Abstract
Background
Nesprins (Nuclear envelope spectrin-repeat proteins) are a novel family of giant spectrin-repeat containing proteins. The nesprin-1 and nesprin-2 genes consist of 146 and 116 exons which encode proteins of ∼1mDa and ∼800 kDa is size respectively when all the exons are utilised in translation. However emerging data suggests that the nesprins have multiple alternative start and termination sites throughout their genes allowing the generation of smaller isoforms.
Results
In this study we set out to identify novel alternatively transcribed nesprin variants by screening the EST database and by using RACE analysis to identify cDNA ends. These two methods provided potential hits for alternative start and termination sites that were validated by PCR and DNA sequencing. We show that these alternative sites are not only expressed in a tissue specific manner but by combining different sites together it is possible to create a wide array of nesprin variants. By cloning and expressing small novel nesprin variants into human fibroblasts and U2OS cells we show localization to actin stress-fibres, focal adhesions, microtubules, the nucleolus, nuclear matrix and the nuclear envelope (NE). Furthermore we show that the sub-cellular localization of individual nesprin variants can vary depending on the cell type, suggesting any single nesprin variant may have different functions in different cell types.
Conclusions
These studies suggest nesprins act as highly versatile tissue specific intracellular protein scaffolds and identify potential novel functions for nesprins beyond cytoplasmic-nuclear coupling. These alternate functions may also account for the diverse range of disease phenotypes observed when these genes are mutated.
Introduction
Nuclear envelope (NE) spectrin-repeat proteins, or nesprins, are a novel family of nuclear and cytoskeletal proteins with rapidly expanding roles as intracellular scaffolds and linkers [1], [2], [3], [4]. Nesprins are characterized by a central extended spectrin-repeat (SR) rod domain and a C-terminal Klarsicht/ANC-1/Syne homology (KASH) transmembrane domain, which acts as a NE targeting motif. At the NE, via interactions with the Sun-domain family of proteins and the nuclear lamina, nesprins on both the inner and outer nuclear membrane form the linker of the nucleoskeleton and cytoskeleton (LINC) complex [5], [6]. This complex requires the giant nesprin-1 (∼1 MDa) and nesprin-2 (∼800 kDa) isoforms, which possess a pair of N-terminal calponin homology domains, which bind directly to F-actin [7], [8]. Nesprin-3 (∼110 kDa) and nesprin-4 (∼43 kDa) are smaller family members with more divergent spectrin-repeats. These lack the N-terminal CH domains of nesprin-1 and -2 and via SRs interact with intermediate filaments and microtubules respectively [3], [4], [9].
Disruption of the LINC complex via mutations in nesprin-1 and -2 or their binding partners, such as emerin and lamin A/C, give rise to Emery Dreifuss Muscular Dystrophy (EDMD) [6], [10], [11], [12], [13], [14], [15], [16], [17]. However, emerging evidence implicates nesprin-1 and -2 in several other unrelated diseases, including schizophrenia, epithelial cancers and autosomal recessive cerebellar ataxia (ARCA1), which are not characterized by NE defects [18], [19], [20]. It is likely that these non-canonical roles for nesprin are mediated by alternative transcription that has been shown to generate multiple tissue-specific nesprin variants that lack either the CH domain, the KASH domain or both and localize to a number of subcellular compartments [2], [21]. For example, nesprin-1 has been shown to localize to the Golgi apparatus and over-expression of dominant-negative nesprin-1 fragments composed of SRs within the central rod domain disrupt Golgi organization and function [22], [23], [24]. Nesprin-1 isoform Drop1, which consists of the N-terminal CH domain and SRs but lacks the KASH domain, is significantly down regulated in epithelial cancer and may play a role in chromatin organization [16], [25], [26]. Furthermore, the brain-specific nesprin-1 isoform, candidate plasticity gene 2 (cpg2), consists solely of SRs and localizes to the neuronal postsynaptic endocytic zone surrounding dendritic spines where it regulates clathrin-mediated uptake and recycling of chemokine receptors [27], [28].
In order to assess further the extent of alternate nesprin functionality, in this study we set out to identify novel nesprin variants by identifying 5′UTRs and 3′UTRs transcribed from the nesprin-1 and nesprin-2 genes. We provide evidence that both nesprin-1 and -2 undergo alternative splicing and express multiple tissue specific variants generated by alternate initiation and termination and that the sub-cellular localization of these variants is cell type dependent. We also provide a unifying nomenclature system for nesprin variants and their UTRs.
