Abstract
Acinetobacter baumannii is an emerging cause of nosocomial infections. The isolation of strains resistant to multiple antibiotics is increasing at alarming rates. Although A. baumannii is considered as one of the more threatening “superbugs” for our healthcare system, little is known about the factors contributing to its pathogenesis. In this work we show that A. baumannii ATCC 17978 possesses an O-glycosylation system responsible for the glycosylation of multiple proteins. 2D-DIGE and mass spectrometry methods identified seven A. baumannii glycoproteins, of yet unknown function. The glycan structure was determined using a combination of MS and NMR techniques and consists of a branched pentasaccharide containing N-acetylgalactosamine, glucose, galactose, N-acetylglucosamine, and a derivative of glucuronic acid. A glycosylation deficient strain was generated by homologous recombination. This strain did not show any growth defects, but exhibited a severely diminished capacity to generate biofilms. Disruption of the glycosylation machinery also resulted in reduced virulence in two infection models, the amoebae Dictyostelium discoideum and the larvae of the insect Galleria mellonella, and reduced in vivo fitness in a mouse model of peritoneal sepsis. Despite A. baumannii genome plasticity, the O-glycosylation machinery appears to be present in all clinical isolates tested as well as in all of the genomes sequenced. This suggests the existence of a strong evolutionary pressure to retain this system. These results together indicate that O-glycosylation in A. baumannii is required for full virulence and therefore represents a novel target for the development of new antibiotics.
Author Summary
Multidrug resistant (MDR) Acinetobacter baumannii strains are an increasing cause of nosocomial infections worldwide. Due to the remarkable ability of A. baumannii to gain resistance to antibiotics, this bacterium is now considered to be a “superbug”. A. baumannii strains resistant to all clinically relevant antibiotics known have also been isolated. Although MDR A. baumannii continues to disseminate globally, very little is known about its pathogenesis mechanisms. Our experiments revealed that A. baumannii ATCC 17978 has a functional O-linked protein glycosylation system, which seems to be present in all strains of A. baumannii sequenced to date and several clinical isolates. We identified seven glycoproteins and elucidated the structure of the glycan moiety. A glycosylation-deficient strain was generated. This strain produced severely reduced biofilms, and exhibited attenuated virulence in amoeba, insect, and murine models. These experiments suggest that glycosylation may play an important role in virulence and may lay the foundation for new drug discovery strategies that could stop the dissemination of this emerging human pathogen, which has become a major threat for healthcare systems.
Introduction
Acinetobacter baumannii is a strictly aerobic Gram negative, non-fermentative, opportunistic pathogen. Since the 1970's, this organism has frequently been isolated from healthcare facilities, but was easily controlled with antibiotics [1], [2]. However, many clinical isolates of A. baumannii have recently emerged with extreme resistance to antibiotics, disinfectants, and desiccation, which has permitted A. baumannii to disseminate throughout healthcare facilities worldwide [3]–[7]. One recent study showed that from 2001 to 2008 the percentage of A. baumannii isolates resistant to at least three classes of antibiotics increased from 4% to 55%, and 17% of all isolates were resistant to at least four drug classes [8]. Panresistant strains of A. baumannii have also been isolated [9]. Because of its importance as an emerging pathogen, attention towards A. baumannii has increased considerably. Most of the efforts have focused on antibiotic resistance mechanisms, but little is known about its virulence factors. A significant amount of work has been done to characterize biofilm formation, which seems to play a role in pathogenesis [10], [11]. Other suggested virulence factors for A. baumannii include the capsule, exopolysaccharide, pili and lipopolysaccharide (LPS) [11]–[14]. Undoubtedly, more research is needed in order to understand A. baumannii pathogenesis.
Genomic analysis of all sequenced A. baumannii strains revealed the presence of homologous genes to those encoding enzymes involved in the Neisseria meningitidis protein O-glycosylation system. Many different mucosal pathogenic bacteria require protein glycosylation for virulence, and glycoproteins seem to play a role in adhesion, motility, DNA uptake, protein stability, immune evasion, and animal colonization [15]. Whereas N-glycosylation seems to be restricted to epsilon and a few delta proteobacteria, O-glycosylation appears to be more widespread among bacteria. Gram negative bacteria including Neisseria spp. and Bacteroides fragilis employ en bloc O-glycosylation as a general system to modify multiple proteins [16], [17]. En bloc O-glycosylation is initiated by a specialized glycosyltransferase that attaches a nucleotide-activated monosaccharide-1P to an undecaprenolphosphate (Und-P) lipid carrier on the inner face of the inner membrane. A series of glycosyltransferases subsequently attach additional monosaccharides to the first sugar residue on Und-PP. When the carbohydrate structure is completed, the Und-PP linked glycan is flipped to the periplasmic face, where an O-oligosaccharyltransferase (O-OTase) transfers the carbohydrate to selected Ser or Thr residues in acceptor proteins [18], [19]. Campylobacter jejuni employs a similar N-glycosylation pathway to modify about 65 proteins [20].
This work demonstrates the existence of a general O-glycosylation system in A. baumannii ATCC 17978, which is required for efficient biofilm formation and pathogenesis in the Dictyostelium discoideum, Galleria mellonella, and murine septicemia virulence models. We identified seven glycoproteins carrying a branched pentasaccharide, the structure of which has been characterized by MS and NMR techniques. O-glycosylation appears to be ubiquitous in A. baumannii, which suggests that this system might be a possible target for novel antimicrobial treatments.
Results
Identification of an O-OTase homologue in A. baumannii and construction of an in-frame knockout mutant
We initially searched the A. baumannii ATCC 17978 genome for homologues of known O-OTases. Via a BLAST analysis, we identified a homolog to the N. meningitidis O-OTase PglL (A1S_3176; E-value 1e-9) that contained a Wzy_C motif. This motif is conserved in all O-OTases, but is also found in WaaL ligases, which catalyze the transfer of the O antigen to the Lipid A core [21], [22]. To date, only experimental determination allows the assignment of an ORF containing the Wzy_C motif as either an O-OTase or a ligase [23]. No other ORFs contained a Wzy_C motif in the A. baumannii ATCC 17978 genome. A1S_3176 is not predicted to be part of an operon [24]. We carried out mutagenesis of the A1S_3176 gene by homologous recombination to evaluate if its encoded protein is an O-Otase or a WaaL ligase. PCR and DNA sequencing confirmed the creation of an A1S_3176 knockout strain, in which the targeted gene was replaced with a gentamicin resistance cassette. There was no significant difference between the growth curves of the wild-type and the A1S_3176 mutant strains at 37°C, indicating that growth in these conditions was not affected by the mutation (Data not shown).
A1S_3176 (PglLAb) is required for glycosylation of membrane proteins in A. baumannii ATCC 17978
Most of the Neisseria O-glycoproteins identified to date are associated to membranes [16]. Membrane extracts from wild type and ΔA1S_3176 A. baumannii strains were analyzed by SDS-PAGE followed by PAS staining, a technique that is specific for detecting glycans, but presents low sensitivity (Fig. 1). A broad band migrating from 25 to 35 kDa was visualized in the extract of A. baumannii WT. Although the membrane protein profile between the WT and the ΔA1S_3176 strains appeared similar, the band detected via PAS stain was not visible in the mutant strain, suggesting that A1S_3176 is required for glycosylation of at least one protein (Fig. 1B). The PAS-reactive band disappeared upon treatment with proteinase K, associating the glycan signal with proteinaceous material. Complementation of A1S_3176 was achieved in trans, and analysis of A. baumannii ΔA1S_3176-pWH1266-pglL membrane extract showed the reappearance of the PAS stained band. Due to the aforementioned similarity between O-OTases and ligases, we carried out a conventional LPS extraction and analyzed the extract of the different strains via SDS-PAGE. Silver stain showed no obvious differences in the carbohydrate pattern were observed, suggesting that A1S_3176 is not involved in LPS synthesis (Fig S1). To further determine if A1S_3716 effected LPS biosynthesis, whole cells were digested with proteinase K and analyzed by Silver stain and no differences were observed (data not shown). However, it has been reported that the O-antigen chains of certain A. baumannii strains are not detectable by Silver stain and therefore we cannot conclusively exclude a role of A1S_3176 in LPS synthesis [25]. Together these results suggest that A1S_3176 is an O-OTase responsible for O-glycosylation in A. baumannii and will be referred from here on as PglLAb, as per its N. meningitidis ortholog.
