharmacology. 1994;45(6):1191–1197. [PubMed] [Google Scholar]
- 32.Johnston CA, Siderovski DP. Structural basis for nucleotide exchange on Gα i subunits and receptor coupling specificity. Proceedings of the National Academy of Sciences of the United States of America. 2007;104(6):2001–2006. doi: 10.1073/pnas.0608599104. [DOI] [PMC free article] [PubMed] [Google Scholar] [Retracted]
- 33.Palm D, Munch G, Dees C, Hekman M. Mapping of β-adrenoceptor coupling domains to Gs-protein by site-specific synthetic peptides. Federation of the Societies of Biochemistry and Molecular Biology Letters. 1989;254(1-2):89–93. doi: 10.1016/0014-5793(89)81015-4. [DOI] [PubMed] [Google Scholar]
- 34.Munch G, Dees C, Hekman M, Palm D. Multisite contacts involved in coupling of the β-adrenergic receptor with the stimulatory guanine-nucleotide-binding regulatory protein: structural and functional studies by β-receptor-site-specific synthetic peptides. European Journal of Biochemistry. 1991;198(2):357–364. doi: 10.1111/j.1432-1033.1991.tb16023.x. [DOI] [PubMed] [Google Scholar]
- 35.Okamoto T, Murayama Y, Hayashi Y, Inagaki M, Ogata E, Nishimoto I. Identification of a Gs activator region of the β 2-adrenergic receptor that is autoregulated via protein kinase A-dependent phosphorylation. Cell. 1991;67(4):723–730. doi: 10.1016/0092-8674(91)90067-9. [DOI] [PubMed] [Google Scholar]
- 36.Taylor JM, Jacob-Mosier GG, Lawton RG, Remmers AE, Neubig RR. Binding of an α 2 adrenergic receptor third intracellular loop peptide to Gβ and the amino terminus of Gα . Journal of Biological Chemistry. 1994;269(44):27618–27624. [PubMed] [Google Scholar]
- 37.Cypess AM, Unson CG, Wu CR, Sakmar TP. Two cytoplasmic loops of the glucagon receptor are required to elevate cAMP of intracellular calcium. Journal of Biological Chemistry. 1999;274(27):19455–19464. doi: 10.1074/jbc.274.27.19455. [DOI] [PubMed] [Google Scholar]
- 38.Konig B, Gratzel M. Site of dopamine D1 receptor binding to Gs protein mapped with synthetic peptides. Biochimica et Biophysica Acta. 1994;1223(2):261–266. doi: 10.1016/0167-4889(94)90235-6. [DOI] [PubMed] [Google Scholar]
- 39.Shpakov AO, Shpakova EA, Tarasenko II, Derkach KV, Vlasov GP. The peptides mimicking the third intracellular loop of 5-hydroxytryptamine receptors of the types 1B and 6 selectively activate G proteins and receptor-specifically inhibit serotonin signaling via the adenylyl cyclase system. International Journal of Peptide Research and Therapeutics. 2010;16(2):95–105. [Google Scholar]
- 40.Voss T, Wallner E, Czernilofsky AP, Freissmuth M. Amphipathic α-helical structure does not predict the ability of receptor-derived synthetic peptides to interact with guanine nucleotide-binding regulatory proteins. Journal of Biological Chemistry. 1993;268(7):4637–4642. [PubMed] [Google Scholar]
- 41.Sun QQ, Dale N. G-proteins are involved in 5-HT receptor-mediated modulation of N- and P/Q- but not T-type Ca2+ channels. Journal of Neuroscience. 1999;19(3):890–899. doi: 10.1523/JNEUROSCI.19-03-00890.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Nanoff C, Koppensteiner R, Yang Q, Fuerst E, Ahorn H, Freissmuth M. The carboxyl terminus of the Gα-subunit is the latch for triggered activation of heterotrimeric G proteins. Molecular Pharmacology. 2006;69(1):397–405. doi: 10.1124/mol.105.016725. [DOI] [PubMed] [Google Scholar]
- 43.Kubota M, Wakamatsu K. Peptide fragment of the m3 muscarinic acetylcholine receptor activates Gq but not Gi2 . Journal of Peptide Science. 2008;14(8):998–1002. doi: 10.1002/psc.1034. [DOI] [PubMed] [Google Scholar]
- 44.Shpakov AO, Tarasenko II, Shpakova EA. Peptides derived from the third cytoplasmic loop of type 6 serotonin receptor as regulators of serotonin-sensitive adenylyl cyclase signaling system. Doklady Biochemistry and Biophysics. 2010;431(1):94–97. doi: 10.1134/s1607672910020110. [DOI] [PubMed] [Google Scholar]
- 45.Morou E, Georgoussi Z. Expression of the third intracellular loop of the δ-opioid receptor inhibits signaling by opioid receptors and other G protein-coupled receptors. Journal of Pharmacology and Experimental Therapeutics. 2005;315(3):1368–1379. doi: 10.1124/jpet.105.089946. [DOI] [PubMed] [Google Scholar]
- 46.Grasso P, Deziel MR, Reichert LE. Selective effects of charge on G protein activation by FSH-receptor residues 551–555 and 650–653. Peptide Research. 1995;8(5):278–284. [PubMed] [Google Scholar]
- 47.Grasso P, Leng N, Reichert LE. A synthetic peptide corresponding to the third cytoplasmic loop (residues 533 to 555) of the testicular follicle-stimulating hormone receptor affects signal transduction in rat testis membranes and in intact cultured rat Sertoli cells. Molecular and Cellular Endocrinology. 1995;110(1-2):35–41. doi: 10.1016/0303-7207(95)91392-t. [DOI] [PubMed] [Google Scholar]
- 48.Mukherjee S, Palczewski K, Gurevich VV, Hunzicker-Dunn M. β-Arrestin-dependent desensitization of luteinizing hormone/choriogonadotropin receptor is prevented by a synthetic peptide corresponding to the third intracellular loop of the receptor. Journal of Biological Chemistry. 1999;274(19):12984–12989. doi: 10.1074/jbc.274.19.12984. [DOI] [PubMed] [Google Scholar]