Results
Identification of Novel Nesprin-1 and Nesprin-2 UTRs
We adopted two approaches to identify bone fide novel 5′ and 3′UTRs. We first performed 5′ and 3′ RACE from HeLa, Skeletal Muscle and Brain cDNA libraries using multiple gene specific nesprin primers and nested primers designed towards the end of a range of exons throughout the nesprin gene. Many PCRs produced non-specific or no amplicons (data not shown) however, products for multiple UTRs as retained introns were detected (Figure 1A). For nesprin-1 we identified N1-5′E83, a novel 5′UTR where the first coding exon utilised is exon 83. Multiple nesprin-1 3′UTRs were detected in a tissue/cell specific manner where the last coding exons were either exons 14, 44, 82, 90 or 106 (N1-3′E14, N1-3′E44, N1-3′E82, N1-3′E90 and N1-3′E106 respectively). Similarly N2-3′E50 and N2-3′E90 are two novel nesprin-2 3′UTRs also identified by RACE. The stop codons for isoforms terminating with these novel 3′ ends were found in retained intronic sequences between the last coding exon and the exon thereafter. In nesprin variants using these 3′ ends the ‘retained intron’ resulted in the addition of unique amino acids followed by a stop codon that were absent from the giant isoforms. Downstream of the stop codon will be a polyA signal followed by a polyadenylation site. For example, variants terminating with the N1-3′E90 UTR contain eight codons before the stop codon in the retained intron between exon 90 and exon 91. Thus variants terminating with this 3′UTR possess a novel 8 amino acid peptide sequence, ‘AGAGYPHQ*’, which is absent in the giant isoform (Figure 1B).
Due to limitations with RACE analysis we next screened available databases for novel nesprin cDNA transcripts. The NCBI expressed sequence tag database (EST), which consists of one-shot sequences of cloned mRNA, was blasted with consecutive, 500 bp-overlapping 1 kb nesprin-1 and nesprin-2 sequences covering the entirety of the giant isoform cDNAs. Several novel UTRs were detected in the EST database screen, typically presenting as retained introns between two exons (Table 1). 5′UTRs were considered real if they contained an identifiable and viable Kozak sequence surrounding the first start codon. Only those 3′UTR sequences which already included a poly(A) tail or contained at least one poly(A) site downstream of the initial ORF termination codon, as determined by scanning with the polyAdq program or manually for non-canonical poly(A) signals, were considered for further study.
Table 1. UTRs identified through online databases.
Gene | UTR | 5′ or 3′ | Location | NCBI Accession | Verified by PCR |
Nesprin-1 | N1-5′I14/15 | 5′ | Intron 14–15/ | DA151121, CR933676, AK055440, BG197747, DB324328 | + |
Nesprin-1 | N1-3′E18 | 3′ | Exon 18 | BC028616, DB545136, DB540697, DB538738 | + |
Nesprin-1 | N1-5′I18/19 | 5′ | Intron 18–19 | DA337073 | − |
Nesprin-1 | N1-3′E20 | 3′ | Exon 20 | DB540697, DB545136, DB538738 | − |
Nesprin-1 | N1-5′I21/22 | 5′ | Intron 21–22 | DA337073 | + |
Nesprin-1 | N1-3′E25 | 3′ | Exon 25 | DA151121, CR933676, AK055440, BG197747, DB324328 | + |
Nesprin-1 | N1-3′E37 | 3′ | Exon 37 | AL713682 | + |
Nesprin-1 | N1-5′E44 | 5′ | Exon 44 | DB300122 | − |
Nesprin-1 | N1-3′E62 | 3′ | Exon 62 | BC039121,CA425673,AW300380, BG203678, BG210617, DB516174,CA441052, BX093712,CA312508, DB319424, AA227537,AI866946 | + |
Nesprin-1 | N1-5′E84 | 5′ | Exon 84 | BU461222 | − |
Nesprin-1 | N1-3′E87 | 3′ | Exon 87 | AB033088 | − |
Nesprin-1 | N1-5′E92 | 5′ | Exon 92 | CJ462692, DA229059, DA227411, DA212433, DA509325, DB059554,DA802484, EE366817, DA241105, DA338782, DB289567, DA116814,DA493491 | + |
Nesprin-1 | N1-5′E97 | 5′ | Exon 97 | BF740426, BF726175 | − |
Nesprin-1 | N1-5′I128/129 | 5′ | Intron 128–129 | AK304825 | + |
Nesprin-1 | N1-5′I132/133 | 5′ | Intron 132–133 | DA632075 | − |
Nesprin-1 | N1-5′E138 | 5′ | Exon 138 | DA827648 | + |
Nesprin-2 | N2-3′E9 | 3′ | Exon 9 | BC042134, BC071873 | + |
Nesprin-2 | N2-3′E46 | 3′ | Exon 46 | BX648234 | + |
Nesprin-2 | N2-5′E49 | 5′ | Exon 49 | BC036941, BI860943,AA247756 | + |
Nesprin-2 | N2-5′E63 | 5′ | Exon 63 | CV571029 | − |
Nesprin-2 | N2-5′I 91/92 | 5′ | Intron 91–92 | DA226447 | + |
Nesprin-2 | N2-5′I 99/100 | 5′ | Intron 99–100 | DB089560, BM805144, DB088145, DA810994, DA725349, DA101036,DB152052, DA196319, DA706514, DA186088, DA106538, DA093934,DA334037, DA333629, DB063748, DA222451, DA230417, DA097798,DA094004, DA522676 | + |
Table listing all potential UTRs identified through available online databases.