Identification of two glycoproteins in A. baumannii via 2D-DIGE and preliminary characterization of the O-glycan by MALDI-TOF/TOF MS and MS/MS analysis
To identify the glycoprotein(s) in A. baumannii, we performed two dimensional in-gel electrophoresis (2D-DIGE) experiments [26]. Membrane samples of both WT and ΔpglL were isolated by ultracentrifugation and the lipidic components were removed as previously described [27]. Most of the signals corresponding to the wild type (Fig. 2A, green) and ΔpglL (Fig. 2B, red) proteins co-localized in the gel (Fig. 2C, yellow), indicating that these proteins were likely not glycosylated. However, a few proteins exhibited differential electrophoretic behavior (Fig. 2). These proteins spots were excised, in-gel digested, and analyzed by MALDI-TOF/TOF MS and MS/MS. We identified two separate pairs of proteins, which according to their electrophoretic migration, appeared to be larger and more acidic in the WT strain (WT1 and WT2) than in the ΔpglL strain (MT1 and MT2). Mass spectrometric analysis determined WT1 and MT1 samples to be A1S_3626 protein, whereas WT2 and MT2 were identified as A1S_3744 protein. Both, A1S_3626 and A1S_3744 are annotated as hypothetical proteins, and BLAST searches yielded homologues exclusively within the Acinetobacter genus.
Analysis of the MALDI-TOF MS spectra of a tryptic digest of WT1 (A1S_3626) revealed a peptide fragment of 2895.24 Da that was absent in MT1 (Fig. 3A). MALDI-TOF-TOF MS/MS of this ion determined that in the wild-type strain the peptide SAGDQAASDIATATDNASAK was linked to the glycan HexNAc-Hex-Hex-(HexNAc)-300, where 300 corresponded to an unknown residue of m/z 300, whereas the same peptide was unmodified in ΔpglL sample (Fig S3A). Similarly, MALDI-TOF MS analysis of a tryptic digest of WT2 (A1S_3744) revealed a peptide fragment of 3852.69 Da that was absent in MT2 (Fig. 3B). MALDI-TOF-TOF MS/MS of the 3852.69 Da peak revealed the same pentasaccharide identified on A1S_3626 on the peptide ETPKEEEQDKVETAVSEPQPQKPAK (2822.33 Da), whereas the same peptide was unmodified in ΔpglL sample (Fig S3B).. We next purified membranes from A. baumannii, digested the sample with Pronase E, and enriched glycosylated peptides using activated charcoal microspin columns. We identified a peak in the MALDI-TOF MS of 1358.4 m/z that was subsequently analyzed by MALDI-TOF/TOF MS/MS (Fig. 3C). Manual peak annotation identified the previously characterized pentasaccharide attached to a sodiated tripeptide containing the amino acids A, T and D. Overall, these results demonstrate that PglL Ab glycosylates at least two different proteins with a pentasaccharide with a preliminary structure of HexNAc-Hex-Hex-(HexNAc)-300.
We observed other spots possibly corresponding to proteins migrating differently in A. baumannii WT and ΔpglL strains. The most prominent was marked as WT3, and was observed only in the WT extract (Fig. 2C). Mass spectroscopy analysis determined this spot corresponded to OmpA (A1S_2840). However, manual analysis using MS/MS of WT3 indicated that OmpA was not glycosylated. Western blot analysis of whole cell extracts of the WT and ΔpglL strains revealed no difference in OmpA expression levels, which implies that manipulation of membrane samples could account for apparent differences observed in expression levels of proteins detected by 2D-DIGE (Fig S2).
Identification of additional O-glycosylated proteins in A. baumannii ATCC 17978 by zwitterionic hydrophilic interaction chromatography (ZIC-HILIC) MS/MS
To determine if additional glycoproteins were present in A. baumannii ATCC 17978, we employed ZIC-HILIC glycopeptide enrichment. Utilizing membrane extracts previously shown to contain A1S_3626 and A1S_3744 putative glycopeptides were enriched and analyzed using an LTQ-Orbitrap Velos. HCD scans containing oxonium ion were manually inspected and searched using MASCOT resulting in the identification of at least 9 different glycosylation sites on 7 different glycoproteins in A. baumannii ATCC 17978 (Table 1; Fig. 4). This peptide-centric approach enabled multiple novel glycoproteins to be identified of which six of the seven proteins are annotated as uncharacterized hypothetical proteins, with the remaining being annotated as MotB (A1S_1193). (Table 1). This demonstrates that PglLAb is able to glycosylate multiple proteins in A. baumannii ATCC 17978.
Table 1. Identification of seven O-glycosylated proteins with nine unique glycosylation sites by ZIC HILIC enrichment of tryptically digested A. baumannii ATCC 17978 membrane extracts.
Precursor m/z [Da] | MH+ [Da] | Charge | Peptide mass [Da] | Mascot Ion score | Sequence | protein name | Annotation for A. baumannii ATCC 17978 |
749.02 | 2245.040 | 3 | 1214.68 | 31 | 301AKPASTPAVKSAS313 | Putative uncharacterized protein | A1S_0556 |
1000.47 | 1999.943 | 2 | 969.57 | 49 | 301AKPASTPAVK310 | Putative uncharacterized protein | A1S_0556 |
999.95 | 3996.794 | 4 | 2966.41 | 40 | 108AAQADKKTEASAAATTEQQDSFDAQVQR135 | Putative uncharacterized protein | A1S_0556 |
1090.53 | 5448.631 | 5 | 4418.21 | 39 | 203AASGVEAAAAPATLTLSTDDKGAVSQCQAGIGDQGFLATLQTQVK247 | OmpA/MotB | A1S_1193 |
1144.20 | 3430.587 | 3 | 2400.20 | 81 | 78NLQKAEDQNADSGIAASTPVATAK101 | Putative uncharacterized protein | A1S_2371 |
1344.64 | 4031.899 | 3 | 3001.51 | 86 | 72ASTTLQNLQKAEDQNADSGIAASTPVATAK101 | Putative uncharacterized protein | A1S_2371 |
1469.05 | 4405.132 | 3 | 3374.73 | 51 | 22ASTTEQPLNPNKVSAPVEDPIDPLAVDAASTVK54 | Putative uncharacterized protein | A1S_2371 |
1210.52 | 2420.037 | 2 | 1389.66 | 53 | 52SDAVGSASEAAPATR66 | Putative uncharacterized protein | A1S_3580 |
1281.56 | 2562.115 | 2 | 1531.73 | 74 | 50AASDAVGSASEAAPATR66 | Putative uncharacterized protein | A1S_3580 |
1283.06 | 2565.111 | 2 | 1534.73 | 47 | 52QAASDIATATDNASAK67 | Putative uncharacterized protein | A1S_3626 |
1406.62 | 4217.856 | 3 | 3187.46 | 77 | 48SAGDQAASDIATATDN(+1)ASAKIDAAADHAADATAK81 | Putative uncharacterized protein | A1S_3626 |
965.75 | 2895.252 | 3 | 1864.85 | 51 | 48SAGDQAASDIATATDNASAK67 | Putative uncharacterized protein | A1S_3626 |
1054.98 | 4216.890 | 4 | 3186.48 | 66 | 48SAGDQAASDIATATDNASAKIDAAADHAADATAK81 | Putative uncharacterized protein | A1S_3626 |
755.54 | 3019.146 | 4 | 1988.77 | 24 | 28NDGM(+16)HEASDPATSHDM(+16)NK45 | Putative uncharacterized protein | A1S_3658 |
996.39 | 2987.158 | 3 | 1956.78 | 80 | 28NDGMHEASDPATSHDMNK45 | Putative uncharacterized protein | A1S_3658 |
797.81 | 3188.233 | 4 | 2157.86 | 22 | 28NDGMHEASDPATSHDMNKNS47 | Putative uncharacterized protein | A1S_3658 |
1001.72 | 3003.153 | 3 | 1972.78 | 42 | 28NDGM(+16)HEASDPATSHDMNK45 | Putative uncharacterized protein | A1S_3658 |
1133.18 | 3397.538 | 3 | 2367.17 | 44 | 29EEEQDKVETAVSEPQPQKPAK49 | Putative uncharacterized protein | A1S_3744 |
880.42 | 2639.232 | 3 | 1608.86 | 55 | 35VETAVSEPQPQKPAK49 | Putative uncharacterized protein | A1S_3744 |
Structure determination of the O-linked glycan by 2D NMR
Identification of the O-glycan of A. baumannii ATCC 17978 was achieved by 2D NMR analysis. The Pronase E digested membrane protein extracts characterized in Fig. 3C were analyzed by 1H:13C HSQC 2D NMR and revealed the structure of the pentasaccharide to be β-GlcNAc3NAcA4OAc-4-(β-GlcNAc-6-)-α-Gal-6-β-Glc-3-β-GalNAc-, with the amino acids S, E, and A attached in any combination (Fig S4, Table 2). β-GlcNAc3NAcA4OAc (corresponding to m/z 300; Fig. 3) is an O-acetylated derivative of glucuronic acid, and can account for the more acidic migration of the WT glycoproteins compared to the ΔpglL in the 2D-DIGE analysis.