- 49.Shpakov AO, Pertseva MN, Gur’ianov GP, Vlasov IA. The influence of the peptides, derivatives of the third cytoplasmic loop of type 1 relaxin receptor, on the stimulation of GTP binding activity of the G proteins by relaxin. Journal of Membrane Biology. 2005;22:435–442. (Rus). [Google Scholar]
- 50.Shpakov AO, Gur’yanov IA, Kuznetsova LA, et al. Studies of the molecular mechanisms of action of relaxin on the adenylyl cyclase signaling system using synthetic peptides derived from the LGR7 relaxin receptor. Neuroscience and Behavioral Physiology. 2007;37(7):705–714. doi: 10.1007/s11055-007-0071-y. [DOI] [PubMed] [Google Scholar]
- 51.Shpakov AO, Gur’yanov IA, Tarasenko II, Vlasov GP. Effects of polycationic peptides of different natures on the functional state of the serotonin-regulated adenylate cyclase system in the rat brain. Journal of Neurochemistry. 2009;3:272–281. [Google Scholar]
- 52.Plati J, Tsomaia N, Piserchio A, Mierke DF. Structural features of parathyroid hormone receptor coupled to Gα s-protein. Biophysical Journal. 2007;92(2):535–540. doi: 10.1529/biophysj.106.094813. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Bavec A, Hällbrink M, Langel U, Zorko M. Different role of intracellular loops of glucagon-like peptide-1 receptor in G-protein coupling. Regulatory Peptides. 2003;111(1–3):137–144. doi: 10.1016/s0167-0115(02)00282-3. [DOI] [PubMed] [Google Scholar]
- 54.Wade SM, Scribner MK, Dalman HM, Taylor JM, Neubig RR. Structural requirements for Go activation by receptor-derived peptides: activation and modulation domains of the α 2-adrenergic receptor i3c region. Molecular Pharmacology. 1996;50(2):351–358. [PubMed] [Google Scholar]
- 55.Granier S, Terrillon S, Pascal R, et al. A cyclic peptide mimicking the third intracellular loop of the V2 vasopressin receptor inhibits signaling through its interaction with receptor dimer and G protein. Journal of Biological Chemistry. 2004;279(49):50904–50914. doi: 10.1074/jbc.M405089200. [DOI] [PubMed] [Google Scholar]
- 56.Howlett AC, Song C, Berglund BA, Wilken GH, Pigg JJ. Characterization of CB1 cannabinoid receptors using receptor peptide fragments and site-directed antibodies. Molecular Pharmacology. 1998;53(3):504–510. doi: 10.1124/mol.53.3.504. [DOI] [PubMed] [Google Scholar]
- 57.Mukhopadhyay S, Howlett AC. CB1 receptor-G protein association: subtype selectivity is determined by distinct intracellular domains. European Journal of Biochemistry. 2001;268(3):499–505. doi: 10.1046/j.1432-1327.2001.01810.x. [DOI] [PubMed] [Google Scholar]
- 58.Ulfers AL, McMurry JL, Miller A, Wang L, Kendall DA, Mierke DF. Cannabinoid receptor-G protein interactions: Gαi1-bound structures of IC3 and a mutant with altered G protein specificity. Protein Science. 2002;11(10):2526–2531. doi: 10.1110/ps.0218402. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Shirai H, Takahashi K, Katada T, Inagami T. Mapping of G protein coupling sites of the angiotensin II type 1 receptor. Hypertension. 1995;25(4):726–730. doi: 10.1161/01.hyp.25.4.726. [DOI] [PubMed] [Google Scholar]
- 60.Sano T, Ohyama K, Yamano Y, et al. A domain for G protein coupling in carboxyl-terminal tail of rat angiotensin II receptor type 1A. Journal of Biological Chemistry. 1997;272(38):23631–23636. doi: 10.1074/jbc.272.38.23631. [DOI] [PubMed] [Google Scholar]
- 61.Kai H, Alexander RW, Ushio-Fukai M, Lyons PR, Akers M, Griendling KK. G-protein binding domains of the angiotensin II AT1A receptors mapped with synthetic peptides selected from the receptor sequence. Biochemical Journal. 1998;332(3):781–787. doi: 10.1042/bj3320781. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Franzoni L, Nicastro G, Pertinhez TA, et al. Structure of the C-terminal fragment 300–320 of the rat angiotensin II AT1A receptor and its relevance with respect to G-protein coupling. Journal of Biological Chemistry. 1997;272(15):9734–9741. doi: 10.1074/jbc.272.15.9734. [DOI] [PubMed] [Google Scholar]
- 63.Schreiber RE, Prossnitz ER, Ye RD, Cochrane CG, Bokoch GM. Domains of the human neutrophil N-formyl peptide receptor involved in G protein coupling: mapping with receptor-derived peptides. Journal of Biological Chemistry. 1994;269(1):326–331. [PubMed] [Google Scholar]
- 64.Bommakanti RK, Dratz EA, Siemsen DW, Jesaitis AJ. Extensive contact between Gi2 and N-formyl peptide receptor of human neutrophils: mapping of binding sites using receptor-mimetic peptides. Biochemistry. 1995;34:6720–6728. doi: 10.1021/bi00020a017. [DOI] [PubMed] [Google Scholar]
- 65.Zhang L, Huang G, Wu J, Ruan KH. A profile of the residues in the first intracellular loop critical for Gs mediated signaling of human prostacyclin receptor characterized by an integrative approach of NMR-experiment and mutagenesis. Biochemistry. 2005;44(34):11389–11401. doi: 10.1021/bi050483p. [DOI] [PubMed] [Google Scholar]
- 66.Zhang L, Wu J, Ruan KH. Solution structure of the first intracellular loop of prostacyclin receptor and implication of its interaction with the C-terminal segment of Gα s protein. Biochemistry. 2006;45(6):1734–1744. doi: 10.1021/bi0515669. [DOI] [PubMed] [Google Scholar]
- 67.Kole HK, Garant MJ, Kole S, Bernier M. A peptide-based protein-tyrosine phosphatase inhibitor specifically enhances insulin receptor function in intact cells. Journal of Biological Chemistry. 1996;271(24):14302–14307. doi: 10.1074/jbc.271.24.14302. [DOI] [PubMed] [Google Scholar]