The majority of UTRs identified by RACE or through the EST screen were verified by PCR and DNA sequencing using a multi-tissue cDNA panel (Figures 1C,D. Table 1 contains a column showing the UTRs which have been verified by PCR). PCR primers were designed so that one primer was present within the UTR and the second within a constitutively present exon with at least one intervening intron sequence to control for genomic DNA contamination. Although many UTRs PCR amplified in a range of tissues, most were transcribed in a tissue specific manner suggesting they lead to the creation of tissue specific nesprin variants. The potential combinations of 5′ UTRs with 3′UTRs are extensive and would allow generation of many variants. Figures 2A and 3A provide an outline of the nesprin-1 and nesprin-2 UTRs across their respective genes with figures 2B and 3B highlighting proposed variants that could be created by a ‘mix-and-match’ approach in vivo for nesprin-1 and nesprin-2 respectively (Table S1 and Table S2 shows the UTRs that when combined generate these nesprin-1 and -2 variants respectively). The spectrin repeats (SRs) used in our schematics to represent nesprins are based on the predictions of SRs as previously described [29]. Many of the predicted nesprin variants are too large to be detected by conventional PCR and are therefore hypothetical. The smaller nesprin variants were however validated by PCR and are described below.
Although many variants could retain the KASH domain, there is a possibility of generating isoforms composed solely of SRs. Therefore, the identified nesprin variants were named according to their predicted molecular weights and the domains they possessed. For example, p56CHNesp1 is a nesprin-1 variant of 56 kDa which has the N-terminal CH domains, p50Nesp1 is a 50 kDa nesprin-1 variant which lacks both the CH domains and the KASH domain and is composed of SRs, while p53KASHNesp1 is a 53 kDa KASH containing variant lacking CH domains. Variants that lack the KASH domain due to alternative splicing events in and around the exons coding for the KASH domain have been described as ΔKASH variants (See below).
Nesprin KASH Isoforms
So far a number of KASH variants including the nesprin-1 and nesprin-2 α,β isoforms have been identified. In principle any of the 5′UTRs identified in this study could be utilised with the 3′UTR of the nesprin-1 giant to make KASH containing NE localized nesprin variants. Whilst most 5′UTRs are too distant from the KASH domain for PCR amplification we were able to verify p53KASHNesp1 (Accession number JQ754366), the smallest nesprin-1 KASH containing isoform identified to date, with a molecular weight of 53 kDa. p53KASHNesp1 uses the N1-5′E138 alternative start site which was detected in heart, spleen, lung, brain, prostate, PBL, small intestine (SI), ovary and liver cDNA (Figure 1C). Although full-length p53KASHNesp1 could not be detected in a range of primary and transformed cell lines it was detected in tissues including heart, spleen and peripheral blood leukocytes (PBL) (Figure 4F). Flag-p53KASHNesp1 cloned from heart cDNA confirmed NE localization when transfected into U2OS cells (Figure 4A,B).
Nesprin Calponin Homology Domain containing Isoforms
Next we set out to identify the sub-cellular localizations of KASH-less nesprin variants composed of SRs or CH domains. p56CHNesp1 and p32CHNesp2 are two nesprin CH-domain containing variants with a Mw suitable for PCR amplification and cloning (Accession numbers JQ740783 and JQ754367 respectively) (Figures 4A,E). p56CHNesp1 initiates with the most upstream nesprin-1 UTR utilised by the nesprin-1 giant and terminates with N1-3′E14, encoding a protein that possesses the CH domains and the first SR of nesprin-1. p32CHNesp2 terminates upstream of the first SR coding exon and is therefore the only known nesprin variant to date which lacks any SRs. Interestingly we observed differential sub-cellular localizations when p56CHNesp1 was transfected into transformed and primary cell lines. In U2OS cells p56CHNesp1 surprisingly localized to the nucleolus while in HDFs it associated with actin stress fibres and focal adhesions (Figure 4C,D). Whilst p56CHNesp1 expression was ubiquitously detected in all cell lines examined, expression of p32CHNesp2 was limited to PBL, MBs and U2OS cells (Figure 4F). Unlike p56CHNesp1, p32CHNesp2 localized to focal adhesions when ectopically expressed in its native U2OS cells (Figure 4E).