Table 2. 1H∶13C HSQC 2D NMR data for the characterization of the A. baumannii 17978 O-glycan.
Unit | H/C-1 | H/C-2 | H/C-3 | H/C-4 | H/C-5 | H/C-6a;b | |
Gal A | H | 4.95 | 3.68 | 3.94 | 4.12 | 4.02 | 3.78; 4.12 |
C | 99.3 | 69.8 | 70.6 | 79.1 | 70.8 | 72.3 | |
GlcNNA B | H | 4.84 | 3.92 | 4.20 | 4.96 | 3.99 | |
C | 103.4 | 54.5 | 53.9 | 71.9 | 76.0 | 174.4 | |
GlcNNA B′ | H | 4.81 | 3.79 | 3.99 | 3.64 | 3.88 | |
C | 103.5 | 55.0 | 56.1 | 71.1 | |||
GalNAc C | H | 4.58 | 4.07 | 3.87 | 4.14 | 3.70 | 3.77; 3.80 |
C | 101.9 | 52.0 | 81.4 | 69.0 | 76.1 | 62.2 | |
Glc D | H | 4.53 | 3.30 | 3.47 | 3.50 | 3.61 | 3.69; 3.88 |
C | 105.7 | 74.0 | 76.9 | 70.6 | 75.5 | 66.8 | |
GlcNAc E | H | 4.50 | 3.70 | 3.52 | 3.45 | 3.45 | 3.77; 3.94 |
C | 103.1 | 56.7 | 75.2 | 71.0 | 77.0 | 61.8 | |
Ser | H | 4.30 | 4.14; 4.14 | ||||
C | 178.2 | 54.3 | 68.1 | ||||
Glu | H | 4.45 | 2.02; 2.14 | 2.51; 2.51 | |||
C | 178.4 | 54.2 | 27.7 | 31.4 | |||
Ala | H | 4.42 | 1.42 | ||||
C | 175.9 | 51.0 | 17.7 | ||||
Ala* | H | 4.31 | 1.42 | ||||
C | 178.4 | 51.0 | 17.7 |
*: Indicates impurity.
PglLAb is required for efficient biofilm formation
It has been suggested that biofilm formation is important for A. baumannii virulence [28]. We tested if O-glycosylation has an impact on biofilm formation in this organism. Biofilm formation was detected using crystal violet staining and quantitatively analyzed by comparing the ratio between cell growth (OD600) and biofilm formation (OD580) at 30°C after 48 hours incubation (Fig. 5A). High absorbance values corresponding to a strong ability to create biofilms (1.23±0.48 and 1.12±0.40) were obtained for the WT strain and the ΔpglL strain complemented in trans respectively. On the contrary, the ΔpglL strain and the ΔpglL strain transformed with pWH1266 exhibited severely reduced levels of absorbance (0.18±0.07 and 0.20±0.04). Similar results were also observed at 37°C (data not shown). We further characterized the role of O-glycosylation in biofilm formation by employing a flow cell system. A. baumannii strains were stained with the green fluorescent stain SYTO 9, visualized by confocal laser scanning microscopy, and quantitative analysis of the biofilms was performed with COMSTAT. Assessment of the initial attachment after 2 hours shows that ΔpglL strain and vector control had significantly less surface coverage (4.12% and 2.32% respectively) than the WT and in trans complemented strain (6.41% and 6.45% respectively; Fig. 5B). Confocal microscopy and subsequent analysis of biofilms biomass, as well as average and maximal thickness after 24 hours showed significantly higher levels for the WT compared to the ΔpglL strain, and the phenotype was restored to WT levels when pglLAb was complemented in trans (Fig. 5 C, D, E, F; *P<0.05). These data indicate that the A. baumannii strain defective in O-glycosylation has a severely diminished capacity to form biofilms.
PglLAb is required for virulence towards Dictyostelium discoideum, and Galleria mellonella
Two well-established virulence models for A. baumannii are the D. discoideum predation and the G. mellonella infection models [5], [29]–[33]. D. discoideum is an unicellular amoeba that feeds on bacteria and previous work has demonstrated similarity between phagocytosis of the amoebae and mammalian phagocytes [34]. We examined if protein glycosylation was required for virulence towards D. discoideum by co-incubation of A. baumannii strains with the amoebae on SM/5 nutrient agar. A. baumannii was previously shown to inhibit amoebae growth in the presence of 1% ethanol [5]. The WT strain was virulent and inhibited all D. discoideum growth in the presence of 1% ethanol, which resulted in no plaque being formed. However the ΔpglL strain was avirulent towards the amoeba, which resulted in plaque formation in the bacterial lawn within 48 hours and clearing of the plate within 4–5 days (Fig S5). G. mellonella have been used to study many host-pathogen interactions, and have several advantages over other virulence models including the presence of both humoral (ie. antimicrobial peptides) and cellular immune response systems (phagocytic cells) [32]. Most importantly, a correlation has been established between the virulence of several bacteria in G. mellonella and mammalian models [35], [36]. For the G. mellonella, while a similar bacterial load (2.31±1.13×105 CFU) was injected for each of the strains, only the WT and complemented strains were able to kill the wax moth larvae after 36 hours, (20% and 0% survival), whereas larvae injected with ΔpglL and the ΔpglL vector control strains had significantly higher survival rates (100% and 80%; Fig. 6). The LD50 of the WT and complemented strains were determined to be approximately 2.6×104 and 1.4×104 respectively after 36 hours. No additional killing was observed in the ΔpglL or vector control strains up to 96 hours. A PBS injected control maintained 100% survival throughout the length of the virulence assay. These results demonstrate a critical role for O-glycosylation in the virulence of A. baumannii in these two model systems.
PglLAb is required for competitive fitness in BALB/c mice
We then tested A. baumannii ΔpglL virulence in vivo using a previously described murine septicemia competition model [37]–[39]. We first determined the LD50 of A. baumannii ATCC 17978 strain by injecting groups of 5 BALB/c mice with serially diluted bacteria cultures (Fig. 7A). A very small dose range between full survival and full killing was observed, and the LD50 was determined to be 6.49×104 CFU/mouse. The competition index (CI) was defined as the number of ΔpglL CFUs recovered/number of WT CFUs recovered, divided by the number of ΔpglL CFUs inoculated/number of WT CFUs inoculated. Cultures of each strain were mixed at a ratio of 1∶1, serial diluted, and plated to determine the initial CI. 1×105 CFU of the mixed strains were injected intraperitoneally into the BALB/c mice, which were subsequently sacrificed 18 hrs post injection. The spleens were aseptically harvested, serial diluted, and plated. All of the mice had a high spleen CFU load of 3.75±2.37×108 CFU/gram and were moribund at the time of sacrifice. While the initial prescreen showed a CI of 1.18±0.21 favoring the ΔpglL mutant, the spleen counts after 18 hrs showed a CI of 0.10±0.03 (Fig. 7B). This data suggests that Ab ΔpglL has a competitive disadvantage as compared to the WT strain. Together, these results indicate that A. baumannii strains lacking O-glycosylation are attenuated in mice.
Protein glycosylation appears to be ubiquitous in Acinetobacter sp
To determine the degree of conservation of the O-glycosylation system in Acinetobacter sp., we searched for the presence of PglLAb homologues in different species within the genus. This genomic search showed that PglLAb was present in all the genomes analyzed with high sequence homology (Fig S6A). We obtained eight clinical isolates from the University of Alberta Hospital. The isolates were identified by 16S rDNA and recA sequencing to be different species within the Acinetobacter genus (A. baumannii, A. nosocomialis, A. pittii, and A. calcoaceticus). Membranes of these strains were purified and analyzed by PAS staining for the presence of glycoproteins (Fig S6B). While there appears to be variation in the size and intensity of the PAS stained band, all the isolates were positive for glycoproteins, demonstrating that PglLAb was active in all these strains. This indicates that despite the plasticity of Acinetobacter sp. genomes [40], there is a strong evolutionary pressure to retain a functional O-glycosylation system.