- 68.Kole HK, Liotta AS, Kole S, Roth J, Montrose-Rafizadeh C, Bernier M. A synthetic peptides derived from a COOH-terminal domain of the insulin receptor specifically enhances insulin receptor signaling. Journal of Biological Chemistry. 1996;271(49):31619–31626. doi: 10.1074/jbc.271.49.31619. [DOI] [PubMed] [Google Scholar]
- 69.Sun H, Seyer JM, Patel TB. A region in the cytosolic domain of the epidermal growth factor receptor antithetically regulates the stimulatory and inhibitory guanine nucleotide-binding regulatory proteins of adenylyl cyclase. Proceedings of the National Academy of Sciences of the United States of America. 1995;92(6):2229–2233. doi: 10.1073/pnas.92.6.2229. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 70.Pagano M, Anand-Srivastava MB. Cytoplasmic domain of natriuretic peptide receptor C constitutes Gi activator sequences that inhibit adenylyl cyclase activity. Journal of Biological Chemistry. 2001;276(25):22064–22070. doi: 10.1074/jbc.M101587200. [DOI] [PubMed] [Google Scholar]
- 71.Zhou H, Murthy KS. Identification of the G protein-activating sequence of the single-transmembrane natriuretic peptide receptor C (NPR-C) American Journal of Physiology. 2003;284(5):1255–1261. doi: 10.1152/ajpcell.00520.2002. [DOI] [PubMed] [Google Scholar]
- 72.Hashim S, Li Y, Anand-Srivastava MB. Small cytoplasmic domain peptides of natriuretic peptide receptor-C attenuate cell proliferation through Gi α protein/MAP kinase/PI3-kinase/AKT pathways. American Journal of Physiology. 2006;291(6):3144–3153. doi: 10.1152/ajpheart.00327.2006. [DOI] [PubMed] [Google Scholar]
- 73.Hamm HE, Deretic D, Arendt A, Hargrave PA, Koenig B, Hofmann KP. Site of G protein binding to rhodopsin mapped with synthetic peptides from the α subunit. Science. 1988;241(4867):832–835. doi: 10.1126/science.3136547. [DOI] [PubMed] [Google Scholar]
- 74.Morizumi T, Imai H, Shichida Y. Two-step mechanism of interaction of rhodopsin intermediates with the C-terminal region of the transducin α-subunit. Journal of Biochemistry. 2003;134(2):259–267. doi: 10.1093/jb/mvg139. [DOI] [PubMed] [Google Scholar]
- 75.Angel TE, Kraft PC, Dratz EA. Metarhodopsin-II stabilization by crosslinked Gtα C-terminal peptides and implications for the mechanism of GPCR-G protein coupling. Vision Research. 2006;46(27):4547–4555. doi: 10.1016/j.visres.2006.08.015. [DOI] [PubMed] [Google Scholar]
- 76.Scheerer P, Park JH, Hildebrand PW, et al. Crystal structure of opsin in its G-protein-interacting conformation. Nature. 2008;455(7212):497–502. doi: 10.1038/nature07330. [DOI] [PubMed] [Google Scholar]
- 77.Mazzoni MR, Taddei S, Giusti L, et al. A Gα s carboxyl-terminal peptide prevents Gs activation by the A2A adenosine receptor. Molecular Pharmacology. 2000;58(1):226–236. doi: 10.1124/mol.58.1.226. [DOI] [PubMed] [Google Scholar]
- 78.Chen Y, Yoo B, Lee JB, Weng G, Iyengar R. The signal transfer regions of Gαs . Journal of Biological Chemistry. 2001;276(49):45751–45754. doi: 10.1074/jbc.M107191200. [DOI] [PubMed] [Google Scholar]
- 79.Vorherr T, Knöpfel L, Hofmann F, Mollner S, Pfeuffer T, Carafoli E. The calmodulin binding domain of nitric oxide synthase and adenylyl cyclase. Biochemistry. 1993;32(23):6081–6088. doi: 10.1021/bi00074a020. [DOI] [PubMed] [Google Scholar]
- 80.Diel S, Beyermann M, Lloréns JMN, Wittig B, Kleuss C. Two interaction sites on mammalian adenylyl cyclase type I and II: modulation by calmodulin and Gβγ . Biochemical Journal. 2008;411(2):449–456. doi: 10.1042/BJ20071204. [DOI] [PubMed] [Google Scholar]
- 81.Yoo B, Iyengar R, Chen Y. Functional analysis of the interface regions involved in interactions between the central cytoplasmic loop and the C-terminal tail of adenylyl cyclase. Journal of Biological Chemistry. 2004;279(14):13925–13933. doi: 10.1074/jbc.M314334200. [DOI] [PubMed] [Google Scholar]
- 82.Grubb DR, Vasilevski O, Huynh H, Woodcock EA. The extreme C-terminal region of phospholipase Cβ1 determines subcellular localization and function; the “b” splice variant mediates α 1-adrenergic receptor responses in cardiomyocytes. Federation of American Societies for Experimental Biology Journal. 2008;22(8):2768–2774. doi: 10.1096/fj.07-102558. [DOI] [PubMed] [Google Scholar]
- 83.Filtz TM, Grubb DR, McLeod-Dryden TJ, Luo J, Woodcock EA. Gq-initiated cardiomyocyte hypertrophy is mediated by phospholipase Cβ1b. Federation of American Societies for Experimental Biology Journal. 2009;23(10):3564–3570. doi: 10.1096/fj.09-133983. [DOI] [PubMed] [Google Scholar]
- 84.Hwang JI, Kim HS, Lee JR, Kim E, Ryu SH, Suh PG. The interaction of phospholipase C-β3 with Shank2 regulates mGluR-mediated calcium signal. Journal of Biological Chemistry. 2005;280(13):12467–12473. doi: 10.1074/jbc.M410740200. [DOI] [PubMed] [Google Scholar]
- 85.Komma MK, Yamasaki M, Ohmi S, Homma Y. Inhibition of phosphoinositide hydrolysis and cell growth of Swiss 3T3 cells by myristoylated phospholipase C inhibitor peptides. Journal of Biochemistry. 1997;122(4):738–742. doi: 10.1093/oxfordjournals.jbchem.a021817. [DOI] [PubMed] [Google Scholar]