Nesprin Central Rod Isoforms
Multiple 5′ and 3′ UTRs were identified in the nesprin-1 gene between exons 83 and 90, suggesting that it is a region where multiple variants are generated (Figure 5A). Using RACE we identified a 5′UTR where the first coding exon was exon 83 (N1-5′E83) and a 3‘UTR where the final coding exon was exon 90 (N1-3′E90) (Figure 1A). Furthermore online databases revealed an additional 5′UTR associated with exon 84 (N1-5′E84) and a previously described Kazusa clone KIAA1262. The KIAA1262 sequence includes exons 77 to 87 and terminates in a 3′UTR where the final coding exon is exon 87 (N1-3′E87). The identification of these new UTRs together with the pre-existing nesprin-1β1 and nesprin-1β2 5′UTRs confirms that this is a region of nesprin with the ability to generate multiple alternative transcripts (Figure 5A).
Hypothetically these UTRs could generate 7 nesprin-1 splice variants by alternative initiation and termination of the four 5′UTRs with the three 3′UTRs (Figure 5A). To test this, PCR amplification from 5′ to 3′UTRs were carried out in multiple tissue cDNA panels to see if any of the variant messages were transcribed. p50Nesp1 (Accession number JQ740784) expression was ubiquitous while expression of the p41Nesp1 (Accession number JQ740786), p31Nesp1(Accession number JQ740785), p23Nesp1 (Accession number JQ754364) and p12Nesp1 (Accession number JQ754365) variants was restricted to certain tissues. p30Nesp1 and p20Nesp1 failed to amplify and therefore are probably not expressed (Figure 5A). When p50Nesp1 was expressed in U2OS cells it localized to and polymerized microtubules while all the other isoforms displayed a diffuse cytoplasmic and nuclear localization (Figure 5B for Flag- p50Nesp1 and Flag- p31Nesp1). All other isoforms are shown in Figure S1A). p23Nesp1 and p12Nesp1 both localized to and disrupted nucleolar morphology when expressed in HDFs, causing fibrillarin to redistribute into peri-nucleolar caps, while the slightly larger p31Nesp1 localized with fibrillarin without affecting its localization (Figure 5C). When p41Nesp1 was expressed in HDFs, it displayed diffuse cytoplasmic localization and also concentrated around the ER (Figure S1B).
Another central rod variant Nesprin-1 p55Nesp1, is composed of a single SR and lacked both the CH and KASH domains (Figure 5D). p55Nesp1 was detected in the kidney, spleen and PBL by PCR and displayed diffuse cytoplasmic localization when transfected into U2OS cells (Figure 5D).
Nesprin Isoform Expression is Highly Adaptable
To further confirm the validity of the novel variants and because previous evidence indicates that nesprins have the ability to self-compensate we decided to investigate how knocking down a sub-set of transcripts would effect expression levels of variants encoded by nearby transcripts [30]. By designing an siRNA targeting exon 90 (si-90) we were able to monitor by qRT-PCR the levels of transcripts terminating with N1-3′E87 and N1-3′E90 UTRs (Figure 6). In theory this siRNA should target all transcripts terminating with N1-3′E90 but have no effect on N1-3′E87 terminating transcripts as this termination site is located to the 5′ end on exon 87. As expected, si-90 significantly reduced levels of N1-3′E90 expression but more interestingly also significantly knocked down levels of the transcripts terminating with N1-3′E87. Furthermore si-136, an siRNA designed towards the KASH domain of nesprin-1 increased expression of N1-3′E87 transcripts, showing that perturbations in the expression of one transcript can influence expression of other downstream transcripts. Conversely no change in N1-3′E90 was detected with si-136, however both siRNAs knocked down levels of nesprin-1 KASH expressing transcripts (Figure 6).
Nesprin and Alternative Splicing of Cassette Exons
Next we set out to determine whether any of the 100 plus exons of the nesprin-1 and nesprin-2 genes have the ability to undergo alternative splicing to increase further variant diversity. As a starting point we used nesprin EST and nucleotide databases to look for potential splicing events which identified cassette exons 6′, 93 and 145 for nesprin-1 (Table 2). Exon 6′ is a potential isoform or tissue specific coding region located between exons 6 and 7 and encodes a 7 amino acid peptide insert at the end of the first CH domain of nesprin-1 (See Figure S2A for nesprin-1 genomic map with cassette exon). Exon 93 contributes an additional 47 amino acids to a SR of the central rod domain while exon 145 encodes a peptide sequence at the C-terminal region of the KASH domain.
