Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2013 Feb 17.
Published in final edited form as: ACS Chem Biol. 2011 Dec 30;7(2):395–402. doi: 10.1021/cb2003412

Agouti-Related Protein Segments Outside of the Receptor Binding Core are Required for Enhanced Short and Long Term Feeding Stimulation

Michael E Madonna 1, Jennifer Schurdak 2, Ying-kui Yang 3, Stephen Benoit 2, Glenn L Millhauser 1,*
PMCID: PMC3288358  NIHMSID: NIHMS347271  PMID: 22129136

Abstract

The Agouti-Related Protein (AgRP) plays a central role in energy balance by reducing signaling through the hypothalamic melanocortin receptors (McRs) 3 and 4, in turn stimulating feeding and decreasing energy expenditure. Mature AgRP(83-132), produced by endoproteolytic processing, contains a central region that folds as an inhibitor cystine knot (ICK) stabilized by a network of disulfide bonds; this domain alone carries the molecular features for high affinity McR binding and inverse agonism. Outside of the ICK domain are two polypeptide segments – an N-terminal extension and a C-terminal loop – both completely conserved but of unknown function. Here we examine the physiological roles of these non-ICK segments by developing a panel of modified AgRPs that were administered to rats through intracerebroventricular (ICV) injection. Analysis of food consumption demonstrates that basic (positively charged) residues are essential for potent short and long term AgRP stimulated feeding. Moreover, we demonstrate an approximate linear relationship between protein charge density and 24 hr food intake. Next, we developed artificial AgRP(83-132) analogs with increased positive charge and found that these species were substantially more potent than wild type. A single dose of one protein, designated AgRP-4K, results in enhanced feeding for well over a week and weight gain that is nearly double that of AgRP(83-132). These studies suggest new strategies for the development of potent orexigenic species, and may serve as leads for the development of therapeutics for treating wasting conditions such as cachexia.


The agouti-related protein (AgRP) is produced in the hypothalamus and acts to stimulate feeding and decrease energy expenditure (1, 2). AgRP is a high affinity inverse agonist of the melanocortin 3 and 4 receptors (Mc3R and Mc4R), members of the G-protein coupled receptor (GPCR) superfamily. Transgenic mice that overexpress AgRP exhibit increased feeding, profound weight gain and metabolic imbalances often associated with diabetes (3). In humans, AgRP plasma levels correlate with body mass (4), while certain polymorphisms predispose individuals to anorexia nervosa (5, 6). Because of its potency in stimulating feeding, leading to weight gain, AgRP and its mimetics are considered prime therapeutic leads in the treatment of cachexia, the wasting condition associated with cancer and AIDS (7).

There are a number of designed ligands that stimulate feeding, including SHU9119, THP, MBP10, and NBI-30 (8), but none are more potent after a single low dose administration than AgRP. Moreover, AgRP's effects are prolonged. A single intracerebroventricular (ICV) AgRP injection produces enhanced feeding for up to seven days (9). And animals receiving a dose of AgRP followed 24 hours later by administration of MTII (a melanocortin agonist), return to elevated feeding levels at 48 hours (24 hours after agonist injection) (10).

AgRP is produced as a 132 amino acid pro-protein that undergoes proprotein convertase (PC 1/3) cleavage, following residue 82, to release its cysteine-rich C-terminal domain (Table 1) (11, 12). The ten cysteine residues within AgRP(83-132) form a network of five disulfide bonds, as shown in Figure 1 (13). Structure determination by NMR demonstrates that residues 87-120 adopt an inhibitor cystine knot (ICK) fold, a scaffold previously found exclusively in invertebrate toxins (13). AgRP is homologous to the agouti signaling protein (ASIP), which is expressed in the skin and controls pigmentation by suppressing signaling through Mc1R. Both proteins share the ICK core region in their respective C-terminal domains (14). In contrast to AgRP, however, the ASIP N-terminal domain is retained and binds to attractin, an interaction that is essential for in vivo function (15).

Table 1.

Agouti Related Protein Sequences

N-term Inhibitor Cystine Knot Core C-Term Loop
Human (83-132) SSRR CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RKLGTAMNPCSRT
Cow SPRR CVRLHESCLGHQVPCCDPCATCYCRFFNAFCYC RKLGTTTNPCSRT
Mouse SPRR CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RKLGTATNLCSRT
Rat SPRR CVRLHESCLGQQVPCCDLCATCYCRFFNTFCYC RKLGTGTTNLCSRP
Pig SPRR CVRLHESCLGHQVPCCDPCATCYCRFFNAFCYC RKLGTATNPCSRT
Sheep SPRR CVRLHESCLGHQVPCCDPCATCYCRFFNAFCYC RKLGTTT
Designed AgRP Sequences
AgRP(83-120) SSRR CVRLHESCLGQQVPCCDPAATCYCRFFNAFCYC R
AgRP(87-132) CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RKLGTAMNPCSRT
AgRP(87-120) CVRLHESCLGQQVPCCDPAATCYCRFFNAFCYC R
AgRP-2Q SSRR CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RQLGTAMNPCSQT
AgRP-4Q SSQQ CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RQLGTAMNPCSQT
AgRP-2K SSRR CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RKLKTKMNPCSRT
AgRP-4K KKRR CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC RKLKTKMNPCSRT

Basic residues in the N-terminal segment and C-terminal loop are shown in blue.

