Opioid glycopeptide analgesics derived from endogenous enkephalins and endorphins

Abstract

Over the past two decades, potent and selective analgesics have been developed from endogenous opioid peptides. Glycosylation provides an important means of modulating interaction with biological membranes, which greatly affects the pharmacodynamics and pharmacokinetics of the resulting glycopeptide analogues. Furthermore, manipulation of the membrane affinity allows penetration of cellular barriers that block efficient drug distribution, including the blood–brain barrier. Extremely potent and selective opiate agonists have been developed from endogenous peptides, some of which show great promise as drug candidates.

The success rate of CNS drug development is lower than that of other therapeutic areas [1]. There are multiple reasons for this dearth of new drugs, including the sheer complexity of the brain and its neuropathologies; a propensity for CNS drugs to cause CNS-mediated side effects that limit dosing and compliance; a lack of validated biomarkers to inform whether a given neurotherapeutic agent is engaging the target in sufficient concentrations to modulate the CNS target; and the presence of the blood–brain barrier (BBB), across which CNS agents need to penetrate. Among these challenges, the BBB is considered to be most problematic for peptide or protein-based therapies [2–4]. However, peptides and proteins do offer distinct advantages for developing efficacious and well-tolerated treatments for CNS diseases, such as chronic pain, Alzheimer's disease and Parkinson's disease. These advantages include intrinsic affinity and selectivity of the peptide for native receptors and the metabolism of the peptide into smaller fragments and amino acids (versus the variety of active metabolites seen with small molecules). In addition, peptides and proteins can bind to multiple sites across a receptor protein, offering greater opportunity to fine tune the receptor–effector response [5,6]. Historical challenges for peptide and protein drug development are being addressed, including modifications that increase stability, techniques that increase yields and lower total synthetic costs, and technology to improve tissue targeting, including access to the CNS. A number of monographs have been written since the beginning of this century that describe formulations and articulate solutions of increasing sophistication to address the problems of peptide-based drugs [7–9].

Opioid receptors

The classical opioid receptors [10] are divided into three subtypes, the μ receptor (MOR or MOP), the δ receptor (DOR or DOP) and the κ receptor (KOR or KOP). Another receptor, the nociceptin or orphanin receptor (NOP or ORL1), is widely distributed in the CNS, and is clearly related to the opioid receptors in terms of its molecular biology but is generally not regarded as an opioid receptor as it does not respond to classical opioid agonists or antagonists. IUPHAR recommends use of the terminology MOP, DOP, KOP and NOP, replacing the older recommendation for OP₁ and OP₂, for example [201]. All of the opioid receptors have been cloned from various species, including mouse, rat and human. Opioid receptors are GPCRs that consist of highly homologous seven-transmembrane helical domains, and are linked with extracellular peptide loops of very limited size (Figure 1) [11,12].

Figure 1. Opioid receptors.

The μ-opioid receptor G-protein-coupled receptor derived from bovine rhodopsin by homology modeling [12].

The MOP receptor [13] is distributed presynaptically in various brain regions, including the limbic structures, the brainstem (i.e., the periaqueductal grey area) and in the superficial dorsal horn of the spinal cord. It was initially characterized in functional smooth muscle preparations of the guinea pig ileum (GPI). This receptor remains the principal target of opioid analgesics currently in clinical use, with the μ referring to morphine. The MOP receptor is widely distributed in other areas of the brain, as well as non-CNS tissues, most relevantly in the immune system, and the cardiovascular and gastrointestinal systems. Pharmacological activation of MOP not only modifies the transmission and perception of nociceptive stimuli, but also a host of other effects, including reduced respiratory drive in response to increased levels of CO₂, opioid-induced bowel dysfunction, abuse liability and pruritus (itching). Repeated or prolonged MOP activation results in adaptations that manifest as tolerance and physical dependence, further complicating management of chronic pain sufferers and patients with substance abuse disorders. Mixed opioid agonists/ antagonists and partial MOP agonists have been used to limit some of the opioid side effects with a mixed degree of success. Clearly, opioid pharmacology is a complex issue [14].

The DOP receptor [15] was originally characterized using the mouse vas deferens smooth muscle tissue preparation (mouse vas deferens [MVD] assay) [16]. The receptor is widely distributed anatomically, being found in the same general anatomical areas as MOP. DOP also contributes to a variety of physical and emotional effects, including initiation of movement [17], regulation of pain and reward circuitry, as well as other complex CNS behaviors (mood/ affect and anxiety). The issues of cellular co-localization of DOP and MOP, as well as the formation of functional ‘hetero dimers’ continue to be the subject of considerable interest [18–20]. Despite the progress that has been made in the localization of opioid receptors [21], the precise localization and neuronal and cellular pathways through which these three receptor types work remains incompletely understood [22,23]. Although DOP receptors contribute to analgesia, euphoria and physical dependence, DOP agonists may be able to produce broad spectrum analgesic efficacy with reduced propensity to produce classic opioid side effects [24].

The KOP receptor, named after the κ-agonist ketocyclazocine, is not as well studied as MOP and DOP, although it has attracted interest from pharmaceutical companies, as either a stand-alone drug [25,26] or in conjunction with agonism of other opioid receptors [27]. Stimulation of CNS KOP receptors is generally associated with dysphoria and psychomimetic effects, along with limited analgesic efficacy, especially in men [28]. Peripherally active KOP agonists produce antinociception in animal models of pain [29] and are being explored as targets for analgesia in several chronic pain states [18,30,31]. KOP antagonists are also being investigated as treatments for addiction and depression [32].

The diversity of the endogenous neuropep-tides and their receptors provide many opportunities for drug discovery [33]. If there were a straightforward methodology for converting endogenous neuropeptides into useful CNS drugs, then a new and potentially sea-changing pharmacopeia would be available for the treatment of CNS disorders.

Endogenous opioid peptide agonists

Since the discovery of the two endogenous pentapeptides, Met-enkephalin and Leu-enkephalin in the 1970s, perhaps as many as 300 endogenous neuropeptides have been identified in widespread locations throughout the CNS Table 1. Endogenous opioid peptides and their receptors undergo modulation in response to various physiological conditions, such as inflammation, tissue injury, pain and other stressors [34].

Table 1.

Endogenous opioid peptides^†.

