Abstract
The inferior colliculus (IC) and the locus coeruleus (LC) are two midbrain nuclei that integrate multimodal information and play a major role in novelty detection to elicit an orienting response. Despite the reciprocal connections between these two structures, the projection pattern and target areas of the LC within the subdivisions of the rat IC are still unknown. Here, we used tract-tracing approaches combined with immunohistochemistry, densitometry, and confocal microscopy (CM) analysis to describe a projection from the LC to the IC. Biotinylated dextran amine (BDA) injections into the LC showed that the LC-IC projection is mainly ipsilateral (90%) and reaches, to a major extent, the dorsal and lateral part of the IC and the intercollicular commissure. Additionally, some LC fibers extend into the central nucleus of the IC. The neurochemical nature of this projection is noradrenergic, given that tyrosine hydroxylase (TH) and dopamine beta hydroxylase (DBH) colocalize with the BDA-labeled fibers from the LC. To determine the total field of the LC innervations in the IC, we destroyed the LC neurons and fibers using a highly selective neurotoxin, DSP-4, and then studied the distribution and density of TH- and DBH-immunolabeled axons in the IC. In the DSP-4 treated animals, the number of axonal fibers immunolabeled for TH and DBH were deeply decreased throughout the entire rostrocaudal extent of the IC and its subdivisions compared to controls. Our densitometry results showed that the IC receives up to 97% of its noradrenergic innervations from the LC neurons and only 3% from non-coeruleus neurons. Our results also indicate that TH immunoreactivity in the IC was less impaired than the immunoreactivity for DBH after DSP-4 administration. This is consistent with the existence of an important dopaminergic projection from the substantia nigra to the IC. In conclusion, our study demonstrates and quantifies the noradrenergic projection from the LC to the IC and its subdivisions. The re-examination of the TH and DBH immunoreactivity after DSP-4 treatment provides insights into the source, extent, and topographic distribution of the LC efferent network in the IC, and hence, contributes to our understanding of the role of the noradrenaline (NA) system in auditory processing.
Keywords: biotinylated dextran amine, dopamine beta hydroxylase deficiency, immunohistochemistry, densitometry, neurotoxicity, noradrenergic efferents, noradrenergic modulation, tyrosine hydroxylase
Introduction
The locus coeruleus (LC) is a structure located in the caudal central gray pons under the floor of the fourth ventricle. It was first described in 1809 by the German neuroanatomist Johann C. Reil, but it was not until 1812 that the Wenzel brothers coined the name (Toshihiro, 2000). The LC is involved in many of the sympathetic effects during stress due to an increased production of noradrenaline (NA). Electrophysiological studies support the hypothesis that the LC is activated by various stressful stimuli (Valentino et al., 1983; Page et al., 1992; Curtis et al., 1993; del C. Gonzalez et al., 1995; Singewald et al., 1995; Conti and Foote, 1996; Dawe et al., 2001; Valentino and Van Bockstaele, 2008), noxious/nociceptive stimuli (Singewald et al., 1995; Couto et al., 2006; Viisanen and Pertovaara, 2007; Liu et al., 2008; Imbe et al., 2009; Tsuruoka et al., 2011), and physiological stimuli, such as hypotension, hypoxia, and visceral stimulation, which increase the firing of the neurons in this structure (Miao-Kun, 1995; Singewald et al., 1995; Lechner et al., 1997; Valentino et al., 2005; Ma et al., 2008).
The LC is the main source of NA for both the brainstem and the forebrain (Aston-Jones, 2004). Previous investigations have described the catecholamine biosynthetic pathways and their regulation in the nervous system. The metabolic pathways can be finely regulated when there is an increase in the demand of synthesis for NA, for instance in a stressful situation or in the detection of novelty stimuli (Potter et al., 1962; Snyder et al., 1965; Axelrod et al., 1969; Ciaranello et al., 1976).
Studies have shown that the neurotoxin N-(2-chloroethyl)-N-ethyl-2-bromobenzylamine (DSP-4) can be used for the temporary selective degradation of the central and peripheral noradrenergic neurons, mainly those from the LC (Fritschy and Grzanna, 1989; Grzanna et al., 1989; Fritschy et al., 1991). Based on these experiments, the authors described the existence of two separate subsystems of noradrenergic fibers, the LC and non-coerulean noradrenergic fibers, which differ not only in their projections but also with respect to the pharmacological properties of their axon terminals. The neurotoxin DSP-4 exclusively affects the noradrenergic fibers from the LC (Fritschy and Grzanna, 1989; Grzanna et al., 1989). It has been suggested that this selectivity of DSP-4 toward LC neurons may be related to the significant difference found in the affinity of DSP-4 for the NA uptake carrier in different brain structures (Zaczek et al., 1990). In rodents, a systemic injection of DSP-4 causes a depletion in the levels of NA, in the release capacity and in the activity of dopamine beta hydroxylase (DBH) (Ross et al., 1973; Ross, 1985). The effects of DSP-4 administration on the behavior of rats (open-field tests) can include neophobia (distorted reactions to new things or experiences), increased emotionality (more grooming activities and number of stools), defensive or submissive behavior, an altered resident/intruder paradigm, increased aggressiveness and a lack of fear to environmental factors (Spyraki et al., 1982; Delini-Stula et al., 1984; Cornwell-Jones et al., 1992; Harro et al., 1995; van den Buuse et al., 2001).
With regard to the auditory pathway, the LC provides noradrenergic inputs to the cochlear nuclei (Klepper and Herbert, 1991; Ebert, 1996; Thompson, 2003), the superior olivary complex (Mulders and Robertson, 2001), the cochlear root nucleus (Gómez-Nieto et al., 2008b) and the inferior colliculus (IC) (Klepper and Herbert, 1991). The IC is an important auditory nucleus in the brainstem with significant physiological implications, not only for hearing processing but also for adaptive mechanisms, such as the acoustic startle reflex (Jordan and Leaton, 1982; Leitner and Cohen, 1985; Li et al., 1998; Li and Yeomans, 2000; Li and Yue, 2002; Heldt and Falls, 2003; Nobre et al., 2003; Silva et al., 2005; Reimer et al., 2008; Satake et al., 2012). The LC and the IC are reciprocally connected (Klepper and Herbert, 1991; Freitas et al., 2006). Nevertheless, little is known about the projection pattern and target areas of the LC within the IC. The aim of this study was to investigate the noradrenergic innervation of the LC throughout the rostrocaudal extent of the IC and its subdivisions. We attempt to reveal the extensive LC noradrenergic efferent network within the IC using anterograde tract-tracing techniques combined with immunohistochemistry in addition to densitometry and colocalization studies of the catecholaminergic enzymes in control and DSP-4 treated rats. Based on the hypothesis that there are two separate subsystems of noradrenergic fibers and that the neurotoxin DSP-4 exclusively affects the noradrenergic fibers from the LC (Fritschy and Grzanna, 1989; Grzanna et al., 1989), we used DSP-4 as a highly selective neurotoxin to eliminate the projections from the LC. Using this approach, we studied the changes in DBH immunohistochemistry in the IC before and after DSP-4 treatment to evaluate the loss of the LC noradrenergic projections to the IC and quantified the difference.
Materials and methods
Animals and experimental design
Seventeen adult albino rats (Wistar strain) weighting 250–300 g were used (Charles River, Barcelona, Spain). The experiments were conducted according to the guidelines for the use and care of laboratory animals of the European Communities Council Directive (DOCE L222; 24-08-1999) and with those established by the Spanish Government (RD 1201/2005). Animals were housed in groups of two or three prior to surgery and individually afterwards. All efforts were made to minimize the number of animals that were used and their suffering.
We designed a prospective study. In the first step, we studied the projections from the LC to the IC. Then, we demonstrated the noradrenergic nature of these projections in the IC through spatial overlapping techniques, and we described the noradrenergic immunoreactivity in the IC. Afterwards, we investigated the morphological modifications in animals treated with the neurotoxin DSP-4.
Injection of neuronal tracers
To study the neuronal projections from the LC to the IC, we injected nine animals with biotinylated dextran amine (BDA, 10,000 MW, Molecular Probes, Eugene, OR, USA; 10% in distilled water) in the left LC. The neuronal tracer BDA was injected after deep anesthetization of the animal through an intramuscular administration of a mixture of xylazine (7 mg/kg) and ketamine (40 mg/kg). When necessary, additional anesthesia (one-fifth of the initial dose) was given during surgery. Each animal was placed in a stereotaxic frame (Kopf, Tujunga, CA, USA) using the head-positioning procedure described by Paxinos and Watson (2005). The skull was exposed by a midline scalp incision, and a craniotomy was performed over the injection coordinates (Fritschy and Grzanna, 1990). Because the LC is topographically organized, the injection sites were preferentially located in and around the dorsal half of the nucleus, where the ascending projections originate (Guyenet, 1980; Fritschy and Grzanna, 1990). BDA was injected iontophoretically via a glass micropipette (25 μm tip diameter) with 3 μA positive current pulses (7 s on/7 s off) for 15 min. Following the tracer injection, the pipette was left in place for 15 min without current passing to prevent the backflow, then the scalp was sutured and the animal was allowed to recover for a minimum of 7 d (Gómez-Nieto et al., 2008a; Horta-Júnior et al., 2008).