- 86.Sidhu RS, Clough RR, Bhullar RP. Regulation of phospholipase C-δ1 through direct interactions with the small GTPase Ral and calmodulin. Journal of Biological Chemistry. 2005;280(23):21933–21941. doi: 10.1074/jbc.M412966200. [DOI] [PubMed] [Google Scholar]
- 87.Lai TH, Lin YF, Wu FC, Tsai YH. Follicle-stimulating hormone-induced Gα h/phospholipase C-δ1 signaling mediating a noncapacitative Ca2+ influx through T-type Ca+2 channels in rat sertoli cells. Endocrinology. 2008;149(3):1031–1037. doi: 10.1210/en.2007-1244. [DOI] [PubMed] [Google Scholar]
- 88.Ching TT, Lin HP, Yang CC, Oliveira M, Lu PJ, Chen CS. Specific binding of the C-terminal Src homology 2 domain of the p85α subunit of phosphoinositide 3-kinase to phosphatidylinositol 3,4,5-trisphosphate: localization and engineering of the phosphoinositide-binding motif. Journal of Biological Chemistry. 2001;276(47):43932–43938. doi: 10.1074/jbc.M105159200. [DOI] [PubMed] [Google Scholar]
- 89.Krotova K, Hu H, Xia SL, et al. Peptides modified by myristoylation activate eNOS in endothelial cells through Akt phosphorylation. British Journal of Pharmacology. 2006;148(5):732–740. doi: 10.1038/sj.bjp.0706777. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 90.Lee NH, Geoghagen NSM, Cheng E, Cline RT, Fraser CM. Alanine scanning mutagenesis of conserved arginine/lysine-arginine/lysine-XX-arginine/lysine G protein-activating motifs on m1 muscarinic acetylcholine receptors. Molecular Pharmacology. 1996;50(1):140–148. [PubMed] [Google Scholar]
- 91.Shpakov AO. Involvement of charged amino acid residues of cytoplasmic loops of serpentine type receptors in the process of hormone signal transduction. Zhurnal Evoliutsionnoi Biokhimii i Fiziologii. 2003;39(3):205–217. [PubMed] [Google Scholar]
- 92.Conklin BR, Farfel Z, Lustig KD, Julius D, Bourne HR. Substitution of three amino acids switches receptor specificity of Gq α to that of Gi α . Nature. 1993;363(6426):274–276. doi: 10.1038/363274a0. [DOI] [PubMed] [Google Scholar]
- 93.Lambright DG, Sondek J, Bohm A, Skiba NP, Hamm HE, Sigler PB. The 2.0 A crystal structure of a heterotrimeric G protein. Nature. 1996;379(6563):311–319. doi: 10.1038/379311a0. [DOI] [PubMed] [Google Scholar]
- 94.Slessareva JE, Ma H, Depree KM, et al. Closely related G-protein-coupled receptors use multiple and distinct domains on G-protein α subunits for selective coupling. Journal of Biological Chemistry. 2003;278(50):50530–50536. doi: 10.1074/jbc.M304417200. [DOI] [PubMed] [Google Scholar]
- 95.Bae H, Cabrera-Vera TM, Depree KM, Graber SG, Hamm HE. Two amino acids within the helix of Gα i1 mediate coupling with 5- hydroxytryptamine1B receptors. Journal of Biological Chemistry. 1999;274(21):14963–14971. doi: 10.1074/jbc.274.21.14963. [DOI] [PubMed] [Google Scholar]
- 96.Muramatsu T, Suwa M. Statistical analysis and prediction of functional residues effective for GPCR-G-protein coupling selectivity. Protein Engineering, Design and Selection. 2006;19(6):277–283. doi: 10.1093/protein/gzl010. [DOI] [PubMed] [Google Scholar]
- 97.Covic L, Gresser AL, Talavera J, Swift S, Kuliopulos A. Activation and inhibition of G protein-coupled receptors by cell-penetrating membrane-tethered peptides. Proceedings of the National Academy of Sciences of the United States of America. 2002;99(2):643–648. doi: 10.1073/pnas.022460899. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 98.Covic L, Misra M, Badar J, Singh C, Kuliopulos A. Pepducin-based intervention of thrombin-receptor signaling and systemic platelet activation. Nature Medicine. 2002;8(10):1161–1165. doi: 10.1038/nm760. [DOI] [PubMed] [Google Scholar]
- 99.Light T, Tsirulnikov L, Reuveni H, Yarnitzky T, Ben-Sasson SA. Induction of pro-angiogenic signaling by a synthetic peptide derived from the second intracellular loop of S1P3 (EDG3) Blood. 2003;102(6):2099–2107. doi: 10.1182/blood-2002-12-3634. [DOI] [PubMed] [Google Scholar]
- 100.Kaneider NC, Agarwal A, Leger AJ, Kuliopulos A. Reversing systemic inflammatory response syndrome with chemokine receptor pepducins. Nature Medicine. 2005;11(6):661–665. doi: 10.1038/nm1245. [DOI] [PubMed] [Google Scholar]
- 101.Swift S, Leger AJ, Talavera J, Zhang L, Bohm A, Kuliopulos A. Role of the PAR1 receptor 8th helix in signaling: the 7-8-1 receptor activation mechanism. Journal of Biological Chemistry. 2006;281(7):4109–4116. doi: 10.1074/jbc.M509525200. [DOI] [PubMed] [Google Scholar]
- 102.Edwards RJ, Moran N, Devocelle M, et al. Bioinformatic discovery of novel bioactive peptides. Nature Chemical Biology. 2007;3(2):108–112. doi: 10.1038/nchembio854. [DOI] [PubMed] [Google Scholar]
- 103.Majumdar M, Tarui T, Shi B, Akakura N, Ruf W, Takada Y. Plasmin-induced migration requires signaling through protease-activated receptor 1 and integrin α 9 β 1 . Journal of Biological Chemistry. 2004;279(36):37528–37534. doi: 10.1074/jbc.M401372200. [DOI] [PubMed] [Google Scholar]
- 104.Boire A, Covic L, Agarwal A, Jacques S, Sherifi S, Kuliopulos A. PAR1 is a matrix metalloprotease-1 receptor that promotes invasion and tumorigenesis of breast cancer cells. Cell. 2005;120(3):303–313. doi: 10.1016/j.cell.2004.12.018. [DOI] [PubMed] [Google Scholar]