Peptide	Sequence	Subtype
Enkephalins
Leu-enkephalin	YGGFL	δ receptor/μ receptor
Met-enkephalin	YGGFM	μ receptor/δ receptor
Metorphamide	YGGFMRRV-NH2	δ receptor/μ receptor
Peptide E	YGGFMRRVGRPEWWMDYQKRYGGFL25	μ receptor/κ receptor
Endorphins
β-endorphin	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE31	μ receptor/δ receptor
γ-endorphin	YGGFMTSEKSQTPLVTL17	μ receptor/unknown
α-endorphin	YGGFMTSEKSQTPLVT16	μ receptor/unknown
Dynorphins
Dynorphin A	YGGFLRRIRPKLKWDNQ17	κ receptor (μ receptor)
Dynorphin B	YGGFLRRQFKVVT13	κ receptor (μ receptor, δ receptor)
Dynorphin1–8	YGGFLRRQ8	κ receptor (μ receptor, δ receptor)
α-neoendorphin	YGGFLRKYPK	κ receptor (μ receptor, δ receptor)
β-neoendorphin	YGGFLRKYP	κ receptor (μ receptor, δ receptor)
Nociceptin/orphanin FQ
Nociceptin	FGGFTGARKSARKLANQ	ORL1
Endomorphins
Endomorphin-1	YPWF-NH2	μ receptor
Endomorphin-2	YPFF-NH2	μ receptor
Dermal peptides
Dermorphin	YaFGYPS-NH2	μ receptor
Deltorphin A	YmFHLMD	δ receptor
Deltorphin C	YaFDVVG-NH2	δ receptor

^†A few of the opioid peptides isolated from the mammalian CNS and from the skin of amphibians are illustrated. Their common names, sequences and suggested receptor binding activities are shown. Weaker binding activities are in parentheses.

The three classes of endogenous opioid peptides (enkephalins, endorphins or dynorphins) are typically assigned to the three types of opioid receptors (DOP, MOP and KOP, respectively). This approach is misleading since the absolute selectivity of each peptide is limited, and it neglects the fact that there are many cleavage variants of the neuropeptides, splice variants for the receptors and, likely, variations in their glycoforms. The endogenous peptides are not orthogonal and neuropeptide receptors might, for example, just as easily be thought of as ‘metorphamide receptors’ or ‘enkephalin receptors’ [35]. Moreover, α-endorphin and γ-endorphin have been found to be inactive at sites that are sensitive to β-endorphin [36] and other sites have been found that are sensitive to γ-endorphin, which have been referred to as ‘non-opioid’ in nature [37,38].

Schwyzer's membrane compartment concepts

Schwyzer articulated critical roles for the membrane in peptide–receptor binding events (Figure 2) [39]. Although his ‘membrane compartment theory’ may have overstated the influence of the membrane in differentiating receptor selectivity (μ vs δ vs κ), it is clear that the membrane environment does play critical roles in pre-organizing the peptide conformation prior to binding, as well as the peptide–receptor binding event itself [40]. We view binding as a three-step process:

• ■ Adsorption of the peptide ligand to the membrane. This promotes receptor binding by reducing a 3D search for the receptor to a faster 2D search. Surface-assisted ‘reduction-of-dimensionality’ calculations, performed by Polya in 1921, were examined by Max Delbrück in which he quantitatively demonstrated the viability of this theory [41,42];

• ■ Conformational changes in the peptide induced by the asymmetric environment of the membrane. Amphipathicity of the peptide is believed to reorganize the peptide–membrane aggregates into minimal energy states [43,44];

• ■ The binding event itself. GPCR binding and activation is a complex, multifaceted phenomenon. It is, however, beyond the scope of this review.

Figure 2. Membrane hopping.

Endogenous opioids associate with the membranes (k_on >> k_off) and bind to one or more of the opioid receptors via a membrane-bound conformation (Fisher's lock and key). Studies show that active (folded) conformations are favored in the membrane and inactive (random coil) conformations are favored in the absence of a membrane. Incorporation of glycosides, represented by the 270° arc, can shift the k_on/k_off equilibrium to facilitate ‘membrane hopping’.

The neurovascular unit & the BBB

In order to enter the brain and CNS, pharmaceutical agents must first penetrate the BBB (Figure 3). There are several strategies available to make a peptide metabolically stable but the transport of a peptide across BBB is still remains a major hurdle in developing CNS drugs [45]. Contrary to the belief that small molecules with molecular weights under 400 readily cross the BBB, it has been observed that almost 98% of small molecules do not readily cross the BBB. Further, evidence has accumulated that peptides can penetrate the CNS by several different mechanisms [46–49]. These observations clearly indicate molecule size is not the primary factor, but rather the overall physiochemical characteristics of the molecule is critical for BBB transport. Since the BBB is composed of endothelial membranes, many research groups focus on designing peptides with increased lipid solubility. Simply increasing the lipid solubility of a drug molecule may have undesirable effects, such as decreasing solubility and bioavailability, and increasing plasma protein binding.

Figure 3. The neurovascular unit.

The neurovascular unit forms the blood–brain barrier that prevents the passage of most peptides and other polar substances from the capillaries into the brain.

AE: Astrocyte endprocess; BL: Basolateral membrane; EC: Endothelial cell; NU: Neutrophil; P: Pericyte; TJ: Tight junction.

The BBB is composed of endothelial membranes that function as a continuous lipid barrier that protects the brain from toxic substances by preventing their entrance from bloodside to CNS. The BBB is also an enzymatic barrier that poses additional challenges in developing peptide/protein-based CNS drugs. Further, it has been viewed recently as a regulatory interface between the CNS and circulation with nutritional, homeostatic and communication functions. Understanding of the principles and physiology of BBB has improved a great deal in the past decade. Moreover, evidence is accumulating that many peptides and proteins cross the BBB in amounts sufficient to affect CNS function. It is now clear that the BBB is not an absolute physical barrier but a regulatory tool that controls the delivery of the substances to the CNS. Strategies based on this principle are proving to be very successful [50]. Other strategies using ‘molecular umbrellas’ [51], ‘Trojan horses’ [52] and BBB ‘shuttles’ [53] have been proposed by various groups. We have successfully applied glycosylation as a strategy to improve the BBB penetration, as well as the stability and systemic availability of enkephalins and the larger endorphin-like peptides.

Glycopeptide synthesis

Initially, O-linked glycopeptides were considered to be exotic substances, and were difficult to evaluate as drugs simply because the synthetic methods required to produce them in tangible amounts were lacking. In the last 40 years this situation has changed, however, glycopeptides are still significantly more difficult to produce than simple peptides, even if the requisite Fmoc–amino acid glycosides are commercially available, and particularly so if the glycosides require synthesis [54,55]. Enzymatic approaches have been incorporated into chemical methods for serine and threonine glycosides [56]. The ideal methodology should produce high yields of pure diastereomers, typically β-anomers for the highest stability. Many classical methods produce high yields of the desired anomers, but require the production of labile glycosyl donors or very reactive (e.g., unstable) promoters [57].

Production of O-linked glucosides and lactosides of enkephalins and endorphins requires the corresponding acetate-protected glycosides of Fmoc–serine or Fmoc–threonine. The benzophenone Schiff base appeared to be a very good protection for amino groups of serine and threo-nine for glycoside formation [58]. O-glycosides of these amino acids with different monosaccharides, aminosugars and deoxysugars were obtained with excellent yield and very high stereoselectivity [59]. Glycoside peracetates have been used as building blocks for solid-phase glycopeptide synthesis, and significant improvements have been made in the production of the glycoside building blocks [60]. An even more efficient and direct approach to these precursors has now been developed that proceeds directly from Fmoc–serine or Fmoc–threonine as glycosyl acceptors, and either β-d-glucose per-acetate or β-lactose peracetate in the presence of ‘minimally competent’ Lewis acids, such as indium(III)bromide (Figure 4) [61].