Visualization of neurotracers
At the end of the survival period, the animals were euthanized with a sodium pentobarbital overdose and then perfused transcardially with 100 ml of fresh Ringer calcium-free buffer (NaCl, 145.45 mM; KCl, 3.35 mM; NaHCO3, 2.38 mM), pH 6.9, at 37°C, followed by 1000 ml of fresh depolymerized 4% paraformaldehyde in 0.1 M phosphate buffer, pH 7.4 (PB), at room temperature. For either light microscopy (LM) or confocal microscopy (CM), the brains were removed and cryoprotected for 48 h at 4°C in 30% sucrose in PB. Serial coronal sections (40 μm in thickness) were cut on a freezing stage sliding microtome (HM430; Microm, Heidelberg, Germany). The serial sections were collected in PB and divided into a series of 10 bins.
For LM, the tracers were visualized using a peroxide-based protocol with Tris-buffered saline containing 0.2% Triton X-100 (TBS-TX, #T9284; Sigma, St. Louis, MO, USA) in washing steps. To reveal the BDA tracer, free-floating sections were incubated with an avidin biotin-peroxidase complex (ABC, Standard-kit #PK 4000; Vector Laboratories, Burlingame, CA, USA) for 2 h and visualized with a 3,3′ diaminobenzidine tetrahydrochloride (DAB) and nickel ammonium sulfate solution (Hancock, 1982; Hsu and Soban, 1982).
TH and DBH immunohistochemistry for LM
To study the pattern of TH and DBH immunoreactivity, we used eight animals. After the perfusion and serial section protocol, standard immunostaining procedures were followed for the respective sections, which entailed incubating the sections for 72 h at 4°C in a primary antibody solution diluted in TBS-Tx. The tissue was then washed and incubated in its corresponding biotinylated secondary antibody for 2 h at room temperature. The antibodies used and their dilution are shown in Table 1.
Table 1.
List of antibodies and dilutions used for the immunohistochemical approaches.
| Antigen | Primary antibody | Reference | Dilution | Secondary antibody | Reference | Dilution | Method |
|---|---|---|---|---|---|---|---|
| TH | Mouse anti-TH | #22941-Diasorin | 1/10,000 | Biotinylated goat anti-mouse | #BA-2000-Vector | 1/200 | LM |
| Goat Cy5 anti-mouse IgG | #115-175-003-JI | 1/250 | CM | ||||
| Goat Cy2 anti-mouse | #115-225-003-JI | 1/250 | CM | ||||
| DBH | Rabbit anti-DBH | #DZ1020-Affiniti | 1/500 | Biotinylated goat anti-rabbit | #BA-1000-Vector | 1/200 | LM |
| Goat Cy5 anti-rabbit IgG | #111-175-003-JI | 1/250 | CM |
Affinity Research Products, Nottingham, UK; Diasorin, Stillwater, MN, USA; JI: Jackson Immunoresearch, West Grove, PA, USA; Vector Laboratories, Burlingame, CA, USA. The specificity of the anti-TH antibody: the antibody recognizes an epitope present in the N-terminal region (between a 40–152) of both rodent and human tyrosine hydroxylase. It detects both the intact subunits and the 59/57 kDa doublet and an array of TH forms with decreasing molecular weights resulting from severe proteolysis. The specificity of the anti-DBH antibody: the dopamine β-hydroxylase precursor recombinant protein epitope signature tag (PrEST).
Immunogen sequence:
VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN.
Following the removal of the secondary antibodies, the sections were reacted with ABC as described above, using DAB as the chromogen. All sections were mounted on slides, dehydrated and coverslipped with Entellan® Neu (Merck, Darmstadt, Germany). In addition, several series were counterstained with cresyl violet 0.1% (#5235, Merck) for cytoarchitectonic reference, chiefly to identify the subdivisions of the IC.
Colocalization experiments
To demonstrate the noradrenergic nature of the BDA-labeled fibers from the LC, we have performed experiments to highlight the colocalization between, tyrosine hydroxylase-immunoreactivity (TH-ir) and dopamine beta hydroxylase-immunoreactivity (DBH-ir) in the IC using CM. Free-floating sections were pretreated with phosphate buffer saline (PBS) 0.3% Triton X-100 and blocked for 1 h at room temperature with 6% normal goat serum (#S-1000, Vector Laboratories) in PBS. After overnight incubation at 4°C with primary antibodies, the sections were washed in PBS and incubated for 1 h at room temperature with the secondary antibody (Table 1). The BDA was revealed by incubation in Cy2-conjugated streptavidin (1/650; #016-220-084; Jackson ImmunoResearch). Later on, the sections were rinsed, mounted on slides and coverslipped with the ProLong® Antifade kit (#P7481; Molecular Probes).
In all immunohistochemistry experiments, the omission of the primary antibody resulted in no staining (see Results for more details).
Neurotoxic lesion with DSP-4
To study the TH-ir and DBH-ir fibers located in the IC following the administration of DSP-4 (Sigma-Aldrich Co, St. Louis, MO, USA), we performed immunohistochemistry for TH and BDH in five animals treated with DSP-4 and five control animals. We administrated a single intraperitoneal dose of 50 mg/kg of DSP-4 in five rats, as previously described (Ross, 1985; Grzanna et al., 1989; Fritschy et al., 1991). After 15 d, we sacrificed the rats.
Image analysis
The sections processed for LM were studied using a microscope (#BX5; Olympus, Center Valley, PA, USA) equipped with a digital camera (Spot Rt®; Diagnostic Instruments, Sterling Heights, MI, USA). Low-magnification images were taken with a 5× objective lens, and high-magnification images were taken with a 20× objective lens.
The sections processed for CM were first examined using a microscope (#BX5; Olympus) equipped with epifluorescence and a digital camera (Spot Rt®). Then, the sections were processed and analyzed using a Leica TCS SP2 confocal laser scanning microscope (Leica Microsystems, Mannheim, Germany) coupled to a Leica DM IRE2 inverted microscope and equipped with argon and helium neon lasers with excitation wavelengths of 458, 476, 488, 543, 568, and 633 nm. The fluorochromes Cy2 and Cy5 were detected sequentially, stack-by-stack, with the acousto-optical tunable filter system and triple dichroic mirror TD488/543/633 using laser lines 488–495, 546, and 633 nm. The background was controlled, and the photomultiplier voltage (800 V) was selected for maximum sensitivity in the linear range. The objectives used were Planapochromat 20×, oil immersion 40×, and 63×/numerical aperture 1.30, giving a resolution of ~150 nm in the xy-plane and ~300 nm along the z-axis (pinhole 1 Airy unit), as well as several electronic zoom factors up to 1.58×.
All photomicrographs shown in the figures were processed with minor modifications in brightness, contrast and to remove the tissue free background using Adobe Photoshop® (version 9.0; Adobe Systems Incorporated, San Jose, CA, USA). The IC fiber drawing was made using Adobe Photoshop® to mount digitalized slices from high-magnification images acquired with 20× objective lens and Canvas® (version X Build 885, ACD Systems Inc, USA) to draw the labeled fibers as well as the assemblage of all figures.
The densitometry of TH-ir and DBH-ir was made using the Canvas fiber drawings. The immunoreactive fibers in the IC were drawn with 0.176 mm thick black solid lines on a white background. The quantification of the mean gray level for the subdivisions of the IC in different rostrocaudal levels was performed on traces of stained sections using ImageJ software (version 1.43, Rasband, W.S., ImageJ, US National Institutes of Health, Bethesda, Maryland, USA, http://imagej.nih.gov/ij/, 1997–2011).
Different experimental conditions were compared using the unpaired Student's t-test. Data are reported as the means ± SD. The statistical package we employed was PASW Statistics 18.0.0 (SPSS Inc., Chicago, IL, USA). Statistical significance was accepted at p < 0.05.