Figure 1.

Figure 1

Schematic of ASIP and AgRP structure/function. The sequence diagram (above) illustrates homologous regions of the two proteins and corresponding functional domains. Question marks indicate the two regions of AgRP of conserved but otherwise unknown function. Structure of AgRP(83-132) (below) illustrates the spatial location of the different regions.

In addition to Mc1R binding, ASIP is also capable of high affinity interactions with Mc3R and Mc4R, as demonstrated by the obese phenotype in the lethal yellow Ay/a mouse (3). In contrast, AgRP binds exclusively to Mc3R and Mc4R (2). We recently reported a study using a panel of ASIP/AgRP chimeras with the goal of identifying the specific features in ASIP required for Mc1R affinity (16). We found that the ASIP C-terminal loop, just past the ICK core, was critical for Mc1R recognition. Moreover, grafting this loop onto the AgRP ICK core resulted in a protein with a Mc1R Kd of approximately 30 nM. As shown in Figure 1, these studies now complete the characterization of ASIP's functional domains.

In contrast, the functions of the polypeptide segments outside of AgRP's ICK core are unknown (Figure 1). The four residue segment preceding the ICK core (Ser-Ser-Arg-Arg) and the 13 residue C-terminal loop are both highly conserved among mammals (Table 1), yet deletion of these segments has absolutely no affect on the Mc3R or Mc4R binding affinities or in vitro activity (17). Specifically, a mini protein composed of just the AgRP ICK core, residues 87-120, possesses approximately the same Mc3R and Mc4R affinity as AgRP(87-132) (17) and AgRP(83-132) (18), and exhibits equivalent inverse agonism (19). AgRP is a strongly cationic protein, and interestingly, five of the seven positively charge amino acids are located in the regions outside of the ICK core (defined by the first and last Cys residues).

To address the functional significance of the segments outside of the ICK core domain in mature AgRP(83-132) (Figure 1), we performed ICV experiments on Long-Evans rats using a panel of AgRP variants in which select non-ICK components are deleted. We find a remarkable relationship between long term feeding enhancement and net AgRP positive charge, carried mainly by the non-ICK segments. Next, we developed a series of novel AgRP constructs where charge is selectively varied. ICV experiments with these constructs not only supports the charge-feeding relationship, but also lead to the discovery of an AgRP analog that significantly increases initial and long term feeding relative to the wild type protein. Together, these studies demonstrate a critical physiological role for the non-ICK AgRP segments, and suggest new strategies in the development of reagents for treating cachexia and other conditions associated with negative energy balance.

Results and Discussion

Truncated AgRP Variants

ICV injection of AgRP variants was used to assess the physiological role of the protein segments outside of the ICK core, comprising the receptor binding domain (Figure 1). Initial experiments focused on truncated forms of mature AgRP(83-132) (Table 1). The minimal construct AgRP(87-120) was designed and investigated in a previous study (17). Briefly, this protein lacks both the four residue segment before the ICK domain, and the C-terminal loop. Simple elimination of the C-terminal loop leaves an uncompensated Cys residue at position 105. To avoid the formation of non-native disulfide bonds, residue 105 was mutated to Ala. In addition, Arg120 following the penultimate Cys was retained as it is part of the β-sheet. Our previous NMR work showed that AgRP(87-120), often referred to as mini-AgRP, folds 100% to a uniform product that retains the ICK structure of the parent protein (17). Moreover, dissociation constants measured at Mc3R and Mc4R are equivalent to mature AgRP(83-132). Two other constructs, AgRP(83-120) and AgRP(87-132) were prepared using the same strategies.

ICV injections were administered to Long Evans rats fitted with cannulas in the third ventricle. Proteins were delivered as a single 1.0 nmol dose in 1.0 μL of solution. Feeding and weight were monitored in most cases until consumption returned to baseline values. Results for wild type AgRP(83-132) and the three truncated variants are shown in Figure 2A. All initially stimulate feeding, as seen in the responses after one day. AgRP(83-132) is the most potent, stimulating feeding nearly 80% over that of control (P<0.001), while mini-AgRP is the least potent. Interestingly, AgRP(83-120) is essentially equipotent to wild type (P<0.001). At three or four days after injection, enhanced feeding relative to control diminishes. Animals dosed with the three truncated variants are almost back to baseline. In contrast, those treated with AgRP(83-132) are still consuming feed about 30% over control (P<0.05 at day 4).

Figure 2.

Figure 2

Effect of a single administration of a 1.0 mmol dose of wild type and truncated AgRPs into third cerebral ventricle in male Long-Evans rats. (A) Percent increase over saline at 24 hr, 48 hr, 72 hr and 96 hr after injection (non- cumulative). (B) Net charge density trend of 24hr feeding response above saline control. □ P < 0.001, ‡ P < 0.01, and * P < 0.05.

The data in Figure 2A suggest that the four residue non-ICK segment preceding the ICK core is required for rapidly stimulating feeding, whereas both non-ICK segments are needed for long term effects. The significant number of basic, positively charged residues carried in the non-ICK segments motivated us to examine the relationship between 24 hr feeding and charge per residue (total protein charge divided by the number of amino acids) for the four proteins, as shown in Figure 2B. Interestingly, there is an approximate linear relationship, with a near four-fold increase in feeding from a doubling of the protein charge density.