Table 2. Cassette exons identified through online databases.
Nesprin | Exon | Splicing | Peptide Sequence | Accession |
Nesprin-1 | Exon 6′ | Cassette | SMHRGSP | CF552114 |
Nesprin-1 | Exon 93 | Cassette | MTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQ | DB289567,AK310977,CA425673,CA312508,DA809350,DB224830,DA493464 |
Nesprin-1 | Exon 145 | Cassette | VHKRWLRFLPF* | BX647837 |
Nesprin-2 | Exons 28–31 | Cassette | Premature stop codons | AU185086 |
Nesprin-2 | Exon 101’ | Cassette | PTHGVQQKYYLMMTKNAMFIREEVFQFFPMTMHFLFINVIFPKLGNCITIIIKGQDSRDPTSLQATTALAGLYQLGRQGSTARY | CR749324 |
Nesprin-2 | Exon 107’ | Cassette | DVEIPENPEAYLKMTTKTLKASS | NM_182914,DA044815,DB138084,DA868743 |
Nesprin-2 | Exons 110–113 | Cassette | IRASSPSKVQSSENYRRRGGDREQGPRQHTATALLPLKGGPGSPTPAAAPPAAAAPGLPAALLRRRLQLHSGQQLCPVLLPHAEVHQWATPHIEGIAGHSATPPA* | BM725084 |
Nesprin-2 | Exon 114 | Cassette | NPASPLPSFDEVDSGDQPPATSVPAPRAK | BE795270 |
An online scan of the EST and nucleotide databases indicated that the nesprin-1 and nesprin-2 genes underwent extensive alternative splicing and this was verified using PCR (Figure 7A,B).
Represents a stop codon for nesprin-1 exon 145 and nesprin-2 exons 110–113.
Several alternatively spliced exons, were also identified in nesprin-2 using the same data mining procedure, including cassette exons 101′, 107′ and 114 and 5′ alternatively spliced exons 110 to 113 (Table 2). Unlike nesprin-1, the identified exons were all located near the C-terminal half of the nesprin-2 giant. Splicing of exons 101′, 107′, 110 to 113 and 114 would alter the length of the coiled-coil regions surrounding the two SR preceding the KASH domain while removal of the first 31aa encoded by exon 113 would eliminate the final SR before the KASH domain. As with exon 6′ of nesprin-1, exon 101′ and 107′ of nesprin-2 represent coding regions which maybe isoform or tissue specific and are located between exons 101 to 102 and 107 to 108 respectively. (See Figure S2B for nesprin-2 genomic map with cassette exons).
To identify whether these splicing events did indeed take place we designed primers to exons either side of the cassette exons and carried out PCR analysis from U2OS and VSMC cDNA libraries (Figure 7A,B). For nesprin-1, two PCR products appeared from U2OS and VSMC libraries when PCR amplification was carried out across exon 93; the larger of the two bands included exon 93 and the smaller band with the exon excluded. Nesprin-2 splicing showed more tissue specificity than nesprin-1, with PCR products including and excluding cassette exon 107′ expressed in U2OS cells at equal quantities while in VSMCs exon 107′ was exclusively expressed with no band detected for transcripts with the exon excluded expressed. Furthermore in VSMCs, transcripts with exons 110–113 removed were detected as well as transcripts with the exons included, although transcripts with the exons included seem to be transcribed in greater abundance. U2OS cells only expressed transcripts with the exons included.
Although splicing of cassette exons 6′ of nesprin-1 and exon 28–31, 101′ and 114 for nesprin-2 failed to be detected in this set of PCRs, examination of a wider array of cells and tissues is required to determine whether the splicing events listed in the databases occur.
Nesprin ΔKASH Isoforms
The search for potential splicing events for nesprin also revealed splice events that eliminate the KASH domain. Alternative splicing of cassette exon 145 of nesprin-1, results in a frame shift that removes the KASH domain to create Nesprin-1ΔKASH (N1-ΔKASH) (Figure 8A). Though the same 3′UTR adjacent to exon 146 is shared between KASH domain and N1-ΔKASH sequences, the removal of exon 145 results in a change in the open reading frame of N1-ΔKASH variants and therefore they terminate with a novel 11aa tail: VHKRWLRFLPF rather than the RYTNGPPPL sequence utilized by KASH containing variants. Expression of N1-ΔKASH isoforms was detected in all tissue cDNA examined by PCR, suggesting that this splicing and resultant variants are ubiquitously expressed (Figure 8D). When the ΔKASH variant of p53KASHNesp1 (p53ΔKASHNesp1) lacking exon 145 was transfected into U2OS cells it no longer resided at the NE, but instead displayed strong nuclear matrix localization and weak cytoplasmic staining (Figure 8A).