Results
LC sends projections to the IC
The tracer injection experiments resulted in a single BDA injection in the left LC (Figure 1A). The injection sites were elliptical with a typical size of ~600 × 600 μm in the rostrocaudal and mediolateral axis, respectively. We only used those injections that did not spread to adjacent nuclei, e.g., to the laterodorsal tegmental nucleus (LDTg). The injections were restricted to the nuclear core of the LC. We also detected anterograde labeling in known LC targets, including the dorsal raphe (Kim et al., 2004), and brain structures of the somatosensory pathway, such as the somatosensory cortex, the ventrobasal nucleus of the thalamus, and the principal nucleus of the trigeminal nerve (Simpson et al., 1997). In all cases, we observed thick (1.04 ± 0.78 μm), straight BDA-labeled fibers with varicosities en passage (beaded fibers), and thin (0.8 ± 0.15 μm), branching BDA-labeled fibers with button-like varicosities (terminal plexus) in both the ipsilateral and contralateral IC (Figures 1B,C,D, and E). These terminal fibers were located predominantly in the lateral and dorsal cortices and in the intercollicular commissure.
Figure 1.
The target areas and projection pattern of the locus coeruleus (LC) fibers within the inferior colliculus (IC). The inset schemes represent coronal sections at the rostrocaudal level as a reference, and the black square represents the area photographed in high magnification. (A) A representative photomicrograph of a typical injection site (I.S.). Left LC received a BDA stereotaxic injection (black). (B) A photomicrograph of a typical labeled fiber in the IC from the LC. The arrow indicates a fiber and the arrowhead indicates a varicosity. (C–E) Confocal photomicrographs of BDA-labeled fibers in the IC. (C) The arrow indicates possible synaptic buttons. (D) The arrow indicates single fibers. (E) The arrow indicates a fiber and the arrowhead indicates possible synaptic buttons. (F) A schematic representation of the BDA-labeled fibers from the LC found in the IC and the internal anatomic subdivisions of the IC. Notice that there are ipsi- and contralateral labeled fibers. The interaural level for coronal placement is displayed in millimeters. See the provided list for abbreviations.
The LC–IC projection was mainly ipsilateral (~90%), although each LC directs some fibers to the contralateral IC (~10%) (Figure 1F). We found a few labeled fibers from the LC in the central nucleus of the IC.
Neurochemical identity of LC terminal fibers in the IC
Fibers that were immunoreactive for TH and DBH in the IC were similar in distribution and size to those described for the BDA-labeled fibers from the LC. We observed TH-ir and BDH-ir beaded fibers that branched into thinner TH-ir and BDH-ir fibers with button-like varicosities (Figures 2B and 3B).
Figure 2.
The colocalization of locus coeruleus fibers with tyrosine hydroxylase (TH) in the dorsal cortex of the inferior colliculus (DCIC). (A) A schematic representation of the coronal section in which the following confocal photomicrographs were taken. The black square depicts the area of the confocal images. (B) The confocal image shows TH-ir in DCIC (red). The arrow and arrowhead indicate representative TH-labeled fibers magnified in C and D, respectively. (E) The confocal image shows labeled fibers (green) after BDA injection in the LC. The arrow and arrowhead indicate representative BDA-labeled fibers in the DCIC. The high magnification images of those fibers are shown in the insets F and G. (H) The merged composition of the photomicrographs in B and E (yellow). The arrowhead and arrow indicate the colocalization of BDA and TH on the representative fibers that are magnified in I and J, respectively. The interaural level for coronal placement is displayed in millimeters. See the provided list for abbreviations.
To show that the BDA-labeled endings from the LC contained catecholaminergic enzymes (TH and DBH), we combined a BDA injection in the LC with immunohistochemistry for TH or DBH. Our results show that BDA-labeled fibers from the LC colocalized with TH-positive fibers and terminals, indicating the catecholaminergic nature of the LC-IC projection (Figure 2). Furthermore, some labeled fibers in the IC from the LC were identified as noradrenergic because we observed colocalization between the BDA-labeled fibers and the DBH-ir fibers (Figure 3).
Figure 3.
The colocalization of locus coeruleus fibers with dopamine beta hydroxylase (DBH) in the dorsal cortex of the inferior colliculus (DCIC). (A) A schematic representation of the coronal section in which the following confocal photomicrographs were taken. The black square depicts the area of the confocal images. (B) A confocal image for DBH-ir (red). The arrows indicate a representative fiber in two parts, most likely due to the Z-axis frame, and the arrowhead shows another representative fiber that is magnified in C. (D) The confocal image shows labeled fibers (green) after BDA injection in the LC. The arrows indicate a representative fiber, and the arrowhead shows another representative fiber that is magnified in E. (F) The merged composition between B and D (yellow). The arrowhead indicates a merged fiber (yellow) that is magnified in G. The arrows show colocalization in another fiber (yellow). The interaural level for coronal placement is displayed in millimeters. See the provided list for abbreviations.
Despite the high degree of colocalization in the IC between TH-ir and DBH-ir fibers (Figure 4), not every catecholaminergic fiber was noradrenergic in nature. The immunoreactivity for TH had incomplete spatial overlapping with DBH-ir (Figure 4). This suggests that others structures in the brainstem and in other brain regions are sending dopaminergic projections to the IC.
Figure 4.
The distribution of immunolabeled fibers for tyrosine hydroxylase (TH) and dopamine beta hydroxylase (DBH) in the inferior colliculus (IC). (A) Schematic representation of the coronal section in which the following confocal photomicrographs were taken. The black square depicts the exact placement of the confocal images, which were taken near the commissure. (B) The confocal image for TH-ir (red). (C) The confocal image for DBH-ir (green). (D) The merged composition between B and C (yellow). (E) A magnification of the white square in D. The arrowhead indicates merged fibers (yellow). (F) An orthogonal view of a section of the confocal fibers. The arrowheads indicate merged fibers and their place in the Z-axis. (G) A three-dimensional view of the two channels. The arrowheads show the difference between the signals in the upper right part of the images where there are TH-ir fibers (red) but not DBH-ir, which leads to the conclusion that dopaminergic fibers (not noradrenergic) exist in the IC. The white square indicates the zone where the colocalization was found. There is a similar pattern of signal distribution. The interaural level for the coronal placement is displayed in millimeters. See the provided list for abbreviations.
DSP-4 administration impaired projections from the LC to the IC
On average, the weight of the treated rats was approximately 12% lower than that of control rats at one week post-treatment and approximately 9% lower than controls at two weeks after the DSP-4 administration. The administration of DSP-4 in rats also causes changes in urination (a loss of rhythm patterns of diurnal urination), a large increase in void volume and increased water intake, all of which are due to changes in TH (Ranson et al., 2003). We also observed disturbed sleep in which the sleep-wake cycle was altered during the first five post-treatment but then returned to control values.
To determine the total field of the LC projection to the entire rostrocaudal extent of the IC and its subdivisions, we used TH and DBH immunohistochemistry and re-examined the LC-IC projection after DSP-4 administration. In non-treated animals, we found intense immunoreactivity for both TH and DBH in the LC (Figures 5A and B). Within the LC, we found dark-stained fibers and cell bodies immunolabeled for both enzymes. As described elsewhere (Klepper and Herbert, 1991), we observed this immunolabeled pattern of fibers and cell bodies throughout the rostral-caudal extent of the LC. At 15 days post-administration in DSP-4 rats, the immunoreactivity for those enzymes decidedly decreased. Thus, large projection neurons and the fibers of the LC could no longer be visualized with TH and DBH immunohistochemistry after DSP-4 treatment (Figures 5C and D). This indicates that the efferents from the LC are affected by the action of the drug, including the noradrenergic fibers in the IC, as presented in the following results. The immunohistochemical negative controls (no primary antibody added) showed no immunoreactivity for TH or DBH (Figures 5E,F,G, and H).
Figure 5.
The effects of DSP-4 administration in the locus coeruleus (LC) on immunohistochemistry (tyrosine hydroxylase and dopamine beta hydroxylase) compared to negative controls for the LC and the inferior colliculus (IC). (A) A photomicrograph of the locus coeruleus (LC) immunostained for tyrosine hydroxylase (TH) in a control animal. The black arrow represents a typical immunoreactive neuron, which is magnified in the inset. (B) A photomicrograph of the LC immunostained for dopamine-beta-hydroxylase (DBH) in a control animal. The black arrow represents a typical immunoreactive neuron, which is magnified in the inset. (C) A photomicrograph of the LC immunostained for TH in a DSP-4-treated animal. (D) A photomicrograph of the LC immunostained for DBH in a DSP-4-treated animal. Notice in this set of images how the immunoreactivity against the catecholaminergic enzymes is distinctly decreased compared to the controls. This reflects the immunoreactivity found in the IC in controls and treated animals. E,F,G, and H are images taken from the negative controls (no primary antibody added). The interaural level for the coronal placement is displayed in millimeters. See the provided list for abbreviations.