- 105.Kaneider NC, Leger AJ, Agarwal A, et al. ‘Role reversal’ for the receptor PAR1 in sepsis-induced vascular damage. Nature Immunology. 2007;8(12):1303–1312. doi: 10.1038/ni1525. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Leger AJ, Jacques SL, Badar J, et al. Blocking the protease-activated receptor 1–4 heterodimer in platelet-mediated thrombosis. Circulation. 2006;113(9):1244–1254. doi: 10.1161/CIRCULATIONAHA.105.587758. [DOI] [PubMed] [Google Scholar]
- 107.Remsberg JR, Lou H, Tarasov SG, Dean M, Tarasova NI. Structural analogues of smoothened intracellular loops as potent inhibitors of Hedgehog pathway and cancer cell growth. Journal of Medicinal Chemistry. 2007;50(18):4534–4538. doi: 10.1021/jm0705657. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 108.Agarwal A, Covic L, Sevigny LM, et al. Targeting a metalloprotease-PAR1 signaling system with cell-penetrating pepducins inhibits angiogenesis, ascites, and progression of ovarian cancer. Molecular Cancer Therapeutics. 2008;7(9):2746–2757. doi: 10.1158/1535-7163.MCT-08-0177. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Trivedi V, Boire A, Tchernychev B, et al. Platelet matrix metalloprotease-1 mediates thrombogenesis by activating PAR1 at a cryptic ligand site. Cell. 2009;137(2):332–343. doi: 10.1016/j.cell.2009.02.018. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.Hollenberg MD, Saifeddine M, Sandhu S, Houle S, Vergnolle N. Proteinase-activated receptor-4: evaluation of tethered ligand-derived peptides as probes for receptor function and as inflammatory agonists in vivo . British Journal of Pharmacology. 2004;143(4):443–454. doi: 10.1038/sj.bjp.0705946. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 111.Slofstra SH, Bijlsma MF, Groot AP, et al. Protease-activated receptor-4 inhibition protects from multiorgan failure in a murine model of systemic inflammation. Blood. 2007;110(9):3176–3182. doi: 10.1182/blood-2007-02-075440. [DOI] [PubMed] [Google Scholar]
- 112.Kubo S, Ishiki T, Doe I, et al. Distinct activity of peptide mimetic intracellular ligands (pepducins) for proteinase-activated receptor-1 in multiple cells/tissues. Annals of the New York Academy of Sciences. 2006;1091:445–459. doi: 10.1196/annals.1378.087. [DOI] [PubMed] [Google Scholar]
- 113.Derian CK, Damiano BP, Addo MF, et al. Blockade of the thrombin receptor protease-activated receptor-1 with a small-molecule antagonist prevents thrombus formation and vascular occlusion in nonhuman primates. Journal of Pharmacology and Experimental Therapeutics. 2003;304(2):855–861. doi: 10.1124/jpet.102.042663. [DOI] [PubMed] [Google Scholar]
- 114.Smyth SS, Woulfe DS, Weitz JI, et al. G-protein-coupled receptors as signaling targets for antiplatelet therapy. Arteriosclerosis, Thrombosis, and Vascular Biology. 2009;29:449–457. doi: 10.1161/ATVBAHA.108.176388. [DOI] [PubMed] [Google Scholar]
- 115.Wielders SJ, Bennaghmouch A, Reutelingsperger CP, Bevers EM, Lindhout T. Anticoagulant and antithrombotic properties of intracellular protease-activated receptor antagonists. Journal of Thrombosis and Haemostasis. 2007;5:571–576. doi: 10.1111/j.1538-7836.2007.02364.x. [DOI] [PubMed] [Google Scholar]
- 116.Kreuzer J, Nürnberg B, Krieger-Brauer HI. Ligand-dependent autophosphorylation of the insulin receptor is positively regulated by Gi-proteins. Biochemical Journal. 2004;380(3):831–836. doi: 10.1042/BJ20031659. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 117.Okamoto T, Okamoto T, Murayama Y, Hayashi Y, Ogata E, Nishimoto I. GTP-binding protein-activator sequences in the insulin receptor. Federation of the Societies of Biochemistry and Molecular Biology Letters. 1993;334(1):143–148. doi: 10.1016/0014-5793(93)81700-a. [DOI] [PubMed] [Google Scholar]
- 118.Jo H, Radding W, Anantharamaiah GM, McDonald JM. An insulin receptor peptide (1135–1156) stimulates guanosine 5’-[γ-thio]triphosphate binding to the 67 kDa G-protein associated with the insulin receptor. Biochemical Journal. 1993;294(1):19–24. doi: 10.1042/bj2940019. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 119.Plesneva SA, Shpakov AO, Kuznetsova LA, Pertseva MN. A dual role of protein kinase C in insulin signal transduction via adenylyl cyclase signaling system in muscle tissues of vertebrates and invertebrates. Biochemical Pharmacology. 2001;61(10):1277–1291. doi: 10.1016/s0006-2952(01)00592-5. [DOI] [PubMed] [Google Scholar]
- 120.Liotta AS, Kole HK, Fales HM, Roth J, Bernier M. A synthetic tris-sulfotyrosyl dodecapeptide analogue of the insulin receptor 1146-kinase domain inhibits tyrosine dephosphorylation of the insulin receptor in situ. Journal of Biological Chemistry. 1994;269(37):22996–23001. [PubMed] [Google Scholar]
- 121.Bernier M, Kole HK, Montrose-Rafizadeh C, Kole S. Discrete region of the insulin receptor carboxyl terminus plays key role in insulin action. Journal of Cellular Biochemistry. 2000;78(1):160–169. doi: 10.1002/(sici)1097-4644(20000701)78:1<160::aid-jcb15>3.0.co;2-g. [DOI] [PubMed] [Google Scholar]
- 122.Kaliman P, Baron V, Alengrin F, et al. The insulin receptor C-terminus is involved in regulation of the receptor kinase activity. Biochemistry. 1993;32:9539–9544. doi: 10.1021/bi00088a004. [DOI] [PubMed] [Google Scholar]