Unlike N1-ΔKASH, nesprin-2 possesses two mechanisms for creating ΔKASH variants (Figure 8B,C). Like nesprin-1, generation of N2-ΔKASH1 occurs via the removal of cassette exons 110 to 113 but uses the same 3′UTR as the KASH variant. This splicing event results in a change in the ORF and therefore N2-ΔKASH1 terminates with a GIAGHSATPPA amino acid sequence rather than the YPMLRYTNGPPPT sequence used by KASH containing isoforms. N2-ΔKASH2 is created by a novel 3′UTR immediately adjacent to the 3′ end of exon 115. N2-ΔKASH2 splicing truncates larger isoforms without generating a novel C-terminal peptide. The N2-ΔKASH1 splicing was pre-dominantly detected in the brain and kidney with smaller amounts being amplified from the heart, where the lower band represents the removal of the cassette exons promoting N2-ΔKASH1 formation (Figure 8D). The N2-ΔKASH2 termination was detected in the heart and spleen only (Figure 8D).
Discussion
Nesprins as Adaptable, Tissue Specific, Intracellular Scaffolds
This study has demonstrated that nesprins, by generating variants via alternative transcriptional initiation and termination show localizations and therefore functions independent of their original description as NE linkers and scaffolds. Although nesprin-1 has the potential to generate more isoforms than nesprin-2, with more UTRs spread across the gene, the nesprin-2 isoforms are primarily N-terminal truncations that would retain the KASH domain. This suggests that nesprin-1 may have more functions beyond the NE than nesprin-2 or that sequences near the highly conserved C-terminus of nesprin-2 are important for cell function [29]. To our knowledge, the potential combinations of UTRs and exon splicing are unlimited. This combined with the ability of nesprins to dynamically regulate variant expression would allow cells to fine-tune their nesprin isoform repertoire as needed to maintain and restore homeostasis following stress or to regulate tissue-specific signalling pathways [31]. As a proof of principle we were able to show that nesprin transcription appears to be highly adaptable with a feedback loop regulating nesprin variant expression. For example we demonstrate using siRNAs that by knocking down a region of nesprin-1 near the KASH domain we were able to upregulate expression of N1-3′E87 UTR transcripts. Furthermore nesprin-2 CH domain knockout mice display an altered expression pattern for specific nesprin-2 C-terminal isoforms in certain tissues to compensate for the loss of nesprin-2 giant or nesprin-2 actin binding domain isoforms [30]. These observations suggest that nesprin alternative transcript generation is highly flexible and more complex than a simplified tissue-specific expression model.
Generation, Regulation and Function of Novel Tissue Specific Nesprin Variants via Alternative Initiation and Termination
Using 5′ and 3′RACE as well as sequences in the EST database, followed by PCR amplification and DNA sequencing, we identified multiple novel sequence variants for nesprin-1 and -2. RT-PCR was used to establish the existence of mRNA transcripts for full-length short isoforms or for the novel UTRs of potentially larger variants. The multiple UTRs allow nesprins to express a large number of sequence variants via alternate initiation and termination and many of these were generated in a tissue specific manner. Therefore, in addition to the novel UTR’s verified in this study it is likely that by performing RACE in a greater collection of cells/tissues we may be able to identify further nesprin alternate initiation and termination sites.
To date, the mechanisms of tissue specific generation of nesprin variants has not been studied. Analysis of the human transcriptome shows a direct correlation between alternative promoter use and alternative splicing [32]. Alternative promoters can produce mRNAs with different 5′UTRs that encode the same protein, distinct N-termini, and even different proteins from the same locus [33], [34], [35], [36]. The identification of multiple, novel 5′UTRs in both nesprin-1 and -2 indicated the presence of several internal alternative promoters. The existence and regulation of alternative nesprin promoters has not yet been explored but this study suggests that these promoters are utilised in a tissue specific manner. Furthermore, because many individual variants have unique pairs of 5′ and 3′UTRs, additional control and regulation of variant expression can be maintained. The 5′UTR is an important regulator of mRNA translation and can contain regulatory motifs/sequences which affect the rate of translation as well as containing a kozak sequence upstream of the start codon which plays a major role in determining the translational strength of the transcript [37], [38]. The 3′UTR of mRNA transcripts can play a role in mRNA localization, stability, and translation [39], [40], [41], [42]. For example, binding of miRNAs to partially complementary sequences in the 3′UTR can result in de-adenylation and translational inhibition or destruction of the target mRNA [43], [44]. A RegRNA scan of both the nesprin 5′ and 3′UTRs for regulatory RNA motifs detected several potential miRNA binding sites which were transcript specific and could potentially regulate variant translation (data not shown).