Figure 4. Minimally competent Lewis acids as glycosidation promotors.

Lewis acids such as InBr₃ can dissociate (lower pathway) from the displaced acetate to form acetic acid and regenerate the Lewis acid catalyst. Stronger Lewis acids remain associated with the acetate (upper pathway) to produce a Brønsted acid and, generally, require a full equivalent of the Lewis acid.

The glycopeptides can be synthesized manually based on established solid-phase N-fluorenylmethoxycarbonyl methods (Fmoc chemistry) (Figure 5). The side chain-protected amino acids used by our research group were Fmoc–Lys(Boc)-OH, Fmoc–Glu(OtBu)-OH, Fmoc–Asn(Trt)-OH, Fmoc–D-Thr(But)-OH, and Fmoc–Tyr(But)-OH. For support we have used Rink amide MBHA 1% DVB resin, with substitution typically ranging from 0.2– 0.8 meq/g. Best results (e.g., highest purities of the crude glycopeptides) were obtained by coupling well below the resin capacity and then capping the excess capacity with acetic anyhydride (Ac₂O). Coupling of the Fmoc–amino acids was achieved using manual coupling methods with or without microwave heating or, typically, using mechanization, with extended reaction times or heating only for coupling of the glycosidic residue and the residue following, which may be regarded as an extremely hindered case of amino acid coupling. Use of NMP as a solvent rather than the more polar DMF also aided these couplings. Manual coupling reactions and critical couplings performed during mechanized coupling were typically monitored using Kaiser's ninhydrin test.

Figure 5. Glycopeptide assembly.

MBHA-functionalized Rink polystyrene resin was used to provide the C-terminal amides upon cleavage after classical Fmoc construction of the glycopeptides. Treatment with hydrazine hydrate (H₂NNH₂•H₂O) in methanol (CH₃OH) was required to remove the acetates from the glycoside moiety prior to cleavage from the Rink resin. A Boc-protected amino acid may be used for the final amino acid (O-tBu-Tyr), which is cleaved with the TFA cocktail.

The Fmoc group was removed from the N-terminus of the growing glycopeptide chain using a mixture of 3% piperidine and 2% diaza-1,3-bicyclo[5.4.0]-undecane in DMF for 10 min with argon bubbling as agitation. The acetyl protecting groups of the glycosides and the N-terminal Fmoc could be removed with 80% hydrazine hydrate (H₂NNH₂•H₂O) in CH₃OH with argon agitation 3X for approximately 2 h. A superior method used Boc protection for the last amino acid, which survived the hydrazine treatment but was removed by TFA. The synthetic glycopeptides were cleaved from the Rink resin with a ‘TFA cocktail’, F₃CCOOH:Et₃Si H:H₂O:PhOCH₃:CH₂Cl₂ (8:0.5:0.5:0.05:1), which also removed the side chain protection, and the N-terminal Boc group, if that method is employed. The crude glycopeptides were precipitated in cold diethylether, redissolved in H₂O and then lyophilized prior to reverse-phase HPLC. A preparative scale C₁₈ column (Phenomenex® 250 × 22 mm, 250 × 55 mm or equivalent) was used, with an acetonitrile–water (CH₃CN-H₂O) gradient containing 0.1% TFA to obtain glycopeptides of greater than 97% purity. Homogeneity of the pure glycopeptides was confirmed by analytical reverse-phase HPLC and MS.

Glycopeptide analgesics based on enkephalins

Our initial attempts at improving the CNS bioavailability of opioid peptides came from collaborations between the Chemistry and Pharmacology Departments at the University of Arizona led by Victor Hruby [62]. In 1983 this group successfully synthesized and characterized a series of cyclic penicillamine containing enkephalin analogues (e.g., DPDPE) that had higher affinity and selectivity for DOP [63]. Incorporation of an unnatural amino acid (D-penicillamine) and the cyclic constraint into the peptide enhanced both its stability and DOP selectivity. One hypothesis was that by increasing the lipophilicity of an already quite lipophilic DPDPE, BBB penetration could be increased, which was confirmed in an in vitro BBB model that used bovine brain microvessel endothelial cells [64].

Concurrently, we tested an alternative hypothesis, which, in retrospect, was naive and incorrect, whereby attachment of a glucose molecule to the modified enkephalin peptide would make the overall ligand a substrate for the Glut-1 transporter [65]. In an effort to enhance CNS bioavailability, we synthesized a series of enkephalin analogues (Tables 2–4). It was predicted that CNS delivery of the enkephalin molecule across the BBB would be increased, and that we would observe antinociceptive activity following systemic administration. While the Glut-1 hypothesis eventually proved to be incorrect, the enkephalin glycosides did penetrate the BBB very effectively and produced potent and long-lasting antinociception in mice after intravenous (iv.) or intraperitoneal (ip.) injection [66].

Table 2.

Cyclic disulfides related to DPDPE^†.

Compound	Structure	IC50 (nM)
		δ receptor	μ receptor	MVD	GPI
1		6.1–6.4	30–43	5.5	26
2		3900	7700	520	3700
3		9.9	42	24	110
4		26–46	45–53	13	60
5		85	48,000	560	40,000
6		32	19
7		10	53.3
8		48	9

^†Study of a series of cyclic disulfide glycosides of enkephalin showed that placement of the glycoside was critical to maintain opioid activity and that δ receptor selectivity was reduced in this series of compounds.

GPI: Guinea pig ileum; MVD: Mouse vas deferens.

Table 4.

Linear glycopeptide amides as μ receptor/δ receptor opioid agonists.

Compound	Structure	Ki (nM)			A50
		δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)	Intravenous (μmol/kg)
Morphine		290 ± 38	0.79 ± 0.12	12.0 ± 1.3	2384	7.84
17		9.20 ± 1.70	5.00 ± 0.65	42.0 ± 5.0	0.018	3.20
18		6.48	41.9	ND	0.034	2.16
19		13.0 ± 0.55	4.5 ± 0.12	31.0 ± 0.3	ND	ND
20		9.86	30.8	ND	0.062	6.82
21		25.0	56.7	ND	0.061	10.9
22		ND	ND	ND	0.380	140.8
23		3.3 ± 0.33	8.7 ± 0.93	130 ± 6.2	0.093	30% at 32.0 mg/kg
24		7.9 ± 0.73	3.9 ± 0.19	310 ± 66	0.34	54.1
25		14.0 ± 0.34	1100 ± 13	3% at 10.0 μM	0.22	5.63

Glycopeptide disaccharides, and phosphates based on δ receptor-preferring enkephalin sequences developed by BP Roques, DtGFLS (DTLES) and DsGFLT (DSLET).

ND: Not determined.