Discussion
Isolation of MDR strains of A. baumannii is increasing at impressive rates. Despite its growing incidence as nosocomial pathogen, only a few A. baumannii virulence factors have been characterized. In this article we describe a general O-glycosylation system in A. baumannii ATCC 17978. Although once considered rare in prokaryotes, both N- and O-glycoproteins are present in all domains of life. In most bacterial species known to synthesize glycoproteins, glycosylation is restricted to a few proteins including adhesins, flagellins or pilins [15]. Only a few “general” glycosylation systems in which more than a single protein is glycosylated have been characterized. C. jejuni N-glycosylates more than 65 proteins with the same heptasaccharide. Inactivation of the glycosylation pathway does not have an effect on growth in vitro, but does reduce adhesion and invasion to cells in culture, and affects chicken and mice colonization [41]. Neisseria gonorrhoeae is able to O-glycosylate at least 12 proteins with a highly variable glycan structure [42]. The glycan has recently been shown to be important for infection of cervical epithelial cells [43]. Bacteroides fragilis also has a general O-glycosylation system, where hundreds of proteins are predicted to be glycosylated [44]. Inactivation of the glycosylation system results in severe growth defects in vitro [17]. It was then not surprising to see that the glycosylation mutant strain was outcompeted by the wild-type strain in gnotobiotic mice colonization experiments. Seven proteins are shown to be O-glycosylated by the PglL OTase encoded by the A1S_3176 gene. Cells unable to perform protein glycosylation do not show any differential growth phenotype in vitro, while exhibiting a diminished capacity to form biofilms and reduced virulence in D. discoideum, G. mellonella, and murine septicemia pathogenesis models systems.
Two glycoproteins were identified using 2D-DIGE. To our knowledge, this is the first time this technique is applied to study bacterial glycoproteomics. The structure of the glycan used to decorate these proteins in A. baumannii was determined by a combination of MS and NMR techniques. The sugar was determined to be a pentasaccharide of the formula β-GlcNAc3NAcA4OAc-4-(β-GlcNAc-6-)-α-Gal-6-β-Glc-3-β-GalNAc-S/T (Fig S4). The glycan contains a terminal O-acetylated glucuronic acid derivative that is negatively charged and has not previously been described. A similar monosaccharide was found in Pseudomonas aeruginosa and Bordetella pertussis [45]. Of the glycoproteins identified, only one (A1S_1193; MotB) has any significant homology outside of the genus Acinetobacter, with the remaining being annotated as hypothetical proteins. MotB has homology with proteins such as Pal from Haemophilus influenzae that have been shown to bind to peptidoglycan and stabilize the outer membrane [46]. Functional characterization of A. baumannii glycoproteins will be crucial to explain the phenotypes associated with lack of glycosylation.
Biofilms are proposed to be a virulence factor that is associated with increased antibiotic resistance, pathogenicity, and persistence of a bacterial population [47]–[49]. We have found that O-glycosylation enhances biofilm formation by A. baumannii ATCC 17978. Biofilm formation is a multistep process that involves an initial weak association leading to an irreversible attachment, which leads eventually to a complex maturation into sophisticated superstructures [50]. We observed by flow cell and confocal imaging that glycosylation enhances the initial attachment as well as mature biofilm mass and density. It is tempting to speculate that glycans of the glycoproteins may have a function in cell-to-cell adhesion [51]. Further work will elucidate in which aspect protein glycosylation is required for efficient biofilm formation.
The basic mechanisms of phagocytic cells are used in both amoebae and mammalian macrophages. As an infection model, the amoebae D. discoideum is considered a primitive macrophage. D. discoideum cells were unable to predate on A. baumannii WT lawns, but were able to efficiently predate on lawns of the glycosylation-deficient bacteria. It is uncertain how protein O-glycosylation protects A. baumannii from D. discoideum but we can hypothesize that glycosylation may help in the inhibition of phagocytosis by the amoebae, and/or prevent bacterial lysis by reactive oxygen species produced by the amoebae [52]. Another possibility is that glycosylation of certain proteins is required to interfere with bacterial degradation and intracellular vesicle transport and/or fusion, as shown for Legionella [53]. We also analyzed if protein O-glycosylation plays a role in pathogenesis in G. mellonella caterpillars. This model system has been recently shown to recreate the mammalian humoral immune system, with similar antimicrobial peptides, toll-like receptors, and the complement-like mechanism of melanization [54]. Similar to the D. discoideum model, A. baumannii ΔpglL strain was unable to kill G. mellonella. O-glycosylation could mediate killing of the larvae by stabilizing the bacterial outer membrane of A. baumannii, which could prevent killing by antimicrobial peptides. The negative charges of the glycan chains could play a role in this process. Alternatively, glycosylation could mask signals detected by the larvae or prevent phagocytosis by G. mellonella haemocytes, among other possibilities. The involvement of glycoproteins in virulence is further supported by the demonstration that the ΔpglL strain is outcompeted by wild type bacteria in a murine septicemia model. Thus, our experiments showed that glycosylation is critical for virulence in three different model systems. Further work using strains carrying mutations in individual glycoproteins will help to elucidate the exact role of protein glycosylation in pathogenesis.
Glycoproteins are usually immunodominant in bacteria, and therefore, the glycoproteins identified in this study may be the base of future vaccine formulations and diagnostic methods. The prevalence of the O-glycosylation machinery in Acinetobacter sp., together with its role in virulence in the three different pathogenesis models, suggest that protein O-glycosylation represents a novel target for the development of antibiotics that could be key to prevent further dissemination of this emerging human pathogen, which has become a major threat to our healthcare systems.
Materials and Methods
Bacterial strains, plasmids, growth conditions, and antimicrobial agents
The bacterial strains and plasmids used in this study are listed in Table 3. A. baumannii strains were grown in Luria Bertani broth/agar at 37°C. The antibiotics ampicillin (Ap) 100 µg/mL, gentamicin (Gm) 50 µg/mL, and tetracycline (Tc) 5 µg/mL were added for selection as needed.
Table 3. List of strains, plasmids, and primers used in this work.
Strains | Reference |
A. baumannii ATCC 17978 | [68] |
A. baumannii ATCC 17978 ΔpglL | This work |
Construction of A. baumannii ΔpglL knockout and in trans complementation
In order to create a ΔpglL via homologous recombination, we cloned a ∼3500 bp fragment consisting of ∼1000 bp upstream and downstream of A1S_3176 into pEXT20 using primers K/O pglL fwd and K/O pglL rev from A. baumannii ATCC 17978 genomic DNA (Table 3). The construct was subsequently subcloned from pEXT20 into pFLP2. We then digested pFLP2-pglL with PsiI and replaced A1S_3176 with a SmaI excised Gentamicin resistance cassette (aacC1) from pSPG1 [55]. The plasmid pFLP2 does not replicate in A. baumannii ATCC 17978. This final construct was transformed into electro-competent A. baumannii WT cells and selection for a single recombination event was analyzed using media supplemented with gentamicin. Positive colonies were grown in 5 mL LB at 37°C for 72 hours, with 1/1000 re-inoculations into fresh LB media every 24 hour period. After 72 hours, the liquid culture was plated on LB agar supplemented with gentamicin and 10% sucrose to select for a double recombination event. Colony PCR using both internal and external primers showed the allelic exchange of A1S_3176 with aacC1, generating a knockout mutant of A. baumannii pglL.
SDS-PAGE and Periodic acid stain (PAS) analysis of membrane extracts
Bacterial cultures were pelleted by centrifugation for 15 mins at 10,000×g, washed with PBS, resuspended in PBS, and subsequently lysed by French Press. Unbroken cells were pelleted by centrifugation for 15 mins @ 5,000×g. The supernatant was ultracentrifugated for 1 hr @ 100,000×g (4°C) to pellet cell membrane. Samples were quantified by Bradford protein quantification (Biorad) and analyzed on a 12% SDS-PAGE. The PAS stain protocol used was previously described [56].
LPS extraction protocol
LPS was extracted according to Marolda et al [57]. Samples were resuspended in 50 µL of dH20 and analyzed by Silverstain on a 15% SDS-PAGE.
2D-DIGE analysis of A. baumannii membrane extracts
Lipid-free membranes were obtained for 2D-DIGE analysis according to [27]. The material was resuspended in: 6.5 M Urea, 2.2 M thiourea, 1% w/v ASB-14, 5 mM Tris-HCl pH 8.8, 20 mM DDT, 0.5% IPG buffer. The samples were labeled using CyDye minimal labeling protocol (Amersham Biosciences). A. baumannii WT membranes were labeled with Cy5 and ΔpglL were labeled with Cy3. Samples were quantified by 2D-Quant kit (GE Healthcare) and 600 µg of each WT and ΔpglL membranes were mixed in Destreak solution (GE Healthcare) to a final volume of 450 µL. 24 cm pH 3–11 NL IPG strips were simultaneously rehydrated and sample loaded for 24 hrs at room temperature in the dark. Isoelectric focusing was done using the Ettan IPGphor system for a total of 56,000 Vhr in the dark. The strip was then incubated in 10 mL of equilibration solution (2% SDS, 50 mM Tris-HCl, 6 M Urea, 30% (v/v) glycerol, 0.002% bromophenol blue) for 15 mins with 100 mg DTT and then 10 mL equilibration solution with 250 mg iodoacetamide. The strip was then sealed into a DALT 12.5 precast gel with 0.5% agarose. The system was run at 2.5 W/gel for 30 mins, the 17 W/gel until the dye front exited the bottom. The gel was visualized using FLA-5000 (FujiFilm) and the images analyzed by ImageQuant 5.0. The gel was subsequently stained with Coomassie brilliant blue, and individual spots excised and prepared for mass spectrometry.