Importantly, we showed that many of the variants generated through retained introns had generated unique peptide sequences. It is highly likely that these sequences expose new functional domains that give the variants additional localization signals or motifs that play an important role in their function. For example, ELM analysis predicts a novel retinoblastoma (Rb) interacting motif found in cell cycle regulatory proteins at the C-terminal end of p220CHNesp2 while the N-terminus of p931KASHNesp1 contains a potential N-myristoylation site, a post-translational modification which facilitates membrane anchoring [45], [46], [47]. ELM analysis also predicts multiple PKA, MAPK and CDK phosphorylation sites in the unique sequences of p32CHNesp2, p56CHNesp1 and p55Nesp1. To further explore this hypothesis yeast-2-hybrid analyses or co-immunoprecipitation assays will be required to identify binding partners for specific nesprin variants.
The ultimate validation for each proposed variant will be the detection of their translation and expression by western blotting. Post-translational modifications such as phosphorylation, sumoylation, and enzymatic cleavage may be partially responsible for the range of western bands often visualized using the currently available anti-nesprin antibodies [1], [17], [48]. Designing isoform-specific antibodies will help to distinguish between modifications and splicing.
Alternative Splicing of Cassette Exons may Diversify Nesprin Function and Localization
In addition to alternative initiation and termination, we showed that some of the cassette exons located in the EST database are indeed valid. It is unclear whether these splice events occur in multiple variants or are isoform specific but they are likely to substantially increase nesprin diversity, likely in a tissue specific manner. This notion was supported by the observation that while some splice events occurred in the majority of cell lines, some events seemed to be cell type specific. For example unlike the nesprin-1 ΔKASH which was detectable in all cells tested, the splicing event of cassette exons which generate nesprin-2 ΔKASH seem to be very tissue specific. Furthermore the ability for nesprin-2 to generate ΔKASH variants via 2 different mechanisms, one by the utilization of a unique 3′UTR and another by the splicing of exons 110–113 suggest that the C-terminal ends of the ΔKASH variants may serve unique tissue specific functions at sites away from the NE.
Although in this study we did not look specifically at the effects of structure, function and localization of nesprin variants with and without alternate splicing of the cassette exons we did show that some of these splicing events also created unique peptides. Nesprin-1 exon 93 encodes a unique 47 amino acid peptide sequence and nesprin-2 exon 107′ encodes a unique 23 amino acid peptide. Although these peptide sequences are not very large they may be capable of encoding novel localization signals or binding sites for interactions with other proteins. Our next aim will be to create nesprin variants with and without these exons so we can identify their putative roles in nesprin function.
However we were able to show that KASH-less nesprin isoforms displayed subcellular localizations which varied depending on the cell lines they were expressed in. In U2OS cells p56CHNesp1 localized to the nucleolus while the same protein localized along actin cables and focal adhesions in HDFs. Currently we do not understand what determines this differential change in subcellular localizations but we speculate that the presence of endogenous p32CHNesp2 at focal adhesions in U2OS cells (p32CHNesp2 is not expressed in HDFs but is expressed in U2OS) is enough for p56CHNesp1 function to become redundant at focal adhesions in U2OS. Furthermore we suspect that differences in the actin cytoskeleton may play a role in differential localization of p56CHNesp1. The nesprin-1 CH domains contain two nuclear localization signals which may be utilized in cells with low actin levels such as U2OS cells but not in structural cells such as HDFs where there is plenty of actin for the protein to bind to [49]. Alternatively, potential p56CHNesp1 phosphorylation events predicted by ELM analysis may occur in a tissue specific manner which may contribute to the differences seen in localizations between the two cell types. Similarly differential sub-cellular localizations were seen when central rod isoforms p12Nesp1, p23Nesp1 and p31Nesp1, were transfected into U2OS and HDFs. In U2OS cells all isoforms displayed diffuse cytoplasmic localization while in HDFs nucleolar localization was observed. Differences in post-translational modifications could vary between the two cell lines or the proteins may have different binding partners in each cell line which could contribute to differential localizations. Ultimately the localization of these isoforms would have to be monitored in cells that express the variant endogenously.
Isoforms and Disease
Multiple nesprin mutations have been identified in Emery Dreifuss Muscular Dystrophy (EDMD), Dilated Cardiomyopathies (DCM), autosomal recessive arthrogryposis (ARA) and autosomal recessive cerebellar ataxia (ARCA1) [15], [17], [18], [50], [51]. The nesprin mutations promoting EDMD and DCM presumably affect LINC nesprin variants resulting in abnormal nuclear morphology and function.