For a better description of the results, we divided the rostrocaudal extension of the IC into three different parts: caudal, middle, and rostral. We found a dense TH-ir throughout the entire IC in the control animals, with the highest mean gray values at the caudal level, mainly in the DCIC and the CNIC (Figure 6A). The fibers spread homogeneously in the IC, and there was no significant difference in the distribution along the subdivisions (p > 0.05). There was a great reduction in TH fibers in all subdivisions of the IC in the animals treated with DSP-4 (Figure 6B). The most important diminutions were found in the caudal (72.9%, p < 0.01) and the middle (68.8%, p < 0.01) portions of the CNIC and in the whole length of the LCIC (caudal 73%, middle 72.3%, and rostral 50.9%, for all cases p < 0.01) (Figures 6C,D, and E), whereas the rostral part of the DCIC and the intercollicular commissure remained almost unaltered. The observed reduction was approximately 10% (p < 0.05) (Figure 6E), suggesting that approximately 90% of the labeled fibers in this region belong to the dopaminergic system.
Figure 6.
The effects of DSP-4 administration in the tyrosine hydroxylase-immunoreactivity (TH-ir) within the inferior colliculus (IC). A schematic representation of TH-ir in the IC from the caudal to the rostral part. (A) Drawings of the TH-ir in control animals. (B) Drawings of the TH-ir in DSP-4-treated animals. Notice how the immunoreactivity is markedly decreased in treated animals compared to controls. (C) The mean gray value of the distribution of TH-ir in control animals at different rostrocaudal levels and subdivisions. (D) The mean gray value of the distribution of TH-ir in DSP-4-treated animals at different rostrocaudal levels and subdivisions. (E) The percent reduction in TH-ir following DSP-4 treatment. The interaural level for the coronal placement is displayed in millimeters. The bars represent means ± SD of 24 stained sections. See the provided list for abbreviations.
Similarly, we found dense DBH-ir in the entire IC in the control animals (Figure 7A). The caudal part presented the highest mean gray values, mainly in the DCIC and the CNIC. The fibers were uniformly distributed in the IC, and there was no significant difference in the distribution along the subdivisions (p > 0.05). However, the reduction in DBH fibers in animals treated with DSP-4 was extremely severe (Figure 7B). The decrease of DBH-ir took placed along the full length of the IC and in all its subdivisions, ranging from 89 to 97% (for all cases p < 0.01) (Figures 7C,D, and E).
Figure 7.
The effects of DSP-4 administration on the dopamine beta hydroxylase-immunoreactivity (DBH-ir) in the inferior colliculus (IC). A schematic representation of DBH-ir in the IC from the caudal to the rostral part. (A) Drawings of the DBH-ir in control animals. (B) Drawings of the DBH-ir in DSP-4-treated animals. Notice how the immunoreactivity almost disappears in treated animals. (C) The mean gray value of the distribution of DBH-ir in control animals at different rostrocaudal levels and subdivisions. (D) The mean gray value of the distribution of DBH-ir in DSP-4-treated animals at different rostrocaudal levels and subdivisions. (E) The percent reduction in DBH-ir following DSP-4 treatment. The interaural level for the coronal placement is displayed in millimeters. The bars represent means ± SD of 24 stained sections. See the provided list for abbreviations.
Based on these data, we conclude that DSP-4 removes the majority of the noradrenergic fibers in the IC, leaving only a few fibers spread in the different divisions of the IC and in the commissure.
Discussion
Our findings suggest there is a direct projection from the LC to the IC. We found that this projection is mainly ipsilateral, reaching the DCIC, the LCIC and the commissure of the IC. In agreement with these results, previous studies have shown that the efferent projection from the LC to other nuclei, such as those from the somatosensory pathway, is mainly ipsilateral (Simpson et al., 1997). The neurochemical nature of these projections is noradrenergic, given that TH and DBH colocalize with the BDA-labeled fibers from the LC. We also found a dense immunoreactivity for TH in the IC, even when DSP-4 was administrated. Similar to our observations in the IC, the levels of TH-immunoreactive axons within the hypothalamus, reticular formation, and brainstem motor nuclei appeared relatively unaffected following DSP-4 administration (Fritschy and Grzanna, 1989).
Consistent with Tong et al. (2005), our results also showed single-labeled fibers for TH and double-labeled fibers for TH and DBH in the IC. Moreover, phenylethanolamine-N-methyltransferase, an enzyme use to identify adrenergic neurons and fibers, is not localized in the IC (Tong et al., 2005). In our study, TH-ir was not totally eliminated in the IC after the administration of DSP-4, which indicates the presence of a strong dopaminergic innervation within the IC. These data suggest that both dopaminergic and noradrenergic systems are present in the IC. The source of the dopaminergic innervation might be from the substantia nigra (Garcia-Munoz et al., 1982; Takada et al., 1987; Kemel et al., 1988; Yasui et al., 1991; Deniau and Chevalier, 1992; Moriizumi et al., 1992; Yasui et al., 1995; Richards et al., 1997).
The LC-IC noradrenergic innervation and the effects of DSP-4 administration
Noradrenergic fibers in the IC have been widely studied (Swanson and Hartman, 1975; Levitt and Moore, 1979; Olazàbal and Moore, 1989; Fritschy and Grzanna, 1990); however, the subnuclei distributions of the catecholaminergic innervations in the IC were uncharacterized. Kromer and Moore (1980) described a diffuse pattern of DBH-ir fibers in all the subdivisions of the IC, whereas Klepper and Herbert (1991) clearly indicated a subnuclei distribution of noradrenergic fibers in the IC based on immunohistochemistry for DBH and retrograde tract-tracing studies after injections into the IC.
Klepper and Herbert (1991) demonstrated that the noradrenergic projection to the IC largely arises from the LC and evidenced that these projections were bilateral with predominance (2/1) toward the ipsilateral side. Because the injections sites in the IC were not considered in those retrograde tract-tracing studies (Klepper and Herbert, 1991), the projection field of the LC innervations in the IC remains unknown. Our anterograde track-tracing study verified that the LC–IC projection is mainly ipsilateral and further described the topographic distribution of the LC noradrenergic system in the rostrocaudal extent of the IC and its subdivisions.
Studies that describe the projections from the LC to the IC using anterograde tracers are often contradictory. The injection of lectin Phaseolus vulgaris leucoagglutinin (PHA-L) into the LC in combination with immunohistochemistry for DBH described axons that ran bilaterally into the inferior colliculi, but those LC axons appeared in a patch within sensory nuclei (Fritschy and Grzanna, 1990). Other authors, found very few labeled BDA fibers in the IC after BDA injections into the LC, with little difference between the ipsi- and contralateral side (Mulders and Robertson, 2001).
On the other hand, there is another work that studied the afferent projections to the central nucleus of the IC in the rat that did not identify the LC as a source of afferents to this nucleus (Beyerl, 1978).
The LC is a nucleus with a considerably large caudo-rostral extension, and it has been described as a nucleus with a heterogeneous neuronal population, differentiating its projections according to topographical criteria: axons directed to the forebrain and axons directed to the spinal cord (Mason and Fibiger, 1979; Grzanna and Molliver, 1980; Nagai et al., 1981; Loughlin et al., 1986). The contributions of each neuronal type to a broad efferent network are presented in detail in those studies, but there is no description of the projections to the IC.
In our study, we injected an anterograde tracer into small portions of the LC to avoid spreading to adjacent nuclei, which also project to the IC (for instance, the LDTg). Due to the small size of the BDA injection sites, only a fraction of all LC neurons was labeled in each case, resulting in light density axonal labeling. To determine the total field of the LC innervations in the IC, we destroyed the LC neurons and fibers using a highly selective neurotoxin, DSP-4, and then studied the distribution and density of the TH and DBH immunolabeled axons in the IC. DSP-4 administration models induce noradrenergic degeneration, exclusively affecting the noradrenergic fibers originating in the LC (Fritschy and Grzanna, 1989; Grzanna et al., 1989; Fritschy et al., 1991). Therefore, the densitometry analysis of TH and DBH-ir throughout the IC in DSP-4-treated and non-treated control rats provided us with valuable information regarding the extent and topographical distribution of the LC efferent network in the IC.
After DSP-4 treatment, we found a loss of TH immunoreactive fibers in the dorsal cortex and lateral cortex of the IC and nearly all BDH immunoreactive fibers. Additionally, there were a few remaining DBH-ir that might belong to noradrenergic neurons distributed in the IC. These intrinsic noradrenergic neurons of the IC send descending projections to brainstem nuclei, including the LC (Tong et al., 2005; Freitas et al., 2006). In agreement with Fritschy and Grzanna (1989), our study verified the existence of two separate systems of noradrenergic fibers in the IC: the LC and non-coerulean noradrenergic systems. Our results further show that the sources of NA from non-coeruleus structures were much sparser than the lost of fibers from the LC. Therefore, our study verified that the LC system is the main source of NA in the IC and indicates that the fibers are distinctively distributed in the dorsal and lateral areas of the IC and the intercollicular commissure. These results might contribute to the understanding of the functional role of the IC–LC projection.