MALDI-TOF/TOF MS and MS/MS analysis of glycoproteins
Samples were in gel tryptically-digested and the peptides were desalted using C18 Zip-Tips and eluted with 60% CH3CN/40% H2O. Samples were spotted on a Bruker Daltonics MTP ground steel or Bruker Daltonics MTP AC600 Anchorchip target plate and air dried. 1 µL for ground steel and 0.4 µL for the AC600 target of 2,5-dihydroxybenzoic acid (DHB, 10 mg/mL in 30% H2O, 70% CH3CN) was spotted on top and allowed to dry. Mass spectra were obtained in the positive mode of ionization using a Bruker Daltonics (Bremen, GmbH) UltrafleXtreme MALDI TOF/TOF mass spectrometer. The FlexAnalysis software provided by the manufacturer was used for analysis of the mass spectra.The MS/MS spectra were obtained manually. The exact m/z used as the precursor m/z for MS/MS was determined first on a Bruker Daltonics (Billerica, MA) Apex Qe MALDI FTICR MS instrument and the MS/MS spectrum was automatically re-calibrated based upon this m/z.
MALDI TOF-TOF MS characterization of the A. baumannii O-glycan from membrane extracts
Lipid free membrane extracts were digested for 72 hrs at 37°C with 2 µL Pronase E (20 mg/mL) being freshly added every 24 hrs. Glycosylated peptides were enriched using Active Charcoal Micro SpinColumn (HARVARD Apparatus) Briefly, the column was prewashed 3× with 400 µL of 0.1% TFA in of 80% ACN and 20% ddH2O and centrifuged at 500 RCF for 2 minutes. The column was equilibrated 3× using 400 µL of H2O. The sample was loaded 3× at 500 RCF for 2 minutes. The column was washed 2× with 200 µL of ddH2O at 500 RCF for 2 minutes. The glycan was eluted 3× with 100 µL 0.1% TFA in 50% ACN and 50% H2O at 1000 RCF for 2 minutes. The sample was dried by vacuum centrifugation and analyzed by MALDI-TOF/TOF MS and MS/MS.
Purification of glycans for NMR analysis
For NMR analysis glycoproteins were digested with a large excess of proteinase K at pH 8 (adjusted by addition of ammonia) at 37°C for 48 hours. Products of digestion or free oligosaccharides were separated on Sephadex G-15 column (1.5×60 cm) and each fraction eluted before salt peak was dried and analyzed by 1H NMR. Fractions containing desired products were separated by anion exchange chromatography on Hitrap Q column (5 mL size, Amersham) and glycan eluted with a linear gradient of NaCl (0–1 M, 1 h). Desalting was performed on Sephadex G15 prior to analysis by NMR.
NMR spectroscopy analysis
NMR experiments were carried out on a Varian INOVA 600 MHz (1H) spectrometer with 3 mm gradient probe at 25°C with acetone internal reference (2.225 ppm for 1H and 31.45 ppm for 13C) using standard pulse sequences DQCOSY, TOCSY (mixing time 120 ms), ROESY (mixing time 500 ms), HSQC and HMBC (100 ms long range transfer delay). AQ time was kept at 0.8–1 sec for H-H correlations and 0.25 sec for HSQC, 256 increments was acquired for t1. Assignment of spectra was performed using Topspin 2 (Bruker Biospin) program for spectra visualization and overlap. Monosaccharides were identified by COSY, TOCSY and NOESY cross peak patterns and 13C NMR chemical shifts. Aminogroup location was concluded from high field signal position of aminated carbons (CH at 45–60 ppm). Connections between monosaccharides were determined from transglycosidic NOE and HMBC correlations.
Protease digestion and enrichment of glycopeptides by zwitterionic hydrophilic interaction chromatography (ZIC-HILIC)
Dried membrane protein-enriched fractions were resuspended in 6 M urea, 2 M thiourea, 40 mM NH4HCO3. Samples were reduced, alkylated, digested with Lys-C (1/200 w/w) and then trypsin (1/50 w/w) as described previously [20]. Digested samples were then dialyzed against ultra-pure water overnight using a Mini Dialysis Kit with a molecular mass cut off of 1000 Da (Amersham Biosciences, Buckinghamshire, UK) and on completion were collected and lyophilized. ZIC-HILIC enrichment was performed according to [20] with minor modifications. Micro-columns composed of 10 µm ZIC-HILIC resin (Sequant, Umeå, Sweden) were packed into P10 tips on a stage of Empire C8 material (Sigma) to a bed length of 0.5 cm and washed with ultra-pure water prior to use. Dried digested samples were resuspended in 80% acetonitrile (ACN), 5% formic acid (FA) and insoluble material removed by centrifugation at 20,000×g for 5 min at 4°C. Samples were adjusted to a concentration of 2 µg/µL and 100 µg of peptide material loaded onto a column and washed with 10 load volumes of 80% ACN, 5% FA. Peptides were eluted with 3 load volumes of ultra-pure water into low-bind tubes and concentrated using vacuum centrifugation.
Identification of glycopeptides using reversed phase LC-MS and HCD MS-MS
ZIC-HILIC fractions were resuspended in 0.1% FA and loaded onto a Acclaim PepMap 100 µm C18 Nano-Trap Column (Dionex Corporation, Sunnyvale, CA) for 10 min using a UltiMate 3000 intelligent LC system (Dionex Corporation). Peptides were eluted and separated on 20 cm, 100 µm inner diameter, 360 µm outer diameter, ReproSil – Pur C18 AQ 3 µm (Dr. Maisch, Ammerbuch-Entringen, Germany) in house packed column. Enriched peptides derived from tryptic digests were analysed using an LTQ-Orbitrap Velos (Thermo Scientific, San Jose CA). Samples were eluted using a gradient from 100% buffer A (0.5% acetic acid) to 40% buffer B (0.5% acetic acid, 80% MeCN) over 120 mins at a constant flow of 200 nL/min enabling the infusion of sample in the instrument using ESI. The LTQ-Orbitrap Velos was operated using Xcalibur v2.2 (Thermo Scientific) with a capillary temperature of 200°C in a data-dependent mode automatically switching between MS ion trap CID and HCD MS-MS. For each MS scan, the three most abundant precursor ions were selected for fragmentation with CID, activation time 30 ms and normalized collision energy 35, followed by HCD, activation time 30 ms and normalized collision energy 45. MS resolution was set to 60,000 with an ACG of 1e6, maximum fill time of 500 ms and a mass window of m/z 600 to 2000. MS-MS fragmentation was carried out with an ACG of 3e4/2e5 for CID/HCD and maximum fill time of 100 ms/500 ms CID/HCD. For HCD events an MS resolution of 7500 was set. A total of six HILIC enrichments were performed and analysis by the above protocol.
Database interrogation of identified glycopeptides
Raw files were processed within Proteome Discover version 1.0 Build 43 (Thermo Scientific) to generate .mgf files. To identify possible glycopeptides within exported scans, the MS-MS module of GPMAW 8.2 called ‘mgf graph’ was utilized. This module allowed the identification of all scan events within the generated .mgf files containing the diagnostic oxonium m/z 301.10 ion. These scan events were manually inspected and identified as possible glycopeptides based on the presence of the deglycosylated peptide ion with a tolerance of 20 ppm. To facilitate glycopeptide assignments from HCD scan events, ions below the mass of the predicted deglycosylated peptides were extracted with Xcalibur v2.2 using the Spectrum list function. Ions with a deconvoluted mass above the deglycosylated peptide mass and ions corresponding to known carbohydrate oxonium ions such as 204.08 and 366.14 were removed in a similar approach to post-spectral processing of ETD data [58], [59]. MASCOT v2.2 searches were conducted via the Australasian Proteomics Computational Facility (www.apcf.edu.au) with the Proteobacteria taxonomy selected. Searches were carried out with a parent ion mass accuracy of 20 ppm and a product ion accuracy of 0.02 Da with no protease specificity, instrument selected as MALDI-QIT-TOF (use of this instrumentation setting was due to the observation of multiple internal cleavage products, extensive NH3 and H2O loss from a, b, y ions, which are all included within this scoring setting) as well as the fixed modification carbamidomethyl (C) and variable modifications, oxidation (M) and deamidation (N). An ion score cut-off of 20 was accepted and all data were searched with the decoy setting activated generating a zero false positive rate generated against the decoy database.