Charge Modified AgRP Variants

We further tested the role of charge with a series of mutations in full AgRP(83-132). To eliminate positive charges, we replaced Arg or Lys with Gln, which retains local side chain steric features and preserves solubility in aqueous solution (Table 1). AgRP-2Q lacks two charges in the C-terminal loop, whereas AgRP-4Q lacks charges in both the N-terminal segment and the C-terminal loop. Feeding behavior after ICV injection is shown in Figure 3A. Both AgRP and AgRP-2Q greatly stimulate feeding in the first 24 hours. Consistent with the data of Figure 2, basic residues within the C-terminal loop are not important for the initial feeding response. Interestingly, AgRP-2Q is somewhat more potent than wild type in both short and long term feeding responses. In contrast, AgRP-4Q gives a weak 24 hour response (P<0.05) and returns to baseline after the second day. AgRP-4Q elicits responses similar to that of AgRP(87-120) demonstrating that elimination of the non-ICK segments, or simply the basic residues within these segments, is sufficient to reduce both short and long term potency.

Figure 3.

Figure 3

Effect of a single administration of a 1.0 mmol dose of mutated and designed AgRPs into third cerebral ventricle in male Long-Evans rats. (A and B) Non-cumulative percent increase of feeding response compared to saline of AgRP proteins with modified charges. (C) Relationship between 24 hr feeding and net charge density for all AgRP constructs. (D) 5-Day change in body mass and (E) trend in net peptide charge and 5-day change in body mass. □ P < 0.001, ‡ P < 0.01, and * P < 0.05 vs saline.

To further test the relationship between positive charge and feeding stimulation, we developed AgRP analogues with additional Lys residues. Inspection of the wild type AgRP(83-132) three dimensional structure reveals a cluster of basic residues extending from the active loop (Figure 1) to the end of the C-terminal loop, as shown in Figure 4. We reasoned that this conserved spatial arrangement could play a part in the feeding enhancement observed for AgRP(83-132) relative to AgRP(83-120). Consequently, we considered positions contiguous with this cluster. Among the possible positions, we chose to mutate Gly123 and Ala125 since these amino acids lack side chain functional groups and are therefore unlikely to play a structural role. The resulting double mutant is referred to as AgRP-2K. We additionally replaced the two Ser residues in the N-terminal segment with Lys, giving the AgRP-4K analog.

Figure 4.

Figure 4

Cluster of basic residues (blue) in AgRP(83-132) from the active and C- terminal loops. AgRP-2K was developed by mutation of Gly123 and Ala125 (arrows) to Arg. Basic residue side chains in the N-terminal segment (Ser83-Ser84- Arg85-Arg86) are not shown.

The results following ICV injection of AgRP-2K and AgRP-4K are striking, as shown in Figure 3B. AgRP-2K elicits an approximate 50% increase in food uptake relative to wild type AgRP in the first 24 hours (P<0.001), and continues to stimulate feeding out to six or seven days. The initial response from AgRP-4K is similar to that of AgRP-2K, but here the animals display elevated feeding beyond nine days, at which point the experiments were halted (P<0.05 at day 8). The relationship between 24 hour feeding and charge density in the Gln and Lys mutants is displayed in Figure 3C and supports linear behavior observed for the truncated AgRP variants. Finally, we examined the change in body mass five days after injection, as shown in Figure 4D. The results parallel the relationship observed between charge and 24 hour feeding (Figure 3E), with AgRP-4Q giving a slight decrease in body mass, and AgRP-4K giving by far the greatest increase. Moreover, AgRP-4K leads to an increase in body mass that is approximately double that observed for wild type AgRP(83-132). ICV data are fully summarized in Table 3.

Table 3.

ICV Feeding and Body Mass

Peptide 24hr Feeding (% above Saline) Day-3 Feeding (% above Saline) Day-5 Feeding (% above Saline) 5–Day ΔBody Mass (g)
AgRP(83-132) 76.94 ± 8.4□ 22.24 ± 0.9‡ 5.78 ± 0.3* 20.7 ± 5.4‡
AgRP(87-132) 42.4 ± 1.1□ 5.02 ± 0.4* – ND
AgRP(83-120) 64.33 ± 5.4□ 13.49 ± 1.5* – ND
AgRP(87-120) 21.32 ± 2# 11.60 ± 0.5# – ND
AgRP-2Q 97.7 ± 10.1□ 39.84 ± 4.6□ 14.07 ± 2.3# 6.89 ± 7#
AgRP-4Q 37.9 ± 4.4* -3.45 ± 0.2# – -6.09 ± 5#
AgRP-2K 115.5 ± 7.5□ 77.28 ± 4.3□ 44.51 ± 3.1□ 25.16 ± 3.5□
AgRP-4K 118 ± 8.3□ 92.27 ± 8.3□ 70.78 ± 7.6□ 41.11 ± 6.8□