Table 2 highlights some of the initial enkephalin glycopeptides that were synthesized [67]. Glycoside placement proved critical for affinity as determined by radioligand binding studies, and efficacy, as determined by GPI and MVD assays. Glycosylation sites close to the N-terminus resulted in reduced affinity for both DOP and MOP. Extension of the modified enkephalin peptide at the C-terminus allowed for glycosylation while preserving opioid receptor affinity, with some compounds retaining moderate DOP selectivity while others had approximately equal affinity for DOP and MOP. Two glycopeptides, β-glucoside 3 and 4 (Table 2) were tested in mice for their ability to produce CNS-mediated antinociception after systemic administration, and were compared with the unglycosylated peptide control 1. Both glycopeptides 3 and 4 produced dose- and time-related antinociception following ip. injection into mice, whereas the unglycosylated control peptides did not produce any measurable effects. The primary obstacles for better characterization of these glycopeptides were the somewhat tedious synthesis of the cyclic disulfides and the relatively low potency of the compounds (~30 mg/kg A₅₀ values).

Larger quantities of a linear enkephalin glycoside based on Roques's so-called ‘delta-enkephalin’ or DTLET (YtGFLT, Tyr-d-Thr-Gly-Phe-Leu-Thr) were produced. The parent unglycosylated peptides, 9 and 10, retained high affinity for both DOP and MOP, relatively weak binding to KOP, and displayed a slight preference (~tenfold) for functional activity in the mouse MVD assay versus GPI assay [68]. Both compounds were extremely potent (<0.1 nmol A₅₀ values) following intra cerebroventricular (i.c.v.) administration but required very large doses iv. to produce any antinociception in the mouse 55°C tail-flick. The addition of a glucoside to a serine in the sixth position of the peptide resulted in retention of modest selectivity for DOP over MOP in functional MVD/ GPI tissue assays and in receptor-binding studies [69]. Both the parent peptide (9) and glycosylated analogue (12) were extremely potent in the mouse tail-flick assay following intra cerebroventricular injection. However, glycopeptide 12 was significantly more potent following systemic routes of administration (iv., ip. and sc.). In situ BBB studies in rats also indicated, despite the increase in MW and increased water solubility, that the glycopeptide penetrated the BBB more effectively than its unglycosylated peptide counterpart 9 [70]. When compared with morphine, glycopeptide 12 resulted in lower levels of physical dependence as indicated by naloxone-precipitated withdrawal.

In an effort to further explore the structure-activity of glycosylation [71], a number of glycopeptides were synthesized to determine if the type of monosaccharide altered the transport characteristics and systemic potency of the lead peptide pharmacophore; if di- or tri-saccharides provided any additional benefit to pharmacokinetic and pharmacodynamic properties; and if bis- or tris-monosaccharides were viable alternative strategies for improving BBB transport and systemic potency [72]. In addition, several other modifications were made to explore the geometry of the attachment point (D vs L amino acid) of the glycoside and to see if the more sterically hindered threonine attachment differed from serine in its effects on activity. It should be noted that we stayed with the linear enkephalin parent peptide as it had roughly equal affinity for DOP and MOP receptors. This was important in assessing potential effects of glycosylation on preferential biasing for DOP or MOP.

The initial Roques-based linear peptides tested had either an l-Ser or l-Thr added to the sixth position of the peptide. The geometry of the glucoside attachment did not impact functional potency/efficacy in the in vitro or in vivo assays (l-Ser vs d-Ser or l-Thr vs d-Thr). For the monosaccharides, the β-xylose was approximately two-times more potent than β-glucose or α-mannose following iv. administration. The three disaccharides (β-lactose, β-maltose and β-melibiose) were all more potent than the best monosaccharide tested, with the β-melibioside being the most potent of the three.

Based on these results, we synthesized additional glycopeptides that incorporated a trisaccharide (β-maltotriose) to see if additional size/ bulk of the carbohydrate moiety would lead to further increases in iv. potency. The experimen iv. potency. The experimental data indicated a modest fall off in binding affinity and potency in the in vitro and in vivo functional assays. We also extended the hexa-peptide to include one to two additional Ser or Thr attachment points with β-glucose (bis- and tris-monosaccharides) to more fully explore the structure–activity relationship. In all cases, the additional glycosyl bulk reduced potency following i.c.v. administration, and the one compound tested iv. was significantly less potent than the original glycopeptide (β-glucoside and l-serine attachment).

Additional studies confirmed aspects of the in vivo studies [67]. Larger carbohydrates reduced octanol:saline partitioning (logD value), indicating greater water solubility (parent peptide < monosaccharide < disaccharide < trisccharide). Serum and brain stability of the glycopeptides also increased with these substitutions. In an in situ model of BBB transport the disaccharide proved to be the most readily transported with the trisaccharide having a reduced R_Br value (though still superior to the unglycosylated control). We extended the in vivo work by adding additional pain assays to assess efficacy. The disaccharide 17 produced potent antinociception in the formic acid, acetic acid and carrageenan assays following systemic administration (all of these pain assays have an inflammatory component).

Based on this modest library of glycopeptides, we chose the β-lactoside (17) as the lead molecule to pursue more advanced in vivo characterization. While not the most potent of the disaccha-rides, the compound was much easier and less costly to synthesize compared with melibiose. Glycopeptide 17 also had some additional desirable characteristics, including being highly water soluble (>50 mg/ml). Based on these findings, we advanced 17 into a more complete characterization of its antinociceptive efficacy and side-effect profile.

As expected, 17 produced full efficacy in the GTPγS assay with a modest selectivity for DOP over MOP. This profile was similar to what was observed in the functional MVD and GPI tissue assays. We confirmed this profile in vivo by pre-treating mice with various opioid antagonists. The general antagonist naloxone completely blocked the actions of 17 in the 55°C tail-flick assay in mice. In contrast, the peripherally selective antagonist naloxone methiodide did not alter the agonist actions of the compound. Subtype selective DOP (naltrindole) and MOP (β-FNA) antagonists each partially blocked the antinociceptive actions of 17 and, when combined, they completely eliminated the agonist actions. The KOP-selective antagonist nor-BNI was without effect.

As a lead molecule, 17 was also tested in several rat models of pain to determine how broad an antinociceptive spectrum the compound might have. The first assay used was a post-surgical incision model of the hind paw [73]. Morphine and 17 both produced dose-related reversal of the tactile allodynia associated with the injury [D Giuvelis et al., Unpublished Data]. On a μmol/kg basis, 17 was almost equal to morphine in terms of potency. Similar results were seen in a subchronic inflammatory pain model induced by complete Freund's adjuvant, although, in this case, 17 had greater potency than morphine, possibly due to enhanced DOP signaling under inflammatory conditions. Finally, 17 was compared with gabapentin in a rat spinal nerve ligation model of neuropathic pain. Glycopeptide 17 produced potent reversal of the tactile allodynia and thermal hyperalgesia post-ligation, whereas gabapentin only reversed tactile allodynia at the doses examined [D Giuvelis et al., Unpublished Data]. Collectively, the data indicate that a mixed DOP/MOP agonist has a broad spectrum of antinociceptive effects in acute and chronic pain models, including ones that have inflammatory and/or neuropathic pain components.