Biofilm analysis using 96 well polystyrene plates
Cultures were grown overnight and re-inoculated at an OD600 0.05 in 100 µL into replicates in a 96 well polystyrene plate (Costar). The cultures were subsequently grown without shaking for 48 hours at 30°C. Bacterial growth was determined by measuring the absorbance at OD600 nm. The cultures were removed and the wells washed with ddH20, followed by the addition of 100 µL of 1% crystal violet in ethanol to stain the cells. The plate was incubated for 30 mins with gentle agitation, then thoroughly washed with ddH20, and the stained biofilms solubilized with 100 µL of 2% SDS for 30 minutes with gentle agitation. The amount of biofilm formed was quantified by measuring the absorbance at OD580 nm. The data was normalized using the ratio between OD580/OD600.
Flow cell biofilm experiments, fluorescent staining and confocal laser scanning microscopy
Flow cell experiments and fluorescent staining were performed as described previously by Seper et al. [60]. Briefly, the respective overnight cultures were adjusted to OD600 = 0.1 using 50-fold diluted LB (2%). Per channel, approximately 250 µl of the dilutions were inoculated. After static incubation for 2 h, flow of pre-warmed 2% LB (37°C) was initiated (3 ml/h). Biofilms were allowed to form for a time period of 24 h and were stained with SYTO 9 (Invitrogen) for visualization. Images of attached bacteria or biofilms were acquired using a Leica SP5 confocal microscope (Leica Microsystems, Mannheim, Germany) with spectral detection and a Leica HCX PL APO CS 40× oil immersion objective (NA 1.25). For the SYTO 9 signal, the excitation wavelength was set at 488 nm and fluorescence emission was detected between 500–530 nm. Optical sections were recorded in 0.2 µm steps. For two-dimensional image visualization the Leica LAF and for three-dimensional image processing the AMIRA software (direct volume rendering with VOLREN module) was used. Quantification of image stacks was performed using COMSTAT (http://www.comstat.dk) [61] (M. Vorregaard et al., pers. comm.). For COMSTAT analysis at least six image stacks from three independent experiments were used.
Dictyostelium discoideum virulence assay
This assay was performed essentially as described by [62]. Briefly, midlogarithmic cultures of D. discoideum were mixed with overnight cultures of bacteria to a final concentration of 1×103 amoebae ml−1. 0.2 ml of the suspension was then plated on SM/5 agar containing 1% ethanol. Plates were incubated at room temperature and monitored for D. discoideum plaques for 3–5 days. Wild type bacteria are toxic to the amoebae. Appearance of plaques indicates attenuation.
Galleria mellonella virulence assay
This assay was performed as previously described [32]. Galleria mellonella larvae were bred in sterile conditions at 37°C by Dr. Andrew Kedde (University of Alberta). After injection of bacteria, caterpillars were incubated at 37°C, and the number of dead caterpillars was scored every 5 hours. Caterpillars were considered dead when they were nonresponsive to touch. This experiment is a representative of 3 biological replicates.
Murine bacterial competition model assay
A murine model of disseminated sepsis using BALB/c mice (16–20 grams) was used for bacterial challenge [63], [64]. A. baumannii strains were grown for 18 h at 37°C in Luria broth with appropriate antibiotics and adjusted to the appropriate concentration in physiologic saline. Inoculums were prepared by mixing the bacterial suspensions 1∶1 (v∶v) with a 10% solution (w/v) of porcine mucin (Sigma, St. Louis, MO) which increases the infectivity of A. baumannii, allowing for a lower concentration of bacteria to be used [65]–[67]. Mice were injected intraperitoneally with 0.2 ml of the bacterial/mucin inoculums. Bacterial concentrations were determined by plating dilutions on Luria agar. The wild type strain lethal dose for 50% of animals was determined by the limit test where groups of 5 mice were infected with dilutions of bacteria, at a range of concentrations within 2 logs of a concentration of bacteria that had previously been shown to be lethal with this species of bacteria using a disseminated sepsis model.
An in vivo competition assay was used to compare fitness between the wt and ΔpglL strains [37]–[39]. Liquid cultures containing individual strains were diluted and plated on LB agar. Mixed inoculums were established by mixing equal proportions of strains based on the OD600. Once mixed the inoculums were serially diluted and plated on LB agar and LB agar with gentamycin to select for the ΔpglL. The expected ratio of CFU on LB compared to CFU on LB with gentamycin was 2∶1.
For bacterial competition experiments in vivo an animal model of sepsis was used. Groups of 3 BALB/c female 16–20-g mice were inoculated intraperitoneally with 1×105 CFUs of mixed inoculums (50% of each strain). Groups of 3 mice were sacrificed at 18 h after inoculation. Mice at 18 hours of infection were showing clinical signs of illness and were often moribund. Spleens were aseptically removed, weighed, and homogenized via passage through a cell strainer (BD falcon 70 um cell strainer) in physiological saline before plating serial log dilutions on Luria agar plates for bacterial quantification. If the two strains had equal fitness in vivo the ratio established prior to infection should be maintained.
Ethics statement
All procedures and experiments involving animals (mice) were approved by the Institutional Animal Care Committee of Defence Research and Development Canada Suffield (protocol # CWS-08-1-1-1), and were in accordance with guidelines from the Canadian Council of Animal Care.
Supporting Information
Acknowledgments
We would like to thank Dr. Tony Cornish for assistance with 2D-DIGE, Jenny Ng for technical assistance, Dr. Pukatzki's lab for D. discoideum training, Robert Rennie and LeAnn Turbull at the University of Alberta hospital for providing the clinical isolates, S. D. Kohlweinand and H. Wolinski for access to the microscope facility, M. Grube and B. Klug for helpful assistance with the Amira software analysis, Dr. Andrew Kedde for providing Galleria mellonella larvae, Dr Mike McConnell for providing the OmpA antibody, and members of the Feldman lab for the critical reading of the manuscript.
Footnotes
The authors have declared that no competing interests exist.
This work was supported by grants from Alberta Innovates Technology Futures, the Natural Sciences and Engineering Research Council of Canada (NSERC), the Alberta Glycomics Centre to MFF, Austrian Science Fund (FWF) grants:F3005-B12 LIPOTOX, P229686 and W901 (DK Molecular Enzymology) to A.S. and S.S. NES is the recipient of a CJ Martin Overseas Biomedical Postdoctoral Research Fellow supported by The National Health and Medical Research Foundation of Australia (grant number: APP1037373). MFF is an Alberta Heritage Foundation for Medical Research (AHFMR) scholar and a Canadian Institutes of Health Research (CIHR) New Investigator. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1.Towner KJ. Acinetobacter: an old friend, but a new enemy. J Hosp Infect. 2009;73:363. doi: 10.1016/j.jhin.2009.03.032. [DOI] [PubMed] [Google Scholar]
- 2.Peleg AY, Seifert H, Paterson DL. Acinetobacter baumannii: emergence of a successful pathogen. Clin Microbiol Rev. 2008;21:582. doi: 10.1128/CMR.00058-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Rello J, Diaz E. Acinetobacter baumannii: a threat for the ICU? Intensive Care Med. 2003;29:351. doi: 10.1007/s00134-003-1661-y. [DOI] [PubMed] [Google Scholar]
- 4.Hanlon GW. The emergence of multidrug resistant Acinetobacter species: a major concern in the hospital setting. Lett Appl Microbiol. 2005;41:378. doi: 10.1111/j.1472-765X.2005.01791.x. [DOI] [PubMed] [Google Scholar]
- 5.Smith MG, Gianoulis TA, Pukatzki S, Mekalanos JJ, Ornston LN. New insights into Acinetobacter baumannii pathogenesis revealed by high-density pyrosequencing and transposon mutagenesis. Genes Dev. 2007;21:614. doi: 10.1101/gad.1510307. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Fournier PE, Richet H. The epidemiology and control of Acinetobacter baumannii in health care facilities. Clin Infect Dis. 2006;42:699. doi: 10.1086/500202. [DOI] [PubMed] [Google Scholar]