Functional implications
Novelty detection is concerned with recognizing inputs that differ in some way from previous inputs. In all sensorial modalities, an unexpected and novel perception is highly effective in attracting and focusing attention. Both the IC and the LC play a major role in novelty detection. The IC constitutes an obligatory and highly integrative relay for the ascending and descending auditory pathways and also process multimodal information, including visual cues (Cooper and Young, 1976; Elverland, 1978; Morest and Oliver, 1984; Faye-Lund and Osen, 1985; Saldana et al., 1996). IC neurons respond selectively to novel sounds and show stimulus-specific adaptation (Pérez-González et al., 2005; Malmierca et al., 2009). Similarly, the LC neurons integrate multimodal information and increase their firing rates following the presentation of novel stimuli (Foote et al., 1980; Grant et al., 1988). Therefore, both midbrain nuclei (IC and LC) are essential for eliciting an orienting response. Our study demonstrates a noradrenergic projection from the LC to the IC, suggesting a functional correlation between the two nuclei. In fact, the main target areas and projection pattern of the LC fibers within the IC are precisely the same IC areas where the population of novelty neurons is located.
In comparison with the neurons in the central nucleus of the IC, the neurons in the dorsal and lateral IC show a strong stimulus-specific adaptation that might contribute to auditory scene analysis, novelty detection, and selective attention (Pérez-González et al., 2005; Malmierca et al., 2009; Lumani and Zhang, 2010). Interestingly, our results showed that the noradrenergic projection from the LC projects to the dorsal and lateral cortex of the IC and, to a lesser extent, to the central nucleus of the IC. Modulators like NA might participate in stimulus-specific adaption given that NA blocks both Ca2+- and Na+-dependent K+ currents (Foehring et al., 1989). Such K+ currents underlie at least part of the cortical auditory adaptation in awake rats (Abolafia et al., 2011). This suggests that the noradrenergic LC–IC projection might contribute to the information that this population of IC neurons integrates for novelty detection.
As we have shown in the IC, the cochlear nucleus and the superior olivary complex also receive noradrenergic inputs from the LC (Klepper and Herbert, 1991; Ebert, 1996; Mulders and Robertson, 2001; Thompson, 2003). Therefore, all the major relay nuclei for auditory information are influenced by the neuromodulator NA. In the context of the NA regulation of behaviors, the activation of the LC noradrenergic system is known to increase attentional processes and influence the target circuits involved in arousal states, learning and memory, alertness, and vigilance (Aston-Jones et al., 1991; Woodward et al., 1991; Berridge and Waterhouse, 2003; Lapiz and Morilak, 2006). This leads us to question how the LC noradrenergic system affects auditory perception and how auditory processing is carried out under different behavioral circumstances. In auditory cue detection, a recent study showed that α-2 adrenergic stimulation is effective in modulating accuracy and response latencies in non-stressed animals (Brown et al., 2012). This suggests that NA not only induces the arousal state to initiate attentional processing but also suggests a more specific role for NA in auditory signal versus non-signal discrimination (Brown et al., 2012). Because the cortex of the IC is particularly rich in α-2 adrenergic receptors (Probst et al., 1984), it is essential to know the target areas of the LC noradrenergic system within the IC. Our study indicates that the LC noradrenergic system massively innervates the dorsal and lateral portions of the IC and revealed that these innervations are significantly impaired in DSP-4-treated rats. These results might contribute to the design of new experiments focused on the role of α adrenergic receptors in the dorsal and lateral IC.
Additionally, the LC projects to the cochlear root nucleus, another midbrain nucleus, which processes unexpected acoustic stimuli and mediates auditory alerting and escape behaviors, such as the acoustic startle reflex (Lee et al., 1996; López et al., 1999; Gómez-Nieto et al., 2008b). The cochlear root nucleus projects to the facial motor neurons that promote pinna movements toward unexpected, loud sounds (Horta-Júnior et al., 2008) and also receives inputs from the IC via a short descending auditory pathway that relays in the ventral nucleus of the trapezoid body (Gómez-Nieto et al., 2008a). Because the IC plays a role in binaural inhibition and is critical for the modulation of the acoustic startle reflex by auditory stimuli (reviewed in Fendt et al., 2001), it is of great interest to study the connections between the IC, LC, and the cochlear root nucleus. The main goal of the present study was to re-examine the projections from the LC to IC in intact and DSP-4 treated rats. Our results demonstrate that the noradrenergic projection from the LC to the IC was drastically impaired after DSP-4 administration. This implies that DSP-4 might be used as a powerful tool to study the functional role of the projections from the LC to midbrain nuclei, such as the IC and the cochlear root nucleus, that are involved in novelty detection, orienting response, and alerting behaviors.
Conflict of interest statement
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Acknowledgments
We would like to express gratitude to the Spanish Ministry of Science and Innovation, (MICINN, # BFU2010-17754) and to the Sao Paulo State Research Foundation (FAPESP proc. 2008/02771-6) for their financial support. Moreover, we thank the AUIP (Programa de Becas de Movilidad Académica 2010–2011) for facilitating a fellowship in Brazil in which some parts of the experiments above took place.
Glossary
Abbreviations
- 4V
forth ventricle
- 5n
trigeminal nerve
- ABC
avidin biotin-peroxidase complex
- Aq
Aqueduct (Sylvius)
- BDA
biotinylated dextran amine
- CM
confocal microscopy
- CN
cochlear nucleus
- CNIC
central nucleus of the inferior colliculus
- DAB
3,3′ diaminobenzidine
- DBH
dopamine beta hydroxylase
- DCIC
dorsal cortex of the inferior colliculus
- DNLL
dorsal nucleus of the lateral lemniscus
- DSP-4
N-(2-chloroethyl)-N-ethyl-2-bromobenzylamine
- LCIC
lateral cortex of the inferior colliculus
- IA
Interaural level
- IC
inferior colliculus
- IHC
immunohistochemistry
- ir
immunoreactivity
- IS
injection site
- LC
locus coeruleus
- LM
light microscopy
- ml
medial lemniscus
- MNTB
medial nucleus of the trapezoid body
- PB
phosphate buffer 0.1 M, pH 7.4
- PBS
phosphate buffer saline
- PnO
pontine reticular nucleus, oral part
- NA
noradrenaline
- TH
tyrosine hydroxylase
- Tx
Triton X100
- tz
trapezoid body
- VNLL
ventral nucleus of the lateral lemniscus.