- 123.Baron V, Kaliman P, Alengrin F, Van Obberghen E. Interaction of the C-terminal acidic domain of the insulin receptor with histone modulates the receptor kinase activity. European Journal of Biochemistry. 1995;229(1):27–34. doi: 10.1111/j.1432-1033.1995.tb20433.x. [DOI] [PubMed] [Google Scholar]
- 124.Gual P, Baron V, Alengrin F, Mothe I, Van Obberghen E. Insulin receptor-induced phosphorylation of cellular and synthetic substrates is regulated by the receptor β-subunit C-terminus. Endocrinology. 1996;137(8):3416–3423. doi: 10.1210/endo.137.8.8754769. [DOI] [PubMed] [Google Scholar]
- 125.Lee CS, Kim KL, Jang JH, Choi YS, Suh PG, Ryu SH. The roles of phospholipase D in EGFR signaling. Biochimica et Biophysica Acta. 2009;1791:862–868. doi: 10.1016/j.bbalip.2009.04.007. [DOI] [PubMed] [Google Scholar]
- 126.Dhanasekaran DN. Transducing the signals: a G protein takes a new identity. Science’s: Signal Transduction Knowledge Environment. 2006;2006(347):p. pe31. doi: 10.1126/stke.3472006pe31. [DOI] [PubMed] [Google Scholar]
- 127.Cao C, Huang X, Han Y, et al. Gα i1 and Gα i3 are required for epidermal growth factor-mediated activation of the Akt-mTORC1 pathway. Science Signaling. 2009;2(68):p. ra17. doi: 10.1126/scisignal.2000118. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 128.Schulze WX, Mann M. A novel proteomic screen for peptide-protein interactions. Journal of Biological Chemistry. 2004;279(11):10756–10764. doi: 10.1074/jbc.M309909200. [DOI] [PubMed] [Google Scholar]
- 129.Schulze WX, Deng L, Mann M. Phosphotyrosine interactome of the ErbB-receptor kinase family. Molecular Systems Biology. 2005;1:p. 2005.0008. doi: 10.1038/msb4100012. Article ID 10.1038/msb4100012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 130.Mouawad R, Li Y, Anand-Srivastava MB. Atrial natriuretic peptide-C receptor-induced attenuation of adenylyl cyclase signaling activates phosphatidylinositol turnover in A10 vascular smooth muscle cells. Molecular Pharmacology. 2004;65(4):917–924. doi: 10.1124/mol.65.4.917. [DOI] [PubMed] [Google Scholar]
- 131.Anand-Srivastava MB, Sehl PD, Lowe DG. Cytoplasmic domain of natriuretic peptide receptor-C inhibits adenylyl cyclase. Involvement of a pertussis toxin-sensitive G protein. Journal of Biological Chemistry. 1996;271(32):19324–19329. doi: 10.1074/jbc.271.32.19324. [DOI] [PubMed] [Google Scholar]
- 132.Murthy KS, Makhlouf GM. Identification of the G protein-activating domain of the natriuretic peptide clearance receptor (NPR-C) Journal of Biological Chemistry. 1999;274(25):17587–17592. doi: 10.1074/jbc.274.25.17587. [DOI] [PubMed] [Google Scholar]
- 133.Okamoto T, Katada T, Murayama Y, Ui M, Ogata E, Nishimoto I. A simple structure encodes G protein-activating function of the IGF-II/mannose 6-phosphate receptor. Cell. 1990;62(4):709–717. doi: 10.1016/0092-8674(90)90116-v. [DOI] [PubMed] [Google Scholar]
- 134.Offermanns S. G-proteins as transducers in transmembrane signalling. Progress in Biophysics and Molecular Biology. 2003;83(2):101–130. doi: 10.1016/s0079-6107(03)00052-x. [DOI] [PubMed] [Google Scholar]
- 135.Van Eps N, Anderson LL, Kisselev OG, Baranski TJ, Hubbell WL, Marshall GR. Electron paramagnetic resonance studies of functionally active, nitroxide spin-labeled peptide analogues of the C-terminus of a G-protein α subunit. Biochemistry. 2010;49(32):6877–6886. doi: 10.1021/bi100846c. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 136.Hofmann KP. Signalling states of photoactivated rhodopsin. Novartis Foundation Symposium. 1999;224:158–175. doi: 10.1002/9780470515693.ch10. [DOI] [PubMed] [Google Scholar]
- 137.Acharya S, Saad Y, Karnik SS. Transducin-α C-terminal peptide binding site consists of C-D and E-F loops of rhodopsin. Journal of Biological Chemistry. 1997;272(10):6519–6524. doi: 10.1074/jbc.272.10.6519. [DOI] [PubMed] [Google Scholar]
- 138.Kisselev OG, Kao J, Ponder JW, Fann YC, Gautam N, Marshall GR. Light-activated rhodopsin induces structural binding motif in G protein α subunit. Proceedings of the National Academy of Sciences of the United States of America. 1998;95(8):4270–4275. doi: 10.1073/pnas.95.8.4270. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 139.Koenig BW, Kontaxis G, Mitchell DC, Louis JM, Litman BJ, Bax A. Structure and orientation of a G protein fragment in the receptor bound state from residual dipolar couplings. Journal of Molecular Biology. 2002;322(2):441–461. doi: 10.1016/s0022-2836(02)00745-3. [DOI] [PubMed] [Google Scholar]
- 140.Fahmy K. Binding of transducin and transducin-derived peptides to rhodopsin studies by attenuated total reflection-Fourier transform infrared difference spectroscopy. Biophysical Journal. 1998;75(3):1306–1318. doi: 10.1016/s0006-3495(98)74049-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 141.Aris L, Gilchrist A, Rens-Domiano S, et al. Structural requirements for the stabilization of metarhodopsin II by the C terminus of the α subunit of transducin. Journal of Biological Chemistry. 2001;276(4):2333–2339. doi: 10.1074/jbc.M002533200. [DOI] [PubMed] [Google Scholar]
- 142.Martin EL, Rens-Domiano S, Schatz PJ, Hamm HE. Potent peptide analogues of a G protein receptor-binding region obtained with a combinatorial library. Journal of Biological Chemistry. 1996;271(1):361–366. doi: 10.1074/jbc.271.1.361. [DOI] [PubMed] [Google Scholar]