ND, Not Determined

□

P < 0.001

‡

P < 0.01

*

P < 0.05

#

P ≥ 0.2 vs saline

Mc3R and Mc4R Pharmacology

We used both displacement and activity assays to evaluate the influence of truncation or charge alteration on receptor pharmacology. Measurements were performed on HEK293 cells expressing the desired receptor subtype. Figure 5 shows 125I-NDP-MSH displacement for all variants at Mc3R and Mc4R, with Ki values and errors reported in Table 2. Variation is limited from 4.5 to 16 nM at Mc3R, and from 7.6 to 16 nM at Mc4R. The variants that give the strongest feeding response fall in the middle of the Ki range and, in general, do not suggest any relationship between dissociation constant and short term or long term consumption. Each variant was further evaluated for its ability to suppress NDP-MSH stimulated cAMP production. Antagonists give a rightward shift in the response curve. The resulting curves are shown in Figure 5, with EC50 values and errors in Table 2. The EC50 values also exhibit limited variation, although greater than observed for the displacement studies, and range from 1.6 to 16 nM at Mc3R, and 1.7 to 17 nM at Mc4R. Interestingly, the lowest EC50 values at both receptors are observed for the AgRP-4Q and AgRP-4K variants, which elicit opposite feeding responses. In general, these results are consistent with our previous work, which found equivalent receptor affinity between AgRP(87-120) and AgRP(87-132), and demonstrate that receptor affinity or activity cannot account for the broad range of in vivo responses observed for the panel of AgRP variants.

Figure 5.

Figure 5

Pharmacology of novel AgRP constructs at Mc3r and Mc4r. (A & C) Displacement of 125I-NDP-MSH; (C & D) cAMP production from increasing NDP MSH concentrations in the presence of 0.10 μM AgRP proteins.

Table 2.

Ligand Displacement and EC50 Values

Mc3R Mc4R

Peptide Ki (nM) EC50 (nM) Ki (nM) EC50 (nM)
AgRP(83-132) ND ND 11 ± 0.7d ND
AgRP(87-132) 5.2 ± 0.7a 8.9 ± 0.2c 11 ± 1a 17 ± 3b
AgRP(83-120) 16.5 ± 0.4 2.96 ± 0.4 11.4 ± 4 4.92 ± 1.3
AgRP(87-120) 7.5 ± 0.5a 5.5 ± 0.2 6.1 ± 0.5a 13 ± 3b
AgRP-2Q 7.56 ± 1.3 9.22 ± 1.4 7.56 ± 0.3 6.66 ± 2.1
AgRP-4Q 15.6 ± 0.3 1.62 ± 0.3 16.2 ± 0.7 1.8 ± 0.5
AgRP-2K 7.84 ± 0.5 16.1 ± 1.6 9.99 ± 3.7 4.54 ± 1.3
AgRP-4K 11.91 ± 4 2.66 ± 0.3 15.65 ± 1.4 1.72 ± 0.4

ND, Not Determined

a

Data adapted from Jackson et al. (17)

b

Data adapted from Patel et al. (16)

c

Data adapted from Wilczynski et al. (34)

d

Data adapted from Creemers et al. (11)

Possible Mechanisms and Implications

The findings above identify an unanticipated but nevertheless dramatic functional role for the AgRP polypeptide segments outside of the ICK core domain. Comparison of wild type AgRP to a mini-AgRP, composed of only the ICK core, shows that the Ser-Ser-Arg-Arg N-terminal extension and the C-terminal loop greatly enhance both the initial and long-term feeding responses. Of these two non-ICK segments, the N-terminal extension is more important, especially for the initial feeding response, but both play a role in sustaining feeding levels above baseline. By evaluation of designed AgRP mutants, we further showed that positive charge conferred by basic residues in these segments is responsible for the observed in vivo responses. Inclusion of additional charges beyond those found in wild type results in a protein that generates a profound feeding response that lasts almost twice as long as that induced by the wild type AgRP. It is unlikely that these results arise from modulation in receptor binding affinity, as the measured dissociation constants and cAMP activities at Mc3R and Mc4R exhibit little variation and no correlation with feeding behavior.

Examination of mammalian AgRP sequences reveals some variation in the two non-ICK segments, but always at positions that do not carry positive charge (Table 1) (12, 13). The basic Lys and Arg residues are completely conserved, and acidic residues are never found at sites that do exhibit variation. It is unlikely that these segments play a structural role. Structure determination by NMR, performed by our lab, found that the C-terminal loop is flexible and points away from the ICK core containing four of the five disulfide bonds (13). Moreover, the mini-AgRP construct folds cooperatively with stability that is indistinguishable from AgRP(83-132) (17). Interestingly, the mini-AgRP core domain is so stable that it is now being used as a scaffold in protein design (20-22).

There is also no evidence that these segments are required for in vivo processing to produce mature AgRP(83-132). As noted in the Introduction, AgRP is produced as a pro-protein that undergoes processing by the serine endoprotease PC 1/3 (11, 12). AgRP residues 79 – 82 (Arg-Glu-Pro-Arg) follow the P4-P1 consensus sequence targeting cleavage to the Arg82-Ser83 peptide bond (23, 24). Alternate cleavage sights are not observed; the processed form of the protein is found exclusively as AgRP(83-132) (25). Moreover, PC 1/3 is tolerant of sequence variations at the P1'-P4' sites (Ser-Ser-Arg-Arg in AgRP) following the cleavage point, thus suggesting a distinct role for the conserved Arg85-Arg86 residues (23).