References
- Abolafia J. M., Vergara R., Arnold M. M., Reig R., Sanchez-Vives M. V. (2011). Cortical auditory adaptation in the awake rat and the role of potassium currents. Cereb. Cortex 21, 977–990 10.1093/cercor/bhq163 [DOI] [PubMed] [Google Scholar]
- Aston-Jones G. (2004). “Locus coeruleus, A5 and A7 noradrenergic cell groups,” in The Rat Nervous System, ed Paxinos G. (San Diego, CA: Elsevier; ), 259–294 [Google Scholar]
- Aston-Jones G., Chiang C., Alexinsky T. (1991). Discharge of noradrenergic locus coeruleus neurons in behaving rats and monkeys suggests a role in vigilance. Prog. Brain Res. 88, 501–520 [DOI] [PubMed] [Google Scholar]
- Axelrod J., Kopin I. J., Waser K. A. (1969). The uptake, storage, release and metabolism of noradrenaline in sympathetic nerves. Prog. Brain Res. 31, 21–32 10.1016/S0079-6123(08)63224-0 [DOI] [PubMed] [Google Scholar]
- Berridge C. W., Waterhouse B. D. (2003). The locus coeruleusenoradrenergic system: modulation of behavioral state and state-dependent cognitive processes. Brain Res. Rev. 42, 33–84 10.1016/S0165-0173(03)00143-7 [DOI] [PubMed] [Google Scholar]
- Beyerl B. D. (1978). Afferent projections to the central nucleus of the inferior colliculus in the rat. Brain Res. 145, 209–223 10.1016/0006-8993(78)90858-2 [DOI] [PubMed] [Google Scholar]
- Brown D. C., 2nd, Co M. S., Wolff R. C., Atzori M. (2012). α-Adrenergic receptors in auditory cue detection: α(2) receptor blockade suppresses false alarm responding in the rat. Neuropharmacology 62, 2177–2182 10.1016/j.neuropharm.2011.12.024 [DOI] [PubMed] [Google Scholar]
- Ciaranello R. D., Wooten F. G., Axelrod J. (1976). Regulation of rat adrenal dopamine B-hydroxylase. II. Receptor interaction in the regulation of enzyme synthesis and degradation. Brain Res. 113, 349–362 [DOI] [PubMed] [Google Scholar]
- Conti L. H., Foote S. L. (1996). Reciprocal cross-desensitization of locus coeruleus electrophysiological responsivity to corticotropin-releasing factor and stress. Brain Res. 722, 19–29 10.1016/0006-8993(96)00175-8 [DOI] [PubMed] [Google Scholar]
- Cornwell-Jones C. A., Palfai T., Krasenbaum D., Byer E., Jr., Clark R., Kinnard K. (1992). Housing influences exploration and social interaction of control and DSP-4-treated rats. Physiol. Behav. 52, 271–276 10.1016/0031-9384(92)90270-C [DOI] [PubMed] [Google Scholar]
- Couto L. B., Moroni C. R., Ferreira C. M., Elias-Filho D. H., Parada C., Pel I. R., Coimbra N. C. (2006). Descriptive and functional neuroanatomy of locus coeruleus-noradrenaline-containing neurons involvement in bradykinin-induced antinociception on principal sensory trigeminal nucleus. J. Chem. Neuroanat. 32, 28–45 10.1016/j.jchemneu.2006.03.003 [DOI] [PubMed] [Google Scholar]
- Cooper M. H., Young P. A. (1976). Cortical projections to the inferior colliculus of the cat. Exp. Neurol. 51, 488–502 10.1016/0014-4886(76)90272-7 [DOI] [PubMed] [Google Scholar]
- Curtis A. L., Drolet G., Valentino R. J. (1993). Hemodynamic stress activates locus coeruleus neurons of unanesthetized rats. Brain Res. Bull. 31, 737–744 [DOI] [PubMed] [Google Scholar]
- Dawe G. S., Huff K. D., Vandergriff J. L., Sharp T., O'Neill M. J., Rasmussen K. (2001). Olanzapine activates the rat locus coeruleus: in vivo electrophysiology and c-Fos immunoreactivity. Biol. Psychiatry 50, 510–520 [DOI] [PubMed] [Google Scholar]
- del C. Gonzalez M. M., Debilly G., Valatx J. L., Jouvet M. (1995). Sleep increase after immobilization stress: role of the noradrenergic locus coeruleus system in the rat. Neurosci. Lett. 202, 5–8 [DOI] [PubMed] [Google Scholar]
- Delini-Stula A., Mogilnicka E., Hunn C., Dooley D. J. (1984). Novelty-oriented behavior in the rat after selective damage of locus coeruleus projections by DSP-4, a new noradrenergic neurotoxin. Pharmacol. Biochem. Behav. 20, 613–618 [DOI] [PubMed] [Google Scholar]
- Deniau J. M., Chevalier G. (1992). The lamellar organization of the rat substantia nigra pars reticulata: distribution of projection neurons. Neuroscience 46, 361–377 10.1016/0306-4522(92)90058-A [DOI] [PubMed] [Google Scholar]
- Ebert U. (1996). Noradrenaline enhances the activity of cochlear nucleus neurons in the rat. Eur. J. Neurosci. 8, 13006–13014 [DOI] [PubMed] [Google Scholar]
- Elverland H. H. (1978). Ascending and intrinsic projections of the superior olivary complex in the cat. Exp. Brain Res. 32, 117–134 [DOI] [PubMed] [Google Scholar]
- Faye-Lund H., Osen K. K. (1985). Anatomy of the inferior colliculus in rat. Anat. Embryol. 171, 1–20 [DOI] [PubMed] [Google Scholar]
- Fendt M., Li L., Yeomans J. S. (2001). Brain stem circuits mediating prepulse inhibition of the startle reflex. Psychopharmacology (Berl.) 156, 216–224 [DOI] [PubMed] [Google Scholar]
- Foehring R. C., Schwindt P. C., Crill W. E. (1989). Norepinephrine selectively reduces slow Ca2+- and Na+-mediated K+ currents in cat neocortical neurons. J. Neurophysiol. 61, 245–256 [DOI] [PubMed] [Google Scholar]
- Foote S. L., Aston-Jones G., Bloom F. E. (1980). Impulse activity of locus coeruleus neurons in awake rats and monkeys is a function of sensory stimulation and arousal. Proc. Natl. Acad. Sci. U.S.A. 77, 3033–3037 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Freitas R. L., Ferreira C. M. R., Ribeiro S. J., Carvalho A. D., Elias-Filho D. H., Garcia-Cairasco N., Coimbra N. C. (2006). Intrinsic neural circuits between dorsal midbrain neurons that control fear-induced responses and seizure activity and nuclei of the pain inhibitory system elaborating postictal antinociceptive processes: a functional neuroanatomical and neuropharmacological study. Exp. Neurol. 191, 225–242 10.1016/j.expneurol.2004.10.009 [DOI] [PubMed] [Google Scholar]
- Fritschy J. M., Grzanna R. (1989). Immunohistochemical analysis of the neurotoxic effects of DSP-4 identifies two populations of noradrenergic axon terminals. Neuroscience 30, 181–197 [DOI] [PubMed] [Google Scholar]
- Fritschy J. M., Grzanna R. (1990). Distribution of locus coeruleus axons within the rat brainstem demonstrated by Phaseolus vulgaris leucoagglutinin anterograde tracing in combination with dopamine-beta-hydroxylase immuno-fluorescence. J. Comp. Neurol. 293, 616–631 10.1002/cne.902930407 [DOI] [PubMed] [Google Scholar]
- Fritschy J. M., Grzanna R., Pompeiano C. D. (1991). Chapter 20 Selective effects of DSP-4 on locus coeruleus axons: are there pharmacologically different types of noradrenergic axons in the central nervous system? Prog. Brain Res. 88, 257–268 [DOI] [PubMed] [Google Scholar]
- Garcia-Munoz M., Patino P., Aguilar R., Arbuthnott G. (1982). Participation of projections from substantia nigra reticulata to the lower brain stem in turning behavior. Exp. Neurol. 78, 380–390 [DOI] [PubMed] [Google Scholar]
- Gómez-Nieto R., Rubio M. E., López D. E. (2008a). Cholinergic input from the ventral nucleus of the trapezoid body to cochlear root neurons in rats. J. Comp. Neurol. 506, 452–468 10.1002/cne.21554 [DOI] [PubMed] [Google Scholar]
- Gómez-Nieto R., Horta-Junior J. A. C., Castellano O., Herrero-Turrión M. J., Rubio M. E., López D. E. (2008b). Neurochemistry of the afferents to the rat cochlear root nucleus: possible synaptic modulation of the acoustic startle. Neuroscience 154, 51–64 10.1016/j.neuroscience.2008.01.079 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Grant S. J., Aston-Jones G., Redmond D. E. (1988). Responses of primate locus ‘coeruleus neurons’ to ‘simple and complex’ sensory ‘stimuli. Brain Res. Bull. 21, 401–410 10.1016/0361-9230(88)90152-9 [DOI] [PubMed] [Google Scholar]
- Grzanna R., Berger U., Fritschy J. M., Geffard M. (1989). Acute action of DSP-4 on central norepinephrine axons: biochemical and immunohistochemical evidence for differential effects. J. Histochem. Cytochem. 37, 1435–1442 10.1177/37.9.2768812 [DOI] [PubMed] [Google Scholar]
- Grzanna R., Molliver M. E. (1980). The locus coeruleus in the rat: an immunohistochemical delineation. Neuroscience 5, 21–40 10.1016/0306-4522(80)90068-8 [DOI] [PubMed] [Google Scholar]