- 143.Rasenick MM, Watanabe M, Lazarevic MB, Hatta S, Hamm HE. Synthetic peptides as probes for G protein function. Carboxyl-terminal Gα s peptides mimic G2 and evoke high affinity agonist binding to β-adrenergic receptors. Journal of Biological Chemistry. 1994;269(34):21519–21525. [PubMed] [Google Scholar]
- 144.Novotny J, Gustafson B, Ransnas LA. Inhibition of β-adrenergic receptor-mediated signals by a synthetic peptide derived from the α subunit of the stimulatory G-protein. Biochemical and Biophysical Research Communications. 1996;219:619–624. doi: 10.1006/bbrc.1996.0283. [DOI] [PubMed] [Google Scholar]
- 145.Chang M, Zhang L, Tam JP, Sanders-Bush E. Dissecting G protein-coupled receptor signaling pathways with membrane-permeable blocking peptides. Endogenous 5-HT2C receptors in choroid plexus epithelial cells. Journal of Biological Chemistry. 2000;275(10):7021–7029. doi: 10.1074/jbc.275.10.7021. [DOI] [PubMed] [Google Scholar]
- 146.Feldman DS, Zamah AM, Pierce KL, et al. Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Gα s carboxyl terminus. Journal of Biological Chemistry. 2002;277(32):28631–28640. doi: 10.1074/jbc.M204753200. [DOI] [PubMed] [Google Scholar]
- 147.Grieco P, Albrizio S, D’Ursi AM, et al. A structure-activity relationship study on position-2 of the Gα s C-terminal peptide able to inhibit Gs activation by A2A adenosine receptor. European Journal of Medicinal Chemistry. 2003;38(1):13–18. doi: 10.1016/s0223-5234(02)00010-7. [DOI] [PubMed] [Google Scholar]
- 148.Shpakov AO, Gur’ianov IA, Kuznetsova LA, et al. The using of C-terminal peptides of G protein α-subunits for the study of their functional coupling with receptors of biogenic amines in rat and mollusk tissues. Journal of Membrane Biology. 2004;21:441–450. (Rus). [Google Scholar]
- 149.Shpakov AO, Korolkov VI, Plesneva SA, Kuznetsova LA, Pertseva MN. Effects of the C-terminal peptide of the α s subunit of the G protein on the regulation of adenylyl cyclase and protein kinase A activities by biogenic amines and glucagon in mollusk and rat muscles. Neuroscience and Behavioral Physiology. 2005;35:177–186. doi: 10.1007/s11055-005-0066-5. [DOI] [PubMed] [Google Scholar]
- 150.Shpakov AO, Shipilov VN, Bondareva VM. Sensitivity of adenylyl cyclase signaling system of the mollusk A. cygnea ganglions to serotonin and adrenergic agonists. Annals of the New York Academy of Sciences. 2005;1040:466–468. doi: 10.1196/annals.1327.092. [DOI] [PubMed] [Google Scholar]
- 151.D’Ursi AM, Giusti L, Albrizio S, et al. A membrane-permeable peptide containing the last 21 residues of the Gα s carboxyl terminus inhibits Gs-coupled receptor signaling in intact cells: correlations between peptide structure and biological activity. Molecular Pharmacology. 2006;69(3):727–736. doi: 10.1124/mol.105.017715. [DOI] [PubMed] [Google Scholar]
- 152.Sunahara RK, Tesmer JJG, Gilman AG, Sprang SR. Crystal structure of the adenylyl cyclase activator Gsα . Science. 1997;278(5345):1943–1947. doi: 10.1126/science.278.5345.1943. [DOI] [PubMed] [Google Scholar]
- 153.Albrizio S, D’Ursi A, Fattorusso C, et al. Conformational studies on a synthetic C-terminal fragment of the α subunit of Gs proteins. Biopolymers. 2000;54(3):186–194. doi: 10.1002/1097-0282(200009)54:3<186::AID-BIP50>3.0.CO;2-2. [DOI] [PubMed] [Google Scholar]
- 154.Gilchrist A, Bünemann M, Li A, Hosey MM, Hamm HE. A dominant-negative strategy for studying roles of G proteins in vivo . Journal of Biological Chemistry. 1999;274(10):6610–6616. doi: 10.1074/jbc.274.10.6610. [DOI] [PubMed] [Google Scholar]
- 155.Gilchrist A, Vanhauwe JF, Li A, Thomas TO, Voyno-Yasenetskaya T, Hamm HE. Gα minigenes expressing C-terminal peptides serves as specific inhibitors of thrombin-mediated endothelial activation. Journal of Biological Chemistry. 2001;276(28):25672–25679. doi: 10.1074/jbc.M100914200. [DOI] [PubMed] [Google Scholar]
- 156.Vanhauwe JF, Thomas TO, Minshall RD, et al. Thrombin receptors activate Go proteins in endothelial cells to regulate intracellular calcium and cell shape changes. Journal of Biological Chemistry. 2002;277(37):34143–34149. doi: 10.1074/jbc.M204477200. [DOI] [PubMed] [Google Scholar]
- 157.Chillar A, Wu J, Cervantes V, Ruan KH. Structural and functional analysis of the C-terminus of Gα q in complex with the human thromboxane A2 receptor provides evidence of constitutive activity. Biochemistry. 2010;49(30):6365–6374. doi: 10.1021/bi100047n. [DOI] [PubMed] [Google Scholar]
- 158.Shpakov AO, Gur’ianov IA, Avdeeva EV, Vorob’ev VI, Vlasov GP. Molecular mechanisms of action of dendrons, containing 48–60 sequence of HIV-1 TAT-protein, on the functional activity of the adenylyl cyclase signaling systems. Tsitologiia. 2004;46(11):1011–1022. (Rus). [PubMed] [Google Scholar]
- 159.Shpakov AO, Gur’ianov IA, Vlasov GP, Pertseva MN. The molecular mechanisms of the interaction of polycationic peptides with the serpentine type receptors and the heterotrimeric G proteins in rat tissues. Journal of Evolutionary Biochemistry and Physiology. 2006;42:321–327. [PubMed] [Google Scholar]