- 7.Giamarellou H, Antoniadou A, Kanellakopoulou K. Acinetobacter baumannii: a universal threat to public health? Int J Antimicrob Agents. 2008;32:119. doi: 10.1016/j.ijantimicag.2008.02.013. [DOI] [PubMed] [Google Scholar]
- 8.Sengstock DM, Thyagarajan R, Apalara J, Mira A, Chopra T. Multidrug-resistant Acinetobacter baumannii: an emerging pathogen among older adults in community hospitals and nursing homes. Clin Infect Dis. 2010;50:1616. doi: 10.1086/652759. [DOI] [PubMed] [Google Scholar]
- 9.Arroyo LA, Mateos I, Gonzalez V, Aznar J. In vitro activities of tigecycline, minocycline, and colistin-tigecycline combination against multi- and pandrug-resistant clinical isolates of Acinetobacter baumannii group. Antimicrob Agents Chemother. 2009;53:1296. doi: 10.1128/AAC.01097-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Choi CH, Hyun SH, Lee JY, Lee JS, Lee YS. Acinetobacter baumannii outer membrane protein A targets the nucleus and induces cytotoxicity. Cell Microbiol. 2008;10:319. doi: 10.1111/j.1462-5822.2007.01041.x. [DOI] [PubMed] [Google Scholar]
- 11.Tomaras AP, Flagler MJ, Dorsey CW, Gaddy JA, Actis LA. Characterization of a two-component regulatory system from Acinetobacter baumannii that controls biofilm formation and cellular morphology. Microbiology. 2008;154:3409. doi: 10.1099/mic.0.2008/019471-0. [DOI] [PubMed] [Google Scholar]
- 12.Choi AH, Slamti L, Avci FY, Pier GB, Maira-Litran T. The pgaABCD locus of Acinetobacter baumannii encodes the production of poly-beta-1-6-N-acetylglucosamine, which is critical for biofilm formation. J Bacteriol. 2009;191:5963. doi: 10.1128/JB.00647-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Gordon NC, Wareham DW. Multidrug-resistant Acinetobacter baumannii: mechanisms of virulence and resistance. Int J Antimicrob Agents. 2010;35:226. doi: 10.1016/j.ijantimicag.2009.10.024. [DOI] [PubMed] [Google Scholar]
- 14.Gonzalez RH, Nusblat A, Nudel BC. Detection and characterization of quorum sensing signal molecules in Acinetobacter strains. Microbiol Res. 2001;155:277. doi: 10.1016/S0944-5013(01)80004-5. [DOI] [PubMed] [Google Scholar]
- 15.Nothaft H, Szymanski CM. Protein glycosylation in bacteria: sweeter than ever. Nat Rev Microbiol. 2010;8:778. doi: 10.1038/nrmicro2383. [DOI] [PubMed] [Google Scholar]
- 16.Vik A, Aas FE, Anonsen JH, Bilsborough S, Schneider A. Broad spectrum O-linked protein glycosylation in the human pathogen Neisseria gonorrhoeae. Proc Natl Acad Sci U S A. 2009;106:4452. doi: 10.1073/pnas.0809504106. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Fletcher CM, Coyne MJ, Villa OF, Chatzidaki-Livanis M, Comstock LE. A general O-glycosylation system important to the physiology of a major human intestinal symbiont. Cell. 2009;137:331. doi: 10.1016/j.cell.2009.02.041. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Alaimo C, Catrein I, Morf L, Marolda CL, Callewaert N. Two distinct but interchangeable mechanisms for flipping of lipid-linked oligosaccharides. Embo J. 2006;25:976. doi: 10.1038/sj.emboj.7601024. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Faridmoayer A, Fentabil MA, Mills DC, Klassen JS, Feldman MF. Functional characterization of bacterial oligosaccharyltransferases involved in O-linked protein glycosylation. J Bacteriol. 2007;189:8098. doi: 10.1128/JB.01318-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Scott NE, Parker BL, Connolly AM, Paulech J, Edwards AV. Simultaneous glycan-peptide characterization using hydrophilic interaction chromatography and parallel fragmentation by CID, higher energy collisional dissociation, and electron transfer dissociation MS applied to the N-linked glycoproteome of Campylobacter jejuni. Mol Cell Proteomics. 2011;10:MCP000201. doi: 10.1074/mcp.M000031-MCP201. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Power PM, Seib KL, Jennings MP. Pilin glycosylation in Neisseria meningitidis occurs by a similar pathway to wzy-dependent O-antigen biosynthesis in Escherichia coli. Biochem Biophys Res Commun. 2006;347:908. doi: 10.1016/j.bbrc.2006.06.182. [DOI] [PubMed] [Google Scholar]
- 22.Gebhart C, Ielmini MV, Reiz B, Price NL, Aas FE. Characterization of exogenous bacterial oligosaccharyltransferases in Escherichia coli reveals the potential for O-linked protein glycosylation in Vibrio cholerae and Burkholderia thailandensis. Glycobiology. In press. 2012. [DOI] [PubMed]
- 23.Hug I, Feldman MF. Analogies and homologies in lipopolysaccharide and glycoprotein biosynthesis in bacteria. Glycobiology. 2011;21:151. doi: 10.1093/glycob/cwq148. [DOI] [PubMed] [Google Scholar]
- 24.Dehal PS, Joachimiak MP, Price MN, Bates JT, Baumohl JK. MicrobesOnline: an integrated portal for comparative and functional genomics. Nucleic Acids Res. 2010;38:400. doi: 10.1093/nar/gkp919. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Pantophlet R, Brade L, Dijkshoorn L, Brade H. Specificity of rabbit antisera against lipopolysaccharide of Acinetobacter. J Clin Microbiol. 1998;36:1250. doi: 10.1128/jcm.36.5.1245-1250.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Cabral MP, Soares NC, Aranda J, Parreira JR, Rumbo C. Proteomic and Functional Analyses Reveal a Unique Lifestyle for Acinetobacter baumannii Biofilms and a Key Role for Histidine Metabolism. J Proteome Res. 2011;10:3417. doi: 10.1021/pr101299j. [DOI] [PubMed] [Google Scholar]
- 27.Pessione E, Pessione A, Lamberti C, Coisson DJ, Riedel K. First evidence of a membrane-bound, tyramine and beta-phenylethylamine producing, tyrosine decarboxylase in Enterococcus faecalis: a two-dimensional electrophoresis proteomic study. Proteomics. 2009;9:2710. doi: 10.1002/pmic.200800780. [DOI] [PubMed] [Google Scholar]
- 28.Gaddy JA, Actis LA. Regulation of Acinetobacter baumannii biofilm formation. Future Microbiol. 2009;4:278. doi: 10.2217/fmb.09.5. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Gaddy JA, Arivett BA, McConnell MJ, Lopez-Rojas R, Pachon J. Role of Acinetobactin-Mediated Iron Acquisition Functions in the Interaction of Acinetobacter baumannii Strain ATCC 19606T with Human Lung Epithelial Cells, Galleria mellonella Caterpillars, and Mice. Infect Immun. 2012;80:1024. doi: 10.1128/IAI.06279-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Wand M, Bock LJ, Turton JF, Nugent PG, Sutton JM. Virulence of strains of Acinetobacter baumannii is enhanced in Galleria mellonella following biofilm adaptation. J Med Microbiol. 2011;61:7. doi: 10.1099/jmm.0.037523-0. [DOI] [PubMed] [Google Scholar]
- 31.Antunes LC, Imperi F, Carattoli A, Visca P. Deciphering the multifactorial nature of Acinetobacter baumannii pathogenicity. PLoS One. 2011;6:e22674. doi: 10.1371/journal.pone.0022674. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Peleg AY, Jara S, Monga D, Eliopoulos GM, Moellering RC., Jr Galleria mellonella as a model system to study Acinetobacter baumannii pathogenesis and therapeutics. Antimicrob Agents Chemother. 2009;53:2609. doi: 10.1128/AAC.01533-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Hornsey M, Wareham DW. In vivo efficacy of glycopeptide-colistin combination therapies in a Galleria mellonella model of Acinetobacter baumannii infection. Antimicrob Agents Chemother. 2011;55:3537. doi: 10.1128/AAC.00230-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34.Hasselbring BM, Patel MK, Schell MA. Dictyostelium discoideum as a model system for identification of Burkholderia pseudomallei virulence factors. Infect Immun. 2011;79:2088. doi: 10.1128/IAI.01233-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Jander G, Rahme LG, Ausubel FM. Positive correlation between virulence of Pseudomonas aeruginosa mutants in mice and insects. J Bacteriol. 2000;182:3845. doi: 10.1128/jb.182.13.3843-3845.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Mylonakis E, Moreno R, El Khoury JB, Idnurm A, Heitman J. Galleria mellonella as a model system to study Cryptococcus neoformans pathogenesis. Infect Immun. 2005;73:3850. doi: 10.1128/IAI.73.7.3842-3850.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Lopez-Rojas R, Dominguez-Herrera J, McConnell MJ, Docobo-Perez F, Smani Y. Impaired virulence and in vivo fitness of colistin-resistant Acinetobacter baumannii. J Infect Dis. 2010;203:548. doi: 10.1093/infdis/jiq086. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Smani Y, Lopez-Rojas R, Dominguez-Herrera J, Docobo-Perez F, Marti S. In vitro and in vivo reduced fitness and virulence in ciprofloxacin-resistant Acinetobacter baumannii. Clin Microbiol Infect. 2011;18:4. doi: 10.1111/j.1469-0691.2011.03695.x. [DOI] [PubMed] [Google Scholar]