- Guyenet P. G. (1980). The coeruleospinal noradrenergic neurons: anatomical and electrophysiological studies in the rat. Brain Res. 189, 121–133 10.1016/0006-8993(80)90012-8 [DOI] [PubMed] [Google Scholar]
- Hancock M. B. (1982). DAB-Nikel substrate for the differential immunoperoxidase staining of nerve fibers and fiber terminals. J. Histochem. Cytochem. 30, 578 [Google Scholar]
- Harro J., Oreland L., Vasar E., Bradwejn J. (1995). Impaired exploratory behaviour after DSP-4 treatment in rats: implications for the increased anxiety after noradrenergic denervation. Eur. Neuropsychopharmacol. 5, 447–455 [DOI] [PubMed] [Google Scholar]
- Heldt S. A., Falls W. A. (2003). Destruction of the inferior colliculus disrupts the production and inhibition of fear conditioned to an acoustic stimulus. Behav. Brain Res. 144, 175–185 10.1016/S0166-4328(03)00092-5 [DOI] [PubMed] [Google Scholar]
- Horta-Júnior J. A., López D. E., Alvarez-Morujo A. J., Bittencourt J. C. (2008). Direct and indirect connections between cochlear root neurons and facial motor neurons: pathways underlying the acoustic pinna reflex in the albino rat. J. Comp. Neurol. 507, 1763–1779 10.1002/cne.21625 [DOI] [PubMed] [Google Scholar]
- Hsu S. M., Soban E. (1982). Color modification of diaminobenzidine (DAB) precipitation by metallic ions and its application for double immunohistochemistry. J. Histochem. Cytochem. 30, 1079–1082 10.1177/30.10.6182185 [DOI] [PubMed] [Google Scholar]
- Imbe H., Okamoto K., Donishi T., Kawai S., Enoki K., Senba E., Kimura A. (2009). Activation of ERK in the locus coeruleus following acute noxious stimulation. Brain Res. 1263, 50–57 10.1016/j.brainres.2009.01.052 [DOI] [PubMed] [Google Scholar]
- Jordan W. P., Leaton R. N. (1982). Startle habituation in rats after lesions in the brachium of the inferior colliculus. Physiol. Behav. 28, 253–258 10.1016/0031-9384(82)90071-3 [DOI] [PubMed] [Google Scholar]
- Kemel M. L., Desban M., Gauchy C., Glowinski J., Besson M. J. (1988). Topographical organization of efferent projections from the cat substantia nigra pars reticulata. Brain Res. 455, 307–323 10.1016/0006-8993(88)90090-X [DOI] [PubMed] [Google Scholar]
- Kim M. A., Lee H. S., Lee B. Y., Waterhouse B. D. (2004). Reciprocal connections between subdivisions of the dorsal raphe and the nuclear core of the locus coeruleus in the rat. Brain Res. 1026, 56–67 10.1016/j.brainres.2004.08.022 [DOI] [PubMed] [Google Scholar]
- Klepper A., Herbert H. (1991). Distribution and origin of noradrenergic and serotonergic fibers in the cochlear nucleus and inferior colliculus of the rat. Brain Res. 557, 190–201 10.1016/0006-8993(91)90134-H [DOI] [PubMed] [Google Scholar]
- Kromer L. F., Moore R. Y. (1980). A study of the organization of the locus coeruleus projections to the lateral geniculate nuclei in the albino rat. Neuroscience 5, 255–271 [DOI] [PubMed] [Google Scholar]
- Lapiz M. D. S., Morilak D. A. (2006). Noradrenergic modulation of cognitive function in rat medial prefrontal cortex as measured by attentional set shifting capability. Neuroscience 137, 1039–1049 10.1016/j.neuroscience.2005.09.031 [DOI] [PubMed] [Google Scholar]
- Lechner S. M., Curtis A. L., Brons R., Valentino R. J. (1997). Locus coeruleus activation by colon distention: role of corticotropin-releasing factor and excitatory amino acids. Brain Res. 756, 114–124 10.1016/S0006-8993(97)00116-9 [DOI] [PubMed] [Google Scholar]
- Lee Y., López D. E., Meloni E. G., Davis M. (1996). A primary acoustic startle pathway: obligatory role of cochlear root neurons and the nucleus reticularis pontis caudalis. J. Neurosci. 16, 3775–3789 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Leitner D. S., Cohen M. E. (1985). Role of the inferior colliculus in the inhibition of acoustic startle in the rat. Physiol. Behav. 34, 65–70 10.1016/0031-9384(85)90079-4 [DOI] [PubMed] [Google Scholar]
- Levitt P., Moore R. Y. (1979). Origin and organization of brainstem catecholamine innervations in rat. J. Comp. Neurol. 186, 505–528 10.1002/cne.901860402 [DOI] [PubMed] [Google Scholar]
- Li L., Korngut L. M., Frost B. J., Beninger R. J. (1998). Prepulse inhibition following lesions of the inferior colliculus: prepulse intensity functions. Physiol. Behav. 65, 133–139 10.1016/S0031-9384(98)00143-7 [DOI] [PubMed] [Google Scholar]
- Li L., Yeomans J. S. (2000). Using intracranial electrical stimulation to study the timing of prepulse inhibition of the startle reflex. Brain Res. Brain Res. Protoc. 5, 67–74 10.1016/S1385-299X(99)00056-2 [DOI] [PubMed] [Google Scholar]
- Li L., Yue Q. (2002). Auditory gating processes and binaural inhibition in the inferior colliculus. Hear. Res. 168, 98–109 10.1016/S0378-5955(02)00356-8 [DOI] [PubMed] [Google Scholar]
- Liu L., Tsuruoka M., Maeda M., Hayashi B., Wang X., Inoue T. (2008). Descending modulation of visceral nociceptive transmission from the locus coeruleus/subcoeruleus in the rat. Brain Res. Bull. 76, 616–625 10.1016/j.brainresbull.2008.04.010 [DOI] [PubMed] [Google Scholar]
- López D. E., Saldana E., Nodal F. R., Merchán M. A., Warr W. B. (1999). Projections of cochlear root neurons, sentinels of the auditory pathway in the rat. J. Comp. Neurol. 415, 160–174 [PubMed] [Google Scholar]
- Loughlin S. E., Foote S. L., Grzanna R. (1986). Efferent projections of nucleus locus coeruleus: morphologic subpopulations have different efferent targets. Neuroscience 18, 307–319 [DOI] [PubMed] [Google Scholar]
- Lumani A., Zhang H. (2010). Responses of neurons in the rat's dorsal cortex of the inferior colliculus to monaural tone bursts. Brain Res. 1351, 115–129 10.1016/j.brainres.2010.06.066 [DOI] [PubMed] [Google Scholar]
- Ma S., Mifflin S. W., Cunningham J. T., Morilak D. A. (2008). Chronic intermittent hypoxia sensitizes acute hypothalamic-pituitary-adrenal stress reactivity and Fos induction in the rat locus coeruleus in response to subsequent immobilization stress. Neuroscience 154, 1639–1647 10.1016/j.neuroscience.2008.04.068 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Malmierca M. S., Cristaudo S., Pérez-González D., Covey E. (2009). Stimulus-specific adaptation in the inferior colliculus of the anesthetized rat. J. Neurosci. 29, 5483–5493 10.1523/JNEUROSCI.4153-08.2009 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Mason S. T., Fibiger H. C. (1979). Regional topography within noradrenergic locus coeruleus as revealed by retrograde transport of horseradish peroxidase. J. Comp. Neurol. 187, 703–724 10.1002/cne.901870405 [DOI] [PubMed] [Google Scholar]
- Miao-Kun S. (1995). Central neural organization and control of sympathetic nervous system in mammals. Prog. Neurobiol. 47, 157–233 10.1016/0301-0082(95)00026-8 [DOI] [PubMed] [Google Scholar]
- Moriizumi T., Leduc-Cross B., Wu J. Y., Hattori T. (1992). Separate neuronal populations of the rat substantia nigra pars lateralis with distinct projection sites and transmitter phenotypes. Neuroscience 46, 711–720 10.1016/0306-4522(92)90157-W [DOI] [PubMed] [Google Scholar]
- Morest D. K., Oliver D. L. (1984). The neuronal architecture of the inferior colliculus in the cat: defining the functional anatomy of the auditory midbrain. J. Comp. Neurol. 222, 209–236 10.1002/cne.902220206 [DOI] [PubMed] [Google Scholar]
- Mulders W. H. A. M., Robertson D. (2001). Origin of the noradrenergic innervation of the superior olivary complex in the rat. J. Chem. Neuroanat. 21, 313–322 10.1016/S0891-0618(01)00118-1 [DOI] [PubMed] [Google Scholar]
- Nagai T., Satoh K., Imamoto K., Maeda T. (1981). Divergent projections of catecholamine neurons of the locus coeruleus as revealed by fluorescent retrograde double labeling technique. Neurosci. Lett. 23, 117–123 [DOI] [PubMed] [Google Scholar]
- Nobre M. J., Sandner G., Brandao M. L. (2003). Enhancement of acoustic evoked potentials and impairment of startle reflex induced by reduction of GABAergic control of the neural substrates of aversion in the inferior colliculus. Hear. Res. 184, 82–90 10.1016/S0378-5955(03)00231-4 [DOI] [PubMed] [Google Scholar]