One of the initial screens for side effect was to inject increasing doses of 17 or morphine and collect locomotor data in an automated open field assay. Morphine and other MOP agonists stimulate forward locomotion in imprinting control region mice. This effect becomes pronounced at near maximal and supramaximal antinociceptive doses. The mixed MOP/DOP agonist 17 produced an initial and transient decrease in forward locomotion that was replaced by a very mild stimulation of activity at later time points. We further investigated the initial inhibition of locomotor activity by pretreating mice with naloxone methiodide or nor-BNI. Both pretreatments attenuated the effects of 17 on locomotion and completely eliminated both effects when the two opioid antagonists were administered simultaneously. This indicated that stimulation of peripheral opioid receptors can produce a transient decrease in exploratory locomotor behavior and there may be a modest κ-agonist effect of the compound in the CNS that contributes to reduced stimulation of locomotor activity but does not contribute to the antinociceptive effects in the 55°C tail-flick assay.

Interestingly, one of the other gross observable differences between 17 and morphine is a lack of Straub tail and muscular rigidity with 17. We quantified this effect in dose–response curves versus antinociception with both morphine and the mixed agonist 17. The potential of morphine to produce both effects overlapped, whereas it took much higher doses of 17 to produce the muscular rigidity and Straub tail compared with its antinociceptive effects.

Based on the mixed DOP/MOP profile of 17, we were interested in evaluating the tolerance and physical dependence liability of the compound relative to morphine. For tolerance studies, we used a common paradigm involving twice-daily injections of the approximate A₉₀ doses of the agonist (or vehicle) for 3 days. On the morning of day 4, full dose–response curves were constructed for each compound in the agonist- and vehicle-treated animals. Repeated doses of morphine resulted in an approximately 13-fold rightward shift in the A₅₀ value indicating substantial development of antinociceptive tolerance. Equivalent doses of 17 (in terms of analgesia) resulted in a significantly reduced rightward shift (<fivefold). Morphine and glycopeptide 17 have similar durations of action and AUC values, making the comparisons more straightforward.

For assessment of physical dependence liability, we used both an acute (single high-dose administration of agonist) and chronic (twice-daily injections for 3 days) dependence protocol. In both cases, injection of the general opioid antagonist naloxone was used to precipitate withdrawal and several indices of withdrawal were recorded (vertical jumps and paw tremors, for example). The level of physical dependence/severity of withdrawal was consistently lower with the 17 exposure compared with equivalent exposures of morphine [74]. The working hypothesis for explaining these results is that the antinociceptive effects of the mixed DOP/MOP compound synergize at the cellular or network level, whereas the processes that drive tolerance and/or physical dependence are additive or subadditive. A predominantly MOP-selective agonist, on the other hand, requires significant occupation of the MOP receptors at sites both responsible for antinociception and tolerance/dependence. Other explanations are possible, including the formation of heterodimers with the glycopeptide (17) versus the small molecule (morphine) that lead to activation of different signaling pathways.

To further characterize the side-effect profiles of the glycopeptide, two commonly used assays for assessing MOP effects were used (gastrointestinal transit and respiratory depression). We had predicted that the DOP/MOP profile would have a reduced effect on these parameters compared with equivalent doses of morphine. This was not the case. Glycopeptide 17 also inhibited upper-gastrointestinal transit and suppressed respiratory response to elevations in CO₂ on the minute ventilation parameter. The former may have been due to the apparent higher concentrations of glycopeptide 17 in the peripheral circulation compared with CNS, thus, overwhelming the MOP populations in the enteric nervous system. These values were estimated from the i.c.v. versus iv. potency ratios to produce antinociception for 17 versus morphine (more formal pharmacokinetic measures are currently being conducted). The respiratory depression observations indicate that a slight preference for DOP over MOP is not sufficient to differentiate from a MOP selective agonist.

Additional studies were conducted with 17 with respect to its abuse liability. As mentioned previously, the level of locomotor stimulation with 17 was markedly reduced compared with morphine. The stimulation of forward locomotion is generally interpreted as an activation of mesolimbic dopamine systems and an indicator of abuse liability. Our group has also conducted preliminary studies using conditioned place preference and iv. drug self administration in rodents. In the conditioned place preference studies, morphine produced a significant place preference whereas antinociceptive equivalent doses of 17 did not (similar to vehicle). In rat self-administration studies 17 maintained significantly lower numbers of infusions than the more MOP selective agonists morphine and fentanyl. In addition, the cumulative latency to delivery of the first three infusions of 17 (at the peak of the dose–effect curve) was significantly longer than morphine and fentanyl [Stevenson et al. Manuscript in Preparation]. These experiments suggest that the reinforcing effects of 17 are less than the prototypical MOP agonists morphine and fentanyl. The reinforcing effects of 17 were also evaluated in rhesus monkeys [75]. Under the conditions examined 17 did not support self-administration in rhesus across a series of doses/concentrations, although the results are more difficult to interpret due to species differences with respect to pharmacokinetics.

Current studies with DOP-selective peptides

With respect to our analgesic drug-development efforts, the prior work with 17 (mixed DOP/ MOP agonist) indicated to us that greater DOP selectivity might be needed in order to differentiate a lead candidate from currently available MOP analgesics. This was based not only on the extensive characterization we had done with 17, but also the literature demonstrating involvement of DOP receptors in neuropathic and other chronic pain states, and the further improvement in side-effect profiles [76–78]. We have also been interested in exploiting potential differences between the small-molecule DOP agonists, such as BW373U86 and SNC80, and the larger peptide-based deltorphin II analogues [79–82]. The former are ineffective in acute nociceptive assays that have high stimulus intensities, whereas the later are effective. This may be due to differences in ligand/receptor biasing or interactions with unique homo- or hetero-dimers of the DOP [83].

A series of glycosylated deltorphin analogues were synthesized that retained their high affinity, selectivity and efficacy at the DOP. Through an in vitro screening process, two to three lead compounds emerged, including glycopeptide 25. (Table 4) This compound exhibits a low nM EC₅₀ value in the GTPγS assay and is very potent when injected i.c.v. (<1 nmol A₅₀ value) (Kitsos et al. Mauscript in Preparation). Glycopeptide 25 is also systemically bioavailable following iv. and p.o. dosing, although the oral dose requires a proprietary co-formulation technology developed by Unigene. We are currently conducting further assessments of efficacy and side effects of glycopeptide 25 and comparing them to morphine and to 17. These preliminary data suggest that we the efficacy of the δ-agonist 25 is at least equal to the mixed μ/δ-agonist 17 with a side-effect profile on gastrointestinal transit that is superior to morphine and 17.

DAMGO - based MOP agonists

To further explore and exploit the biousian hypothesis [84], the classical μ-agonist (K_i: 0.53 nM) DAMGO [85,86] was used as a lipophilic peptide message [87], and additional moieties added to provide a water soluble address to produce a series of MOP-selective ligands. Their pharmacology was assessed in vitro and in vivo [88,89]. It was believed that the exploration of the biousian hypothesis [84] within the context of a pure MOP agonist would simplify interpretation of the results (Figure 6). The binding and antinociceptive effects of 26–29 are shown in Table 5 with values for morphine sulfate and DAMGO included for comparison. Binding was determined in Chinese hamster ovary cell membranes as before. Antinociception (A₅₀ values) was determined after i.c.v. or iv. administration using the mouse 55°C tail-flick assay.