Among the known collection of natural and synthetic orexigenic peptides, AgRP exhibits the greatest overall potency. For example, a single 1.0 nM dose of neuropeptide Y (NPY) rapidly stimulates feeding beyond that of an equivalent dose of AgRP, but its effects quickly dissipate and feeding returns to baseline after 24 hours (10, 26). The synthetic cyclic hexapeptide SHU9119 gives a long-term response similar to AgRP, but requires higher minimal doses for activation (8). Because of its unique behavior, AgRP is considered to be an important lead in the development of drugs for treating cachexia (27). Cachexia is a state of negative energy balance that often arises with cancer, AIDS, kidney failure and leads to malnutrition and loss of body mass (7, 28). Maintaining positive energy balance, on the other hand, correlates strongly with the outcome of cancer patients undergoing radiation or chemotherapy. Consistent with the role of the melanocortin system in maintaining energy balance, animal models driven to cachexia by tumors or administration of lipopolysaccharide (LPS) resume normal feeding and body weight from the administration of Mc4R antagonists, including AgRP (27). It is therefore noteworthy that our findings here identify new features that enhance AgRP function and prolong efficacy by nearly a factor of two.

It is clear from our experiments that AgRP's basic residues, outside of the ICK core McR recognition domain, play a central role in modulating short- and long-term AgRP function. Although the direct mechanism linking positive charge to AgRP function is not clear, we note three possibilities. First, the basic residues may increase AgRP diffusibility thereby moving the protein more efficiently from the ventricle to the hypothalamus. Second, they may slow degradation or facilitate interactions with accessory molecules proximal to the melanocortin receptors. For example, negatively charged syndecans, cell surface proteoglycans, are implicated in McR regulation (29, 30). New experiments show that AgRP localization in the paraventricular nucleus is reduced in syndecan knockout mice, suggesting that syndecans are required for concentrating AgRP at postsynaptic membranes (31). Finally, the basic residues may facilitate signaling through a non-McR pathway. In support of this mechanism, injection of the synthetic agonist MTII, following AgRP administration, transiently reduces feeding, which then returns to the level consistent with AgRP dose (10). Moreover, loss of feeding regulation, resulting from selective ablation of AgRP neurons, is not reversed by increased ASIP levels (32).

In summary, we have demonstrated a clear functional role for AgRP's conserved non-ICK segments. The basic, positively charged residues are vital for AgRP stimulated long-term feeding. Enhancement of positive charge in these non-ICK segments leads to a protein of unprecedented orexigenic potency. Moreover, AgRP may be engineered to have variable long-term feeding profiles. Given that the arcuate nucleus is not fully protected by the blood brain barrier, the potent AgRP-4K protein developed here, or its derivatives, may be deliverable by intravenous injection. In general, the principles identified here will be helpful in pharmaceutical design for treating cachexia and perhaps other conditions associated with improper energy balance.

Methods

Peptide Synthesis, Purification and Folding

All peptides were synthesized using Fmoc synthesis on an Applied Biosystems (Foster City, CA) 433A Peptide Synthesizer on a 0.25mmol scale. Syntheses were monitored using the SynthAssist version 2.0 software package. All peptides were assembled on a Rink-amide-MBHA. Amino acids and resins were purchased through NovaBiochem. HBTU was obtained from Advanced Chemtech (Louisville, KY), and all other reagents were purchased from Sigma-Aldrich (St. Louis, MO). Fmoc deprotection was achieved using a 1% hexamethyleneimine (HMI) and 1% 1,8-Diazabicyclo[4.5.0]-undec-7-ene (DBU) solution in DMF. Deprotection was monitored by conductivity and continued until the conductivity level returned to the baseline, then synthesis continued. Deprotection times ranged from 2.5-7 minutes. Couplings used 4 equivalents Fmoc-amino acid in HBTU/DIEA for all amino acids except pre-activated Fmoc-Cys(trt)-OPfp. A 3-fold excess of Fmoc-Cys(trt)-OPfp was dissolved in 1.5mL 0.5M HOAt/DMF with no DIEA for coupling. AgRP(87-132) and AgRP(87-120) were N-terminal acetylated by reacting with 0.5M acetic anhydride in DMF for 5 minutes. Fully synthesized peptide resins were split into 3 reaction vessels, washed with DCM and dried. A solution of 12mL TFA containing 200mL each of TIS/EDT/liquefied Phenol (as scavengers) was added to each reaction vessel of dry peptide resin and incubated for 1.5h. The resin was filtered and washed with 1mL TFA and the combined filtrate and wash was then added to 90mL cold dry diethyl ether for precipitation. The precipitate was collected by centrifugation and the ether was discarded. The pellet was dissolved in 40mL 1:1 H2O:ACN (0.1% TFA) and lyophilized.

Peptides were purified by RP-HPLC on Vydac (Hesperia, CA) preparative C18 columns. Fractions were collected and analyzed by ESI-MS on a Micromass (Wythenshawe, UK) ZMD mass spectrometer to confirm the correct molecular weight. In each case the major peak was found to be the peptide, and fractions, which contained the peptide as a major constituent, were combined and lyophilized.