- Olazàbal U. E., Moore J. K. (1989). Nigrotectal projection to the inferior colliculus: horseradish perosidase transport and tyroxine hydroxylase immunohystochemical studies in rats, cats and bats. J. Comp. Neurol. 282, 98–118 10.1002/cne.902820108 [DOI] [PubMed] [Google Scholar]
- Page M. E., Akaoka H., Aston-Jones G., Valentino R. J. (1992). Bladder distention activates noradrenergic locus coeruleus neurons by an excitatory amino acid mechanism. Neuroscience 51, 555–563 10.1016/0306-4522(92)90295-D [DOI] [PubMed] [Google Scholar]
- Paxinos G., Watson C. (2005). The Rat Brain in Stereotaxic Coordinates: The New Coronal set–161 Diagrams, 5th edn. San Diego, CA: Academic Press [Google Scholar]
- Pérez-González D., Malmierca M. S., Covey E. (2005). Novelty detector neurons in the mammalian auditory midbrain. Eur. J. Neurosci. 22, 2879–2885 10.1111/j.1460-9568.2005.04472.x [DOI] [PubMed] [Google Scholar]
- Potter L. T., Axelrod J., Kopin I. J. (1962). Differential binding and release of norepinephrine and tachyphylaxis. Biochem. Pharmacol. 11, 254–256 [DOI] [PubMed] [Google Scholar]
- Probst A., Cortés R., Palacios J. M. (1984). Distribution of α 2-adrenergic receptors in the human brainstem: an autoradiographic study using [3H]p-aminoclonidine. Eur. J. Pharmacol. 106, 477–488 [DOI] [PubMed] [Google Scholar]
- Ranson R. N., Gaunt K., Santer R. M., Watson A. H. D. (2003). The effects of ageing and of DSP-4 administration on the micturition characteristics of male Wistar rats. Brain Res. 988, 130–138 10.1016/S0006-8993(03)03357-2 [DOI] [PubMed] [Google Scholar]
- Reimer A. E., Oliveira A. R., Brandao M. L. (2008). Selective involvement of GABAergic mechanisms of the dorsal periaqueductal gray and inferior colliculus on the memory of the contextual fear as assessed by the fear potentiated startle test. Brain Res. Bull. 76, 545–550 10.1016/j.brainresbull.2008.03.011 [DOI] [PubMed] [Google Scholar]
- Richards C. D., Shiroyama T., Kitai S. T. (1997). Electrophysiological and immunocytochemical characterization of GABA and dopamine neurons in the substantia nigra of the rat. Neuroscience 80, 545–557 10.1016/S0306-4522(97)00093-6 [DOI] [PubMed] [Google Scholar]
- Ross S. B. (1985). DSP-4 and behavioural experiments. Pharmacol. Sci. 6, 237 [Google Scholar]
- Ross S. B., Johansson J. G., Lindborg B., Dahlbom R. (1973). Cyclizing compounds. I. Tertiary N-(2-bromobenzyl)-N-haloalkylamines with adrenergic blocking action. Acta Pharm. Suec. 10, 29–42 [PubMed] [Google Scholar]
- Saldana E., Feliciano M., Mugnaini E. (1996). Distribution of descending projections from primary auditory neocortex to inferior colliculus mimics the topography of intracollicular projections. J. Comp. Neurol. 371, 15–40 [DOI] [PubMed] [Google Scholar]
- Satake S., Yamada K., Melo L. L., Barbosa S. R. (2012). Effects of microinjections of apomorphine and haloperidol into the inferior colliculus on prepulse inhibition of the acoustic startle reflex in rat. Neurosci. Lett. 509, 60–63 10.1016/j.neulet.2011.12.052 [DOI] [PubMed] [Google Scholar]
- Silva R. C. B., Sandner G., Brandao M. L. (2005). Unilateral electrical stimulation of the inferior colliculus of rats modifies the prepulse modulation of the startle response (PPI): effects of ketamine and diazepam. Behav. Brain Res. 160, 323–330 10.1016/j.bbr.2004.12.013 [DOI] [PubMed] [Google Scholar]
- Simpson K. L., Altman D. W., Wang L., Kirifides M. L., Lin R. C., Waterhouse B. D. (1997). Lateralization and functional organization of the locus coeruleus projection to the trigeminal somatosensory pathway in rat. J. Comp. Neurol. 385, 135–147 [PubMed] [Google Scholar]
- Singewald N., Zhou G. Y., Schneider C. (1995). Release of excitatory and inhibitory amino acids from the locus coeruleus of conscious rats by cardiovascular stimuli and various forms of acute stress. Brain Res. 704, 42–50 10.1016/0006-8993(95)01102-1 [DOI] [PubMed] [Google Scholar]
- Snyder S. H., Glowinski J., Axelrod J. (1965). The storage of norepinephrine and some of its derivatives in brain synaptosomes. Life Sci. 4, 797–807 [DOI] [PubMed] [Google Scholar]
- Spyraki C., Arbuthnott G. W., Fibiger H. C. (1982). The effect of DSP-4 on some positively reinforced operant behaviors in the rat. Pharmacol. Biochem. Behav. 16, 197–202 [DOI] [PubMed] [Google Scholar]
- Swanson L. W., Hartman B. K. (1975). The central adrenergic system: an immunofluorescence study of the location of cell bodies and their efferent connections in the rat utilizing dopamine-β-hydroxylase as a marker. J. Comp. Neurol. 163, 467–506 10.1002/cne.901630406 [DOI] [PubMed] [Google Scholar]
- Takada M., Li Z. K., Hattori T. (1987). A note on the projections of pars compacta neurons within pars reticulata of the substantia nigra in the rat. Brain Res. Bull. 18, 285–290 10.1016/0361-9230(87)90004-9 [DOI] [PubMed] [Google Scholar]
- Thompson A. M. (2003). Pontine sources of norepinephrine in the cat cochlear nucleus. J. Comp. Neurol. 457, 374–383 10.1002/cne.10540 [DOI] [PubMed] [Google Scholar]
- Tong L., Altschuler R. A., Holt A. G. (2005). Tyrosine hydroxylase in rat auditory midbrain: distribution and changes following deafness. Hear. Res. 206, 28–41 10.1016/j.heares.2005.03.006 [DOI] [PubMed] [Google Scholar]
- Toshihiro M. (2000). The locus coeruleus: history. J. Chem. Neuroanat. 18, 57–64 10.1016/S0891-0618(99)00051-4 [DOI] [PubMed] [Google Scholar]
- Tsuruoka M., Tamaki J., Maeda M., Hayashi B., Inoue T. (2011). The nucleus locus coeruleus/subcoeruleus contributes to antinociception during freezing behavior following the air-puff startle in rats. Brain Res. 1393, 52–61 10.1016/j.brainres.2011.04.008 [DOI] [PubMed] [Google Scholar]
- Valentino R. J., Foote S. L., Aston-Jones G. (1983). Corticotropin-releasing factor activates noradrenergic neurons of the locus coeruleus. Brain Res. 270, 363–367 10.1016/0006-8993(83)90615-7 [DOI] [PubMed] [Google Scholar]
- Valentino R. J., Van Bockstaele E. (2008). Convergent regulation of locus coeruleus activity as an adaptive response to stress. Eur. J. Pharmacol. 583, 194–203 10.1016/j.ejphar.2007.11.062 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Valentino R. J., Van Bockstaele E. J., Steckler T. (2005). “Chapter 4.4 Functional interactions between stress neuromediators and the locus coeruleus-norepinephrine system,” in Techniques in the Behavioral and Neural Sciences, Part 1, Vol. 15, eds Reul J. M. H. M., Kalin N. H., Steckler T. (Philadelphia, PA: Elsevier; ), 465–486 [Google Scholar]
- van den Buuse M., Lambert G., Fluttert M., Eikelis N. (2001). Cardiovascular and behavioural responses to psychological stress in spontaneously hypertensive rats: effect of treatment with DSP-4. Behav. Brain Res. 119, 131–142 10.1016/S0166-4328(00)00349-1 [DOI] [PubMed] [Google Scholar]
- Viisanen H., Pertovaara A. (2007). Influence of peripheral nerve injury on response properties of locus coeruleus neurons and coeruleospinal antinociception in the rat. Neuroscience 146, 1785–1794 10.1016/j.neuroscience.2007.03.016 [DOI] [PubMed] [Google Scholar]
- Woodward D. J., Moises H. C., Waterhouse B. D., Yeh H. H., Cheun J. E. (1991). Modulatory actions of norepinephrine on neural circuits. Adv. Exp. Med. Biol. 287, 193–208 [DOI] [PubMed] [Google Scholar]
- Yasui Y., Nakano K., Kayahara T., Mizuno N. (1991). Non-dopaminergic projections from the substantia nigra pars lateralis to the inferior colliculus in the rat. Brain Res. 559, 139–144 10.1016/0006-8993(91)90296-8 [DOI] [PubMed] [Google Scholar]
- Yasui Y., Tsumori T., Ando A., Domoto T. (1995). Demonstration of axon collateral projections from the substantia nigra pars reticulata to the superior colliculus and the parvicellular reticular formation in the rat. Brain Res. 674, 122–126 10.1016/0006-8993(94)01459-U [DOI] [PubMed] [Google Scholar]
- Zaczek R., Fritschy J. M., Culp S., De Souza E. B., Grzanna R. (1990). Differential effects of DSP-4 on noradrenaline axons in cerebral cortex and hypothalamus may reflect heterogeneity of noradrenaline uptake sites. Brain Res. 522, 308–314 10.1016/0006-8993(90)91474-U [DOI] [PubMed] [Google Scholar]