Figure 6. Antinociception studies indicate a U-shaped or V-shaped curve when the A₅₀ potency values are correlated with predicted amphipathicity.

The hydrodynamic values (glucose units) or Connolly-derived amphipathicity values are plotted along the X-axes, and A₅₀ values derived from mouse intravenous tail-flick data are plotted on the Y-axis. Both analyses produce a U-shape or V-shape, as predicted by the biousian hypothesis [84]. The amphipathicity values were calculated using the formula A = e^{–Awater/Alipid}, where Awater = the Connolly surface area of the hydrophilic moiety (Ų) and ^Alipid = the Connolly surface area of the rest of the lipophilic peptide message segment YaG(N-MeF).

Table 5.

Glycopeptides based on DAMGO.

Compound	Structure	Ki (nM)			A50
		δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)	Intravenous (μmol/kg)
Morphine		290 ± 38	0.79 ± 0.12	12.0 ± 1.3	2384	7.84
DAMGO		990 ± 35	0.56 ± 0.006	270 ± 9.3	30	1.88
26		600 ± 44	0.68 ± 0.02	190 ± 9.3	2.0	0.20
27		730 ± 66	1.30 ± 0.16	160 ± 10	2.0	0.27
28		54% at 10 μM	1.30 ± 0.14	270 ± 2.5	19	0.72
29		1600 ± 129	0.66 ± 0.05	350 ± 51	2.0	1.15
30		55 ± 4.6	4.2 ± 0.34	570 ± 9.8	33	30% at 38.1 mg/kg
31		1400 ± 180	3.8 ± 0.73	31% at 10 μM	42	1.5

Glycopeptide disaccharides and phosphates based on the μ receptor-preferring sequences.

Since the binding affinities and receptor preferences of the μ-selective DAMGO derivatives are similar, the analgesic potencies of the glycopeptides are largely determined by their ability to penetrate the BBB by transcytosis [67], which in turn depends on the biousian character of the drugs [84]. One may consider two extremes that result in poor delivery of a peptide drug:.

• ■ The peptide binds tightly to biological membrane, effectively removing it from solution;

• ■ The peptide remains in aqueous solution, effectively preventing it from binding to biological membranes.

Thus, the goal in producing glycopeptides that are capable of effective CNS delivery, binding and GPCR activation, is to balance the degree of glycosylation, which effectively determines the amount of time the glycopeptide spends on the endothelial membrane of the BBB, as well as other membranes that the glycopep-tide is likely to encounter. Affinity for the membrane is still required for effective binding and activation of the GPCR but a certain amount of membrane hopping is required for effective drug transport. Thus, a plot of the BBB transport or antinociceptive A₅₀ values versus the membrane affinity produced a U-shaped or V-shaped curve (Figure 6).

Unpublished studies in mice showed that disaccharide 29 produced behaviors (Straub tail and hyperlocomotion) suggestive of ‘narcotic intoxication’ at very low doses and had an extreme addiction liability as indicated by naloxone precipitated withdrawal studies. While μ-agonists, such as peptide 26 or glycopeptide 27, could provide some useful clinical features that that morphine and other μ-selective anal-gesics do not possess, there does not seem to be much appetite for adding drugs to the pharmacopeia with side-effect profiles worse than morphine, and that are likely to be extremely addictive.

Kaiser's pioneering studies on the structure of β-endorphin

The late Emil Kaiser led a group of researchers at the Rockefeller Institute (USA) in studies of the structure and function of naturally occurring peptides, focusing their pioneering efforts on endogenous opioid hormones of mammalian origin including β-endorphin [90] and other seemingly diverse peptides from arthropods such as bee venom, or melittin (Figure 7)[91]. In fact, both β-endorphin and melittin interact strongly with biological membranes. It is in understanding the similarities and differences in exactly how these two peptides interact with membranes that will provide a rationale and opportunity for improving peptide drug delivery and effective design of CNS drugs. Our group has incorporated a design strategy for BBB penetration that exploits amphipathic α-helices that can interact strongly with cellular membranes to enhance endocytotic events. Critically, this biousian approach also preserves a degree of hydrophilicity for the overall peptide, especially when it is not interacting with the phospholipid membrane [84].

Figure 7. Representations of the amphipathic helical region in β-endorphin.

(A) Human β-endorphin [12–28] represented both as an α-helical net projection (left) and as a π-helical net projection (right) [90]. The lipophilic (hydrophobic) residues are circled. (B) Human β-endorphin [12–30] represented as an axial projection of a π-helix [91].

All of our glycosylated enkephalins display well-defined secondary structures in sodium dodecyl sulfate (SDS) micelles, irrespective of the identity of the glycoside attached to the peptide, which represent the simplest model for a biological membrane. In contrast, no defined structure is observed in aqueous media (Figure 8a) [92]. Similarly, the longer glycopeptides related to β-endorphin tend to adopt amphipathic helical structures in SDS micelles as well as phospholipid bicelles (Figure 8b) [93]. These larger glycopeptides displayed an ensemble of random coil conformations in aqueous solvent despite they are 17 residues in length. It is evident from these observations that amphipathicity of the glycopeptide (not simply hydrophilic or hydrophobic nature alone) is essential for membrane transport. This biousian behavior (i.e., random coil state in aqueous environment and highly folded state in membrane environment) appears essential for the effective transport of these larger peptides across the BBB [84].

Figure 8.

Micelle-bound structures of glycopeptide analogues determined by NMR related to (A) enkephalins and (B) endorphins [92,93].

Biousian behavior has also been observed for other endogenous GPCR peptide ligands [84,94]. Many, if not all peptide ligands that activate GPCRs lack a well-defined structure in aqueous buffer, but tend to fold into largely α-helical conformations in the presence of organic solvents [95] and lipid micelles [96], and in crystals [97,98]. Inooka and coworkers have been able to demonstrate that micelle-bound conformation of a peptide ligand is closely related to the actual receptor-bound conformation, that is, the α-helical region is similar in both cases [99].

Glycopeptide opioids based on endorphins

Initially, we focused on the importance of the glycoside in the context of the short enkephalin-based glycopeptides to enhance membrane hopping and BBB penetration, as evidenced by peptide 35 compared with glycopeptide (Table 6) [35]. The much larger endorphin-based peptides did not always require glycosylation in order to achieve effective membrane hopping rates to produce effective drug transport (Figure 9). In fact, the glycosylation could have no effect (32 vs 33), or even a deleterious effect on iv. potency (32 vs 34). We think that the flexibility of the linker (proline vs GABA vs DAVA) may play an important role as well, satisfying both the GPCR and the membrane binding requirements. More importantly although, the intrinsic stability of the membrane bound helix can decisively affect drug transport, as evidenced by iv. potency in vivo.

Table 6.