Air oxidative folding of each peptide was accomplished by dissolving the unfolded peptide into folding buffer (2.0M GuHCl/0.1M Tris, 3mM GSH, 400μM GSSG, pH 8) at a peptide concentration of 0.1mg/mL and stirring for 24-36h. Folding was monitored for all peptides by RP-HPLC on a C18 analytical column, which revealed a single peak, in each case, for the folded material that was shifted to an earlier retention time than the fully reduced peptide. The folded product was purified by RP-HPLC on a C18 preparative column and its identity confirmed as the fully oxidized product by ESI-MS. Reinjecting a small sample of the purified peptide on an analytical RP-HPLC column assessed purity of the peptides. Sample purity was determined to be >90%. Quantitative analysis of the peptide concentrations was done by UV absorption.

Rodent Studies

Male Long Evans rats ~10-12 weeks and weighing 250-350g were obtained from Harlan (Indianapolis, IN) and maintained in an AALAC accredited vivarium on a 12 to 12hr light dark cycle. Animals were given ad libitum access to standard rodent chow and water. After a one week habituation period, all animals were deeply anesthetized with a 1-ml/kg dose of (0.22g Ketamine/0.03g Xylazine) and placed into a sterotaxic apparatus with the incisor bars set at +1.0. Subsequently, an indwelling cannula was lowered into the third ventricle using the following coordinates, AP= -2.2, ML=0, DV= -7.0. All animals were allowed to recover for two weeks during which time they regained their pre-surgical body weight. To verify cannula placement, angiotensin II (10ng/μl) was injected into the third ventricle and water consumption was measured over a one hour period. To be included animals had to drink more than 7ml. Animals were injected one hour prior to the beginning of their dark phase using a within subjects paradigm.

Trials were conducted with one control group (receiving saline) and one experimental group (receiving the peptide of interest). After feeding returned to baseline, animals were allowed to re-equilibrate for 1 week before switching the experimental and control groups, and repeating the experiments. Each individual group maintained n > 5. The results of all trials were combined to assess percent baseline, due to differences in time of year and animal subjects. Changes in absolute grams of food intake are not different than changes in percent baseline. All experiments were run in replicates of 2-3 studies. Errors are expressed as ± SEM.

Pharmacology

The HEK-293 cell line was used for hMc3R and hMc4R transfection. The cells transfected with receptor were cultured in DMEM medium containing 10% bovine fetal serum and HEPES. Cells at 80% confluence were washed twice, and the receptor constructs were transfected into cells using lipofectamine (Life Technologies, Rockville MD). All experiments were run in triplicate and errors are expressed as ± SEM (Table 2).

Binding Assays

Binding experiments were performed using the conditions previously described. Briefly, after removal of the media, cells were incubated with non-radioligand NDP-MSH or AGRP analogues from 10-10 to 10-6M in 0.5 ml MEM containing 0.2% BSA and 1 × 105 cpm of 125I-NDP-MSH for one hour. The binding reactions were terminated by removing the media and washing the cells twice with MEM containing 0.2% BSA. The cells were then lysed with 0.2 N NaOH, and the radioactivity in the lysate was quantified in an analytical gamma counter (PerkinElmer, Shelton, CT). Nonspecific binding was determined by measuring the amount of 125I-label bound on the cells in the presence of excess 10-6 M unlabeled ligand. Specific binding was calculated by subtracting nonspecifically bound radioactivity from total bound radioactivity.

cAMP Assays

Cellular cAMP generation was measured using a competitive binding assay kit (TRK 432, Amersham, Arlington Heights, IL). Briefly, cell culture media was removed, and cells were incubated with 0.5 ml Earle's Balanced Salt Solution (EBSS), containing the melanocortin agonist NDP-MSH (10-10-10-6 M), for one hour at 37°C in the presence of 10-3 M isobutylmethylxanthine. The reaction was stopped by adding ice-cold 100% ethanol (500μl/well). cAMP content was measured as previously described, according to instructions accompanying the assay kit (33).

Supplementary Material

1_si_001

Acknowledgements

The authors thank G. Barsh of Stanford University and the HudsonAlpha Institute for helpful discussion and comments on the manuscript. This work was supported by a grant from the National Institutes of Health (DK064265).

Footnotes

Supporting Information Available: This material is available free of charge via the Internet at http://pubs.acs.org.