- 39.Lau GW, Ran H, Kong F, Hassett DJ, Mavrodi D. Pseudomonas aeruginosa pyocyanin is critical for lung infection in mice. Infect Immun. 2004;72:4278. doi: 10.1128/IAI.72.7.4275-4278.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Snitkin ES, Zelazny AM, Montero CI, Stock F, Mijares L. Genome-wide recombination drives diversification of epidemic strains of Acinetobacter baumannii. Proc Natl Acad Sci U S A. 2011;108:63. doi: 10.1073/pnas.1104404108. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Szymanski CM, Burr DH, Guerry P. Campylobacter protein glycosylation affects host cell interactions. Infect Immun. 2002;70:2244. doi: 10.1128/IAI.70.4.2242-2244.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Borud B, Aas FE, Vik A, Winther-Larsen HC, Egge-Jacobsen W. Genetic, structural, and antigenic analyses of glycan diversity in the O-linked protein glycosylation systems of human Neisseria species. J Bacteriol. 2011;192:2829. doi: 10.1128/JB.00101-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Jennings MP, Jen FE, Roddam LF, Apicella MA, Edwards JL. Neisseria gonorrhoeae pilin glycan contributes to CR3 activation during challenge of primary cervical epithelial cells. Cell Microbiol. 2011;13:896. doi: 10.1111/j.1462-5822.2011.01586.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Fletcher CM, Coyne MJ, Comstock LE. Theoretical and experimental characterization of the scope of protein O-glycosylation in Bacteroides fragilis. J Biol Chem. 2011;286:3226. doi: 10.1074/jbc.M110.194506. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Knirel YA, Kochetkov NK. [Structure of lipopolysaccharides from gram-negative bacteria. III. Structure of O-specific polysaccharides]. Biokhimiia. 1994;59:1851. [PubMed] [Google Scholar]
- 46.Parsons LM, Lin F, Orban J. Peptidoglycan recognition by Pal, an outer membrane lipoprotein. Biochemistry. 2006;45:2128. doi: 10.1021/bi052227i. [DOI] [PubMed] [Google Scholar]
- 47.Johnson LR. Microcolony and biofilm formation as a survival strategy for bacteria. J Theor Biol. 2008;251:34. doi: 10.1016/j.jtbi.2007.10.039. [DOI] [PubMed] [Google Scholar]
- 48.Bazaka K, Crawford RJ, Nazarenko EL, Ivanova EP. Bacterial extracellular polysaccharides. Adv Exp Med Biol. 2011;715:226. doi: 10.1007/978-94-007-0940-9_13. [DOI] [PubMed] [Google Scholar]
- 49.Hoiby N, Ciofu O, Johansen HK, Song ZJ, Moser C. The clinical impact of bacterial biofilms. Int J Oral Sci. 2011;3:65. doi: 10.4248/IJOS11026. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Sauer K, Camper AK, Ehrlich GD, Costerton JW, Davies DG. Pseudomonas aeruginosa displays multiple phenotypes during development as a biofilm. J Bacteriol. 2002;184:1154. doi: 10.1128/jb.184.4.1140-1154.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.O'Toole GA, Kolter R. Flagellar and twitching motility are necessary for Pseudomonas aeruginosa biofilm development. Mol Microbiol. 1998;30:304. doi: 10.1046/j.1365-2958.1998.01062.x. [DOI] [PubMed] [Google Scholar]
- 52.Cosson P, Soldati T. Eat, kill or die: when amoeba meets bacteria. Curr Opin Microbiol. 2008;11:276. doi: 10.1016/j.mib.2008.05.005. [DOI] [PubMed] [Google Scholar]
- 53.Bozue JA, Johnson W. Interaction of Legionella pneumophila with Acanthamoeba castellanii: uptake by coiling phagocytosis and inhibition of phagosome-lysosome fusion. Infect Immun. 1996;64:673. doi: 10.1128/iai.64.2.668-673.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Kavanagh K, Reeves EP. Exploiting the potential of insects for in vivo pathogenicity testing of microbial pathogens. FEMS Microbiol Rev. 2004;28:112. doi: 10.1016/j.femsre.2003.09.002. [DOI] [PubMed] [Google Scholar]
- 55.Ugalde JE, Czibener C, Feldman MF, Ugalde RA. Identification and characterization of the Brucella abortus phosphoglucomutase gene: role of lipopolysaccharide in virulence and intracellular multiplication. Infect Immun. 2000;68:5723. doi: 10.1128/iai.68.10.5716-5723.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Cagatay TI, Hickford JG. Glycosylation of type-IV fimbriae of Dichelobacter nodosus. Vet Microbiol. 2008;126:167. doi: 10.1016/j.vetmic.2007.06.007. [DOI] [PubMed] [Google Scholar]
- 57.Marolda CL, Lahiry P, Vines E, Saldias S, Valvano MA. Micromethods for the characterization of lipid A-core and O-antigen lipopolysaccharide. Methods Mol Biol. 2006;347:252. doi: 10.1385/1-59745-167-3:237. [DOI] [PubMed] [Google Scholar]
- 58.Good DM, Wenger CD, Coon JJ. The effect of interfering ions on search algorithm performance for electron-transfer dissociation data. Proteomics. 2010;10:167. doi: 10.1002/pmic.200900570. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Good DM, Wenger CD, McAlister GC, Bai DL, Hunt DF. Post-acquisition ETD spectral processing for increased peptide identifications. J Am Soc Mass Spectrom. 2009;20:1440. doi: 10.1016/j.jasms.2009.03.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Seper A, Fengler VH, Roier S, Wolinski H, Kohlwein SD. Extracellular nucleases and extracellular DNA play important roles in Vibrio cholerae biofilm formation. Mol Microbiol. 2011;82:1037. doi: 10.1111/j.1365-2958.2011.07867.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Heydorn A, Nielsen AT, Hentzer M, Sternberg C, Givskov M. Quantification of biofilm structures by the novel computer program COMSTAT. Microbiology 146 ( Pt. 2000;10):2407. doi: 10.1099/00221287-146-10-2395. [DOI] [PubMed] [Google Scholar]
- 62.Pukatzki S, Kessin RH, Mekalanos JJ. The human pathogen Pseudomonas aeruginosa utilizes conserved virulence pathways to infect the social amoeba Dictyostelium discoideum. Proc Natl Acad Sci U S A. 2002;99:3164. doi: 10.1073/pnas.052704399. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Ko WC, Lee HC, Chiang SR, Yan JJ, Wu JJ. In vitro and in vivo activity of meropenem and sulbactam against a multidrug-resistant Acinetobacter baumannii strain. J Antimicrob Chemother. 2004;53:395. doi: 10.1093/jac/dkh080. [DOI] [PubMed] [Google Scholar]
- 64.Fattahian Y, Rasooli I, Mousavi Gargari SL, Rahbar MR, Darvish Alipour Astaneh S. Protection against Acinetobacter baumannii infection via its functional deprivation of biofilm associated protein (Bap). Microb Pathog. 2011;51:406. doi: 10.1016/j.micpath.2011.09.004. [DOI] [PubMed] [Google Scholar]
- 65.McConnell MJ, Dominguez-Herrera J, Smani Y, Lopez-Rojas R, Docobo-Perez F. Vaccination with outer membrane complexes elicits rapid protective immunity to multidrug-resistant Acinetobacter baumannii. Infect Immun. 2011;79:526. doi: 10.1128/IAI.00741-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Batson HC, Landy M, Brown M. The virulence and immunogenicity of strains derived from Salmonella typhosa 58 (Panama carrier). J Exp Med. 1950;91:243. doi: 10.1084/jem.91.2.231. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.McConnell MJ, Pachon J. Active and passive immunization against Acinetobacter baumannii using an inactivated whole cell vaccine. Vaccine. 2010;29:5. doi: 10.1016/j.vaccine.2010.10.052. [DOI] [PubMed] [Google Scholar]
- 68.Piechaud M, Second L. [Studies of 26 strains of Moraxella Iwoffi]. Ann Inst Pasteur (Paris) 1951;80:99. [PubMed] [Google Scholar]
- 69.Dykxhoorn DM, St Pierre R, Linn T. A set of compatible tac promoter expression vectors. Gene. 1996;177:136. doi: 10.1016/0378-1119(96)00289-2. [DOI] [PubMed] [Google Scholar]
- 70.Hunger M, Schmucker R, Kishan V, Hillen W. Analysis and nucleotide sequence of an origin of DNA replication in Acinetobacter calcoaceticus and its use for Escherichia coli shuttle plasmids. Gene. 1990;87:51. doi: 10.1016/0378-1119(90)90494-c. [DOI] [PubMed] [Google Scholar]
- 71.Hoang TT, Karkhoff-Schweizer RR, Kutchma AJ, Schweizer HP. A broad-host-range Flp-FRT recombination system for site-specific excision of chromosomally-located DNA sequences: application for isolation of unmarked Pseudomonas aeruginosa mutants. Gene. 1998;212:86. doi: 10.1016/s0378-1119(98)00130-9. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.