The amphipathic helix address^†.

Compound	Message sequence	Link	Helical address sequence	Ki (nM)			A50
				δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)	Intravenous (μmol/kg)
32	YtFGL	P	NLBEKALKSL-NH2	9.6	2.3	2.8	0.57	0.32
33	YtFGL	P	NLBEKALKS*L-NH2	3.6	2.6	2.3	0.58	0.36
34	YtFGL	P	NLBEKALKS**L-NH2	12.0	8.2	5.7	0.11	1.06
35	YtFGL	GABA	SL-NH2	16	11	38	0.064	(>> 10)
36	YtFGL	GABA	S*L-NH2	39	16	56	0.059	2.29
37	YtFGL	GABA	NLBEKALKSL-NH2	29	31	49	0.143	1.12
38	YtFGL	GABA	NLBEKALKS*L-NH2	4.2	4.3	11	0.046	0.28
39	YtFGL	GABA	NLBEKALKS**L-NH2	4.3	0.97	11	0.165	1.13
40	YtFGL	DAVA	NLBEKALKSL-NH2	32	37	64	0.162	1.41

^†For endorphin analogues 32, 33 and 34, the glycosylation state showed only minor effects on binding and intravenous potency. The addition of a carbohydrate (35 vs 36) clearly shows a dramatic effect on intravenous potency, presumably by affecting transport, and combining the two features into the address region (e.g., 38) provides the best delivery.

S = OH; S* = Glc; S** = Lact.

DAVA: Delta amino valeric acid; GABA: Gamma amino butyric acid; P: Proline.

Figure 9. Biousian behavior in a helix context.

Modulation of amphipathic helix stability should modulate interactions with biological membranes and ‘searching’ for the receptor.

To determine the effect of helix stability a series of opioid C-terminal amide peptide 16-mers 41–47 were prepared using seven different helical segments with a minimal perturbation of the structure. Two amino acid residues (position 8 or 12) were substituted with one of three amino acids; helix-weakening glycine (Gly or G); helix-preferring L-alanine (Ala or A); or strongly helix-preferring α-aminoisobutyric acid (Aib or B) to produce seven different peptides of decreasing helix stability (B~B, B~A, A~B, A~A, A~G, G~A and G~G). Each series of helices was prepared in three different glycosylation states; one peptide series with unglycosylated l-serine (S°); a series of monosaccharides bearing a single β-O-d-glucose (Glc) on l-serine (S*); and a series of disaccharide glycopeptides bearing β-O-lactose (Lact) on l-serine (S**). These closely related seven peptides and 14 glycopeptides were characterized by high field (600 MHz) NMR in the presence of SDS and D₂O/ H₂O, and by circular dichroism in H₂O, H₂O/F₃CCH₂OH (data not shown here), and SDS/H₂O (Figure 10) [100,101]. The degree of helicity was conveniently expressed as%-helicity per residue [102,103]. Note that helicity was essentially absent in aqueous media (Table 7). Peptide 41 was not soluble in H₂O. However, in the presence of SDS micelles there was a clear trend, (Table 8) with B~B strongly favoring helical conformations, G~G disfavoring helical conformations, and intermediate levels of helicity for the others in relatively smooth, although not monotonic, stepwise fashion (Figure 11). The most helical compound, 41, was not soluble in water, but readily dissolved in the presence of SDS.

Figure 10. Circular dichroism to measure helicity.

Modulation of the amphipathic helix stability can be directly measured by examining the circular dichroism behavior in (A) sodium dodecylsulfate, (B) trifluoroethanol and (C) water, and measuring the elipticity at 222 nm.

Table 7.

Intrinsic helix stability in H₂O^†.

Series	Message sequence	Link	Helical address sequence	Helicity per residue in H2O buffer (%)
				S° = OH	S* = Glc	S** = Lact
41	YtFGL	P	NLBEKBLKSo/*/**L-NH2	Not soluble	4.5	0.7
42	YtFGL	P	NLBEKALKSo/*/**L-NH2	12.2	7.5	1.0
43	YtFGL	P	NLAEKBLKSo/*/**L-NH2	7.4	7.0	1.3
44	YtFGL	P	NLAEKALKSo/*/**L-NH2	7.2	6.9	0.1
45	YtFGL	P	NLAEKGLKSo/*/**L-NH2	8.7	0.0	0.0
46	YtFGL	P	NLGEKALKSo/*/**L-NH2	7.1	0.8	0.0
47	YtFGL	P	NLGEKGLKSo/*/**L-NH2	8.1	0.7	0.0

^†Variation in the intrinsic helicity was achieved with minimal impact on other properties by altering only two amino acid residues with B (Aib), A (Ala) or G (Gly). Water solubility could be affected by altering the glycosylation state of the S.

Except for the extremely helical peptides without glycosylation, all of these compounds were highly water soluble, and showed only random coil behavior in aqueous solution.

Aib: α-aminoidobutyric acid; P: Proline; S: Serine.

Table 8.

Amphipathic helix stability in the presence of micelles^†.

Compound	Message sequence	Link	Helical address sequence	Helicity per residue in sodium dodecyl sulfate micelles (%)
				So = OH	S* = Glc	S** = Lact
41	YtFGL	P	NLBEKBLKSo/*/**L-NH2	70	56.7	40.8
42	YtFGL	P	NLBEKALKSo/*/**L-NH2	60.8	44.9	35.7
43	YtFGL	P	NLAEKBLKSo/*/**L-NH2	58.5	35.7	33.6
44	YtFGL	P	NLAEKALKSo/*/**L-NH2	54.4	35.7	31.8
45	YtFGL	P	NLAEKGLKSo/*/**L-NH2	37.8	24.6	13.3
46	YtFGL	P	NLGEKALKSo/*/**L-NH2	33.0	14.5	4.5
47	YtFGL	P	NLGEKGLKSo/*/**L-NH2	11.0	6.4	2.8

^†Helix amphipath stability was greatly altered in the presence of sodium dodecyl sulfate by altering the two amino acid residues with B (Aib), A (Ala) or G (Gly). Water solubility and the degree of helix formation (%-helix/residue) was also affected by altering the glycosylation state of the S.

Aib: α-aminoidobutyric acid; P: Proline; S: Serine.

Figure 11.

Helicity in sodium dodecyl sulfate as a function of peptide address sequence and glycosylation state.

All 21 compounds were characterized in terms of δ/μ/κ-binding, and subjected to the 55°C tail-flick test in mice, both after i.c.v. administration (Tables 9–11). Administration with iv. bolus injection is currently being studied, and the data (not shown) is only preliminary. Although there were only modest variations in the binding selectivity, and in the A₅₀ values obtained after i.c.v. administration (bypassing the BBB), there are large variations in the A₅₀ values obtained after iv. injection, ranging from little or no antinociceptive activity observed at 32 mg/kg down to extremely potent activities with A₅₀ values below 500 μg/kg.

Table 9.

Binding and intracerebroventricular antinociception as a function of helix stability: unglycosylated peptides.