- 160.Shpakov AO, Gur’yanov IA, Bayanova NV, Vlasov GP. Receptor of the serpentine type and heterotrimeric G protein as targets of action of polylysine dendrimers. Cell and Tissue Biology. 2009;3(1):14–22. [Google Scholar]
- 161.Grishina G, Berlot CH. Identification of common and distinct residues involved in the interaction of α i2 and α s with adenylyl cyclase. Journal of Biological Chemistry. 1997;272(33):20619–20626. doi: 10.1074/jbc.272.33.20619. [DOI] [PubMed] [Google Scholar]
- 162.Rebecchi MJ, Pentyala SN. Structure, function, and control of phosphoinositide-specific phospholipase C. Physiological Reviews. 2000;80(4):1291–1335. doi: 10.1152/physrev.2000.80.4.1291. [DOI] [PubMed] [Google Scholar]
- 163.Litosch I. Novel mechanisms for feedback regulation of phospholipase C-β activity. International Union of Biochemistry and Molecular Biology Life. 2002;54(5):253–260. doi: 10.1080/15216540215673. [DOI] [PubMed] [Google Scholar]
- 164.Akhter SA, Luttrell LM, Rockman HA, Iaccarino G, Lefkowitz RJ, Koch WJ. Targeting the receptor-Gq interface to inhibit in vivo pressure overload myocardial hypertrophy. Science. 1998;280(5363):574–577. doi: 10.1126/science.280.5363.574. [DOI] [PubMed] [Google Scholar]
- 165.Wettschureck N, Rütten H, Zywietz A, et al. Absence of pressure overload induced myocardial hypertrophy after conditional inactivation of Gα q/Gα 11 in cardiomyocytes. Nature Medicine. 2001;7(11):1236–1240. doi: 10.1038/nm1101-1236. [DOI] [PubMed] [Google Scholar]
- 166.Sankaran B, Osterhout J, Wu D, Smrcka AV. Identification of a structural element in phospholipase C β2 that interacts with G protein βγ . Journal of Biological Chemistry. 1998;273(12):7148–7154. doi: 10.1074/jbc.273.12.7148. [DOI] [PubMed] [Google Scholar]
- 167.Lin YF, Tseng MJ, Hsu HL, Wu YW, Lee YH, Tsai YH. A novel follicle-stimulating hormone-induced Gα h/phospholipase C-δ1 signaling pathway mediating rat Sertoli cell Ca2+-influx. Molecular Endocrinology. 2006;20(10):2514–2527. doi: 10.1210/me.2005-0347. [DOI] [PubMed] [Google Scholar]
- 168.Patterson RL, van Rossum DB, Nikolaidis N, Gill DL, Snyder SH. Phospholipase C-γ: diverse roles in receptor-mediated calcium signaling. Trends in Biochemical Sciences. 2005;30(12):688–697. doi: 10.1016/j.tibs.2005.10.005. [DOI] [PubMed] [Google Scholar]
- 169.Homma Y, Takenawa T. Inhibitory effect of src homology (SH) 2/SH3 fragments of phospholipase C- γ on the catalytic activity of phospholipase C isoforms. Journal of Biological Chemistry. 1992;267(30):21844–21849. [PubMed] [Google Scholar]
- 170.Homma Y. Suppression of membrane phospholipase C activity by synthetic autoinhibitor peptides. Methods: Companion to Methods in Enzymology. 1993;5:229–232. [Google Scholar]
- 171.Hawkins PT, Anderson KE, Davidson K, Stephens LR. Signalling through Class I PI3Ks in mammalian cells. Biochemical Society Transactions. 2006;34(5):647–662. doi: 10.1042/BST0340647. [DOI] [PubMed] [Google Scholar]
- 172.Newton AC. Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions. Chemical Reviews. 2001;101(8):2353–2364. doi: 10.1021/cr0002801. [DOI] [PubMed] [Google Scholar]
- 173.Roffey J, Rosse C, Linch M, Hibbert A, McDonald NQ, Parker PJ. Protein kinase C intervention: the state of play. Current Opinion in Cell Biology. 2009;21(2):268–279. doi: 10.1016/j.ceb.2009.01.019. [DOI] [PubMed] [Google Scholar]
- 174.Eichholtz T, de Bont DBA, de Widt J, Liskamp RMJ, Ploegh HL. A myristoylated pseudosubstrate peptide, a novel protein kinase C inhibitor. Journal of Biological Chemistry. 1993;268(3):1982–1986. [PubMed] [Google Scholar]
- 175.Persaud SJ. Protein kinase C signalling in pancreatic β-cells: cellular and molecular approaches. Digestion. 1997;58(2):86–92. doi: 10.1159/000201550. [DOI] [PubMed] [Google Scholar]
- 176.Disatnik MH, Boutet SC, Lee CH, Mochly-Rosen D, Rando TA. Sequential activation of individual PKC isozymes in integrin-mediated muscle cell spreading: a role for MARCKS in an integrin signaling pathway. Journal of Cell Science. 2002;115(10):2151–2163. doi: 10.1242/jcs.115.10.2151. [DOI] [PubMed] [Google Scholar]
- 177.Harishchandran A, Nagaraj R. Interaction of a pseudosubstrate peptide of protein kinase C and its myristoylated form with lipid vesicles: only the myristoylated form translocates into the lipid bilayer. Biochimica et Biophysica Acta. 2005;1713:73–82. doi: 10.1016/j.bbamem.2005.05.008. [DOI] [PubMed] [Google Scholar]
- 178.Spyridopoulos I, Luedemann C, Chen D, et al. Divergence of angiogenic and vascular permeability signaling by VEGF: inhibition of protein kinase C suppresses VEGF-induced angiogenesis, but promotes VEGF-induced, NO-dependent vascular permeability. Arteriosclerosis, Thrombosis, and Vascular Biology. 2002;22:901–906. doi: 10.1161/01.atv.0000020006.89055.11. [DOI] [PubMed] [Google Scholar]
- 179.Shpakov A, Pertseva M, Kuznetsova L, Plesneva S. A novel, adenylate cyclase, signaling mechanism of relaxin H2 action. Annals of the New York Academy of Sciences. 2005;1041:305–307. doi: 10.1196/annals.1282.046. [DOI] [PubMed] [Google Scholar]
- 180.Cunha FM, Berti DA, Ferreira ZS, Klitzke CF, Markus RP, Ferro ES. Intracellular peptides as natural regulators of cell signaling. Journal of Biological Chemistry. 2008;283(36):24448–24459. doi: 10.1074/jbc.M801252200. [DOI] [PMC free article] [PubMed] [Google Scholar]