References

  • 1.Kaelin CB, Candille SI, Yu B, Jackson P, Thompson DA, Nix MA, Binkley J, Millhauser GL, Barsh GS. New ligands for melanocortin receptors. Int J Obes (Lond) 2008;32(Suppl 7):S19–27. doi: 10.1038/ijo.2008.234. [DOI] [PubMed] [Google Scholar]
  • 2.Ollmann MM, Wilson BD, Yang YK, Kerns JA, Chen Y, Gantz I, Barsh GS. Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein. Science (New York, NY) 1997;278:135–138. doi: 10.1126/science.278.5335.135. [DOI] [PubMed] [Google Scholar]
  • 3.Wilson BD, Ollmann MM, Barsh GS. The role of agouti-related protein in regulating body weight. Mol Med Today. 1999;5:250–256. doi: 10.1016/s1357-4310(99)01471-9. [DOI] [PubMed] [Google Scholar]
  • 4.Katsuki A, Sumida Y, Gabazza EC, Murashima S, Tanaka T, Furuta M, Araki-Sasaki R, Hori Y, Nakatani K, Yano Y, Adachi Y. Plasma levels of agouti-related protein are increased in obese men. J Clin Endocrinol Metab. 2001;86:1921–1924. doi: 10.1210/jcem.86.5.7458. [DOI] [PubMed] [Google Scholar]
  • 5.Adan RA, Hillebrand JJ, De RC, Nijenhuis W, Vink T, Garner KM, Kas MJ. Melanocortin system and eating disorders. Annals of the New York Academy of Sciences. 2003;994:267–274. doi: 10.1111/j.1749-6632.2003.tb03189.x. [DOI] [PubMed] [Google Scholar]
  • 6.Vink T, Hinney A, van EAA, van GSH, Sandkuijl LA, Sinke RJ, Herpertz-Dahlmann BM, Hebebrand J, Remschmidt H, van EH, Adan RA. Association between an agouti-related protein gene polymorphism and anorexia nervosa. Mol Psychiatry. 2001;6:325–328. doi: 10.1038/sj.mp.4000854. [DOI] [PubMed] [Google Scholar]
  • 7.Krasnow SM, Marks DL. Neuropeptides in the pathophysiology and treatment of cachexia. Current Opinion in Supportive and Palliative Care. 2010;4:266–271. doi: 10.1097/SPC.0b013e32833e48e7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Joppa MA, Ling N, Chen C, Gogas KR, Foster AC, Markison S. Central administration of peptide and small molecule MC4 receptor antagonists induce hyperphagia in mice and attenuate cytokine-induced anorexia. Peptides. 2005;26:2294–2301. doi: 10.1016/j.peptides.2005.03.002. [DOI] [PubMed] [Google Scholar]
  • 9.Hagan MM, Benoit SC, Rushing PA, Pritchard LM, Woods SC, Seeley RJ. Immediate and prolonged patterns of Agouti-related peptide-(83--132)-induced c-Fos activation in hypothalamic and extrahypothalamic sites. Endocrinology. 2001;142:1050–1056. doi: 10.1210/endo.142.3.8018. [DOI] [PubMed] [Google Scholar]
  • 10.Hagan MM, Rushing PA, Pritchard LM, Schwartz MW, Strack AM, van der Ploeg LH, Woods SC, Seeley RJ. Long-term orexigenic effects of AgRP-(83---132) involve mechanisms other than melanocortin receptor blockade. American journal of physiology Regulatory, integrative and comparative physiology. 2000;279:R47–52. doi: 10.1152/ajpregu.2000.279.1.R47. [DOI] [PubMed] [Google Scholar]
  • 11.Creemers JW, Pritchard LE, Gyte A, Le RP, Meulemans S, Wardlaw SL, Zhu X, Steiner DF, Davies N, Armstrong D, Lawrence CB, Luckman SM, Schmitz CA, Davies RA, Brennand JC, White A. Agouti-related protein is posttranslationally cleaved by proprotein convertase 1 to generate agouti-related protein (AGRP)83-132: interaction between AGRP83-132 and melanocortin receptors cannot be influenced by syndecan-3. Endocrinology. 2006;147:1621–1631. doi: 10.1210/en.2005-1373. [DOI] [PubMed] [Google Scholar]
  • 12.Jackson PJ, Douglas NR, Chai B, Binkley J, Sidow A, Barsh GS, Millhauser GL. Structural and molecular evolutionary analysis of Agouti and Agouti-related proteins. Chemistry &amp; biology. 2006;13:1297–1305. doi: 10.1016/j.chembiol.2006.10.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.McNulty JC, Thompson DA, Bolin KA, Wilken J, Barsh GS, Millhauser GL. High-resolution NMR structure of the chemically- synthesized melanocortin receptor binding domain AGRP(87-132) of the agouti-related protein. Biochemistry. 2001;40:15520–15527. doi: 10.1021/bi0117192. [DOI] [PubMed] [Google Scholar]
  • 14.McNulty JC, Jackson PJ, Thompson DA, Chai B, Gantz I, Barsh GS, Dawson PE, Millhauser GL. Structures of the agouti signaling protein. Journal of molecular biology. 2005;346:1059–1070. doi: 10.1016/j.jmb.2004.12.030. [DOI] [PubMed] [Google Scholar]
  • 15.He L, Gunn TM, Bouley DM, Lu XY, Watson SJ, Schlossman SF, Duke-Cohan JS, Barsh GS. A biochemical function for attractin in agouti-induced pigmentation and obesity. Nature genetics. 2001;27:40–47. doi: 10.1038/83741. [DOI] [PubMed] [Google Scholar]
  • 16.Patel MP, Cribb Fabersunne CS, Yang Y-K, Kaelin CB, Barsh GS, Millhauser GL. Loop-swapped chimeras of the agouti-related protein and the agouti signaling protein identify contacts required for melanocortin 1 receptor selectivity and antagonism. Journal of molecular biology. 2010;404:45–55. doi: 10.1016/j.jmb.2010.08.054. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Jackson PJ, McNulty JC, Yang Y-K, Thompson DA, Chai B, Gantz I, Barsh GS, Millhauser GL. Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity. Biochemistry. 2002;41:7565–7572. doi: 10.1021/bi012000x. [DOI] [PubMed] [Google Scholar]