Compound	Message sequence	Link	Helical address sequence	Ki (nM)			A50
				δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)
41*	YtFGL	P	NLBEKBLKSL-NH2	16	8.7	27	1.66
42*/32	YtFGL	P	NLBEKALKSL-NH2	9.6	2.3	2.8	0.57
43*	YtFGL	P	NLAEKBLKSL-NH2	9.7	10	28	0.18
44*	YtFGL	P	NLAEKALKSL-NH2	3.5	2.8	5.5	0.55
45*	YtFGL	P	NLAEKGLKSL-NH2	15	17	49	0.79
46*	YtFGL	P	NLGEKALKSL-NH2	14	21	23	0.96
47*	YtFGL	P	NLGEKGLKSL-NH2	19	14	17	1.92

S = OH; S* = Glc; S** = Lact.

P: Proline; S: Serine.

Table 11.

Binding, intracerebroventricular and intravenous antinociception as a function of helix stability: lactosides

Compound	Message sequence	Link	Helical address sequence	Ki (nM)			A50	A50
				δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)	Intravenous (μmol/kg)
41**	YtFGL	P	NLBEKBLKS**L-NH2	5.9	1.2	2.5	0.57	4.3
42**/34	YtFGL	P	NLBEKALKS**L-NH2	12	8.2	5.7	0.11	1.1
43**	YtFGL	P	NLAEKBLKS**L-NH2	14	3.2	3.5	0.21	1.2
44**	YtFGL	P	NLAEKALKS**L-NH2	2.6	< 1	3.5	0.76	4.1
45**	YtFGL	P	NLAEKGLKS**L-NH2	4.7	0.97	4.3	0.14	8.7
46**	YtFGL	P	NLGEKALKS**L-NH2	13	4.4	6.6	0.50
47**	YtFGL	P	NLGEKGLKS**L-NH2	4.5	1.4	2.6	0.23	> 40

S = OH; S* = Glc; S** = Lact.

P: Proline; S: Serine.

Future perspective

While it would be premature to state that we have a complete understanding of the role of amphipathicity, biousian behavior [84] and membrane affinity in the transport of opioid peptides and glycopeptides, it is clear that the transport of these compounds across biological membranes of interest is not only possible, but quite efficient. It seems clear that the observed transport phenomena will not be limited to this class of neuropeptides, as researchers are exploring glycosylated endomorphins [104], dermorphins [105], dermorphins [106] and other peptides [107] with good results. Thus, we remain optimistic that interest in glycopeptide drugs derived from neuropeptides will increase and that all major pharmaceutical companies will establish research programs in the area.

Executive summary.

• ■ The three opiate receptors, μ, δ and κ receptors, and their endogenous peptide neurotransmitters, the enkephalins and endorphins, play numerous roles in the CNS. Principal among these roles is the modulation of acute and chronic pain states. The endogenous peptide neurotransmitters are highly amphipathic, spending the bulk of their independent existence after cleavage from larger precursor proteins and prior to release stored in vesicles contained within the presynaptic membrane. Upon release they float in the postsynaptic membrane where they bind and activate opiate receptors. The effects of the endogenous peptide ligands are local in nature due to their poor transport properties.

• ■ Glycosylation of the relatively short enkephalins allows them to leave the membrane environment to engage in ‘membrane hopping’. The key is to add a water soluble moiety to the peptide in such a way that it enhances water solubility without interfering with its interaction with the membrane. We have dubbed this effect ‘biousian behavior’ in which the glycopeptide may exist either in a relatively constrained membrane bound state, or an aqueous state as a ‘random coil’ ensemble. The degree of glycosylation can be adjusted to optimize the biological transport rates of the enkephalin-based glycopeptides to provide drugs based on the endogenous enkephalins.

• ■ The biousian behavior permits the glycopeptides and related serine phosphates to penetrate the blood–brain barrier, probably via transcytosis.

• ■ The larger endorphins have a message–linker–address peptide format. The message exists as a turn structure and is largely responsible for receptor binding and activation. The address exists as an amphipathic helix and is largely responsible for binding to the membrane. A flexible linker domain allows the receptor binding requirements and the membrane binding requirements to be met simultaneously. The address domain can be altered in order to optimize the biological transport rates of the endorphin-based glycopeptides based on the endogenous endorphins.

• ■ Peptide sequences can be varied to produce glycopeptide drugs that favor any of the three opiate receptors, or various combinations, such as μ/κ receptors and mixed μ/δ-agonists. Side-effect profiles of the analgesics can be manipulated by altering the agonist features of the enkephalins or the endorphin message segments.

• ■ Glycopeptide-based drugs have been developed that exert analgesic effects in mice far in excess of the classical narcotics, such as morphine, Demerol® and Oxycontin®. We are optimistic that interest in glycopeptide drugs derived from neuropeptides will increase, and that all major pharmaceutical companies will establish research programs in the area. We expect that the applications will not be limited to opiate agonists and that a large number of the 250 plus endogenous neuropeptides can be converted into glycopeptide drugs capable of penetrating the blood–brain barrier.

Table 3.

Linear glycopeptide amides as δ receptor/μ receptor opioid agonists.

Compound	Structure	Ki (nM)			A50
		δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)	Intravenous (μmol/kg)
Morphine		290 ± 38	0.79 ± 0.12	12.0 ± 1.3	2384	7.84
9		4.1 ± 41	1.4 ± 0.08	34.0 ± 2.2	0.068	46.4
10		9.71	11.7	ND	0.038	32.6
11		46.0	65.8	ND	0.092	9.45
12		7.0 ± 1.2	2.4 ± 0.017	49 ± 4.3	0.023	11.4
13		23.0	15.2	ND	0.033	16.7
14		16.8	39.8	ND	0.022	ND
15		54.4	297.8	ND	0.035	ND
16		24.5	31.8	ND	0.040	22.0

Glycopeptide monosaccharides based on DOP-preferring enkephalin sequences developed by BP Roques, DtGFLS (DTLES) and DsGFLT (DSLET).

ND: Not determined.

Table 10.

Binding and intracerebroventricular antinociception as a function of helix stability: glucopeptides.

Compound	Message sequence	Link	Helical address sequence	Ki (nM)			A50
				δ receptor	μ receptor	κ receptor	Intracerebroventricular (nmol)
41*	YtFGL	P	NLBEKBLKS*L-NH2	11	9.1	6.9	1.13
42*/33	YtFGL	P	NLBEKALKS*L-NH2	3.6	2.3	2.6	0.58
43*	YtFGL	P	NLAEKBLKS*L-NH2	14	6.1	12	1.46
44*	YtFGL	P	NLAEKALKS*L-NH2	7.9	6.2	8.9	1.44
45*	YtFGL	P	NLAEKGLKS*L-NH2	6.3	2.2	6.3	1.47
46*	YtFGL	P	NLGEKALKS*L-NH2	5.7	2.9	11	2.54
47*	YtFGL	P	NLGEKGLKS*L-NH2	7.1	3.5	4.4	2.12

S = OH; S* = Glc; S** = Lact.

P: Proline; S: Serine.