  • 18.Tota MR, Smith TS, Mao C, MacNeil T, Mosley RT, van der Ploeg LH, Fong TM. Molecular interaction of Agouti protein and Agouti-related protein with human melanocortin receptors. Biochemistry. 1999;38:897–904. doi: 10.1021/bi9815602. [DOI] [PubMed] [Google Scholar]
  • 19.Chai B-X, Neubig RR, Millhauser GL, Thompson DA, Jackson PJ, Barsh GS, Dickinson CJ, Li J-Y, Lai Y-M, Gantz I. Inverse agonist activity of agouti and agouti-related protein. Peptides. 2003;24:603–609. doi: 10.1016/s0196-9781(03)00104-9. [DOI] [PubMed] [Google Scholar]
  • 20.Jiang L, Kimura RH, Miao Z, Silverman AP, Ren G, Liu H, Li P, Gambhir SS, Cochran JR, Cheng Z. Evaluation of a (64)Cu-labeled cystine-knot peptide based on agouti-related protein for PET of tumors expressing alphavbeta3 integrin. J Nucl Med. 2010;51:251–258. doi: 10.2967/jnumed.109.069831. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Silverman AP, Kariolis MS, Cochran JR. Cystine-knot peptides engineered with specificities for alpha(IIb)beta(3) or alpha(IIb)beta(3) and alpha(v)beta(3) integrins are potent inhibitors of platelet aggregation. J Mol Recognit. 2011;24:127–135. doi: 10.1002/jmr.1036. [DOI] [PubMed] [Google Scholar]
  • 22.Silverman AP, Levin AM, Lahti JL, Cochran JR. Engineered cystine-knot peptides that bind alpha(v)beta(3) integrin with antibody-like affinities. Journal of molecular biology. 2009;385:1064–1075. doi: 10.1016/j.jmb.2008.11.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Duckert P, Brunak S, Blom N. Prediction of proprotein convertase cleavage sites. Protein Eng Des Sel. 2004;17:107–112. doi: 10.1093/protein/gzh013. [DOI] [PubMed] [Google Scholar]
  • 24.Taylor NA, Van DVWJ, Creemers JW. Curbing activation: proprotein convertases in homeostasis and pathology. Faseb J. 2003;17:1215–1227. doi: 10.1096/fj.02-0831rev. [DOI] [PubMed] [Google Scholar]
  • 25.Breen TL, Conwell IM, Wardlaw SL. Effects of fasting, leptin, and insulin on AGRP and POMC peptide release in the hypothalamus. Brain research. 2005;1032:141–148. doi: 10.1016/j.brainres.2004.11.008. [DOI] [PubMed] [Google Scholar]
  • 26.Flynn MC, Plata-Salaman CR, French-Mullen JM. Neuropeptide Y-related compounds and feeding. Physiol Behav. 1999;65:901–905. doi: 10.1016/s0031-9384(98)00220-0. [DOI] [PubMed] [Google Scholar]
  • 27.Marks DL, Ling N, Cone RD. Role of the central melanocortin system in cachexia. Cancer research. 2001;61:1432–1438. [PubMed] [Google Scholar]
  • 28.Grossberg AJ, Scarlett JM, Marks DL. Hypothalamic mechanisms in cachexia. Physiol Behav. 2010;100:478–489. doi: 10.1016/j.physbeh.2010.03.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Reizes O, Benoit SC, Strader AD, Clegg DJ, Akunuru S, Seeley RJ. Syndecan-3 modulates food intake by interacting with the melanocortin/AgRP pathway. Annals of the New York Academy of Sciences. 2003;994:66–73. doi: 10.1111/j.1749-6632.2003.tb03163.x. [DOI] [PubMed] [Google Scholar]
  • 30.Reizes O, Lincecum J, Wang Z, Goldberger O, Huang L, Kaksonen M, Ahima R, Hinkes MT, Barsh GS, Rauvala H, Bernfield M. Transgenic expression of syndecan-1 uncovers a physiological control of feeding behavior by syndecan-3. Cell. 2001;106:105–116. doi: 10.1016/s0092-8674(01)00415-9. [DOI] [PubMed] [Google Scholar]
  • 31.Zheng Q, Zhu J, Shanabrough M, Borok E, Benoit SC, Horvath TL, Clegg DJ, Reizes O. Enhanced anorexigenic signaling in lean obesity resistant syndecan-3 null mice. Neuroscience. 2010;171:1032–1040. doi: 10.1016/j.neuroscience.2010.09.060. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Wu Q, Howell MP, Cowley MA, Palmiter RD. Starvation after AgRP neuron ablation is independent of melanocortin signaling. Proc Natl Acad Sci U S A. 2008;105:2687–2692. doi: 10.1073/pnas.0712062105. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Yang YK, Ollmann MM, Wilson BD, Dickinson C, Yamada T, Barsh GS, Gantz I. Effects of recombinant agouti-signaling protein on melanocortin action. Molecular endocrinology (Baltimore, Md.) 1997;11:274–280. doi: 10.1210/mend.11.3.9898. [DOI] [PubMed] [Google Scholar]
  • 34.Wilczynski A, Wang XS, Joseph CG, Xiang Z, Bauzo RM, Scott JW, Sorensen NB, Shaw AM, Millard WJ, Richards NG, Haskell- Luevano C. Identification of putative agouti-related protein(87-132)-melanocortin-4 receptor interactions by homology molecular modeling and validation using chimeric peptide ligands. Journal of medicinal chemistry. 2004;47:2194–2207. doi: 10.1021/jm0303608. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

1_si_001

RESOURCES