ARA is caused by an A to G mutation in a splice acceptor site, resulting in retention of intron 136 of nesprin-1 [51]. This mutation produces a premature stop codon and therefore the nesprin-1 giant, nesprin-1β and nesprin-1α isoforms should lack the KASH domain. Conversely these patients appeared to have no defects in nuclear morphology or lamin and emerin localization, suggesting other nesprin gene products or p53KASHNesp1 which should not be effected by this mutation maybe enough to keep the nucleus intact.
ARCA1 is a neurological disease characterized by irregular gait and lack of limb coordination [18]. Five different mutations giving rise to ARCA1 were identified within the central spectrin rod of nesprin-1, upstream of the KASH variants identified so far. The A310067G mutation which effects the invariant A of the AG splice acceptor site at the junction of exon 85 and intron 84 results in the formation of a pre-mature stop codon and therefore will effect production of not only the p40, p50, p31 and p23 nesprin-1 proteins identified in this study but also other variants terminating with the N1-3′E87 and N1-3′E90 ends in there native tissues/cells. Although many diseases associated with nesprins so far suggest that NE nesprins are involved, ARCA1 patients appear to have no nuclear defects, suggesting that nesprin associated signalling pathways beyond the NE may be significantly hindered and potentially causative in the disease.
Materials and Methods
Identification of Novel UTRs
Rapid Amplification of cDNA Ends (RACE) on Brain, HeLa and Skeletal muscle Marathon-Ready cDNA libraries using the Advantage-2 PCR kit (Clontech) and gene specific primers was performed (Table S3). Resultant PCR fragments were cloned into pGEM-T easy vector (Promega) and sequenced (Gene Service). These sequences were then BLASTED against the human genome and novel cDNA ends were further analyzed.
Additional novel UTRs for nesprin-1 and nesprin-2 were identified by screening the NCBI expressed sequence tag (EST) database with consecutive, 500 bp-overlapping 1 kb Nesprin-1 and Nesprin-2 sequences covering the entirety of the giant isoform cDNAs. Tissue specificity of novel UTRs was determined by performing PCR amplification in a multiple tissue cDNA collection (Clontech). 30 PCR cycles were performed on 0.5 ul of cDNA followed by a further 15 cycles on 1 ul of the amplified product. Specificity of the PCR products were validated by DNA sequencing. Primers used for UTR expression can be found in Table S4. Primers used for cassette exon splicing and detection of nesprin ΔKASH variants can be found in Tables S5 and S6 respectively.
Plasmids
Isoforms p53KASHNesp1, p56CHNesp1 and p50Nesp1 were Taq PCR amplified from tissue cDNA and cloned into pGEM-T Easy. The pGEM-T plasmids were subsequently used as templates for Pfu amplification with primers containing restriction sites and ligated into pCMV-Tag2 vector. p53ΔKASHNesp1 was cloned using inverse PCR with Pfu off the Flag-p53KASHNesp1 vector while p50Nesp1 served as a template for the inverse PCR and creation of p41Nesp1 and p30Nesp1. The Kazusa cDNA clone KIAA1262 served as a template for PCR amplification and cloning of p31Nesp1, p23Nesp1 and p12Nesp1 into a pCMV-Tag2 (Clontech). p32CHNesp2 was PCR amplified from IMAGE clone 5478637 and cloned into pCMV-Tag2 as described.
Tissue culture
Normal human dermal fibroblasts (HDF) and osteosarcoma cells (U2OS) were obtained from American Tissue Culture Collection (ATCC). The cells were passaged after reaching 70% confluency and maintained in DMEM complete media (Sigma) supplemented with 10 units/mL penicillin, 10 mg/mL streptomycin, 200 µM L-glutamine and 10% FBS.
Transfections
For Flag-tagged construct expression, 1×106 HDFs or U2OS cells were electroporated with 1 µg plasmid DNA using an Amaxa Nucleofector and cultured on coverslips for 16 hours.
Immunofluorescence
Cells were fixed for 5 minutes in 3.7% paraformaldehyde in PBS followed by 2 min permeabilization with 0.5% NP-40 in PBS. The coverslips were incubated with blocking solution (1% BSA) for 1 hour at RT. The primary antibodies were diluted in blocking solution and applied to the coverslips for 1 hour at RT, followed by a 1 hour RT incubation with fluorescent dye-conjugated secondary antibodies (Invitrogen) diluted in blocking solution. The coverslips were washed with PBS, mounted onto slides with medium containing DAPI, and visualized using a Leica SP5 confocal microscope or a Zeiss Axioskop microscope.
siRNA Knockdown and qRT-PCR
U2OS cells were transfected with siRNAs for nesprin-1 or control siRNA using hiperfect transfection reagent (Quiagen) as described by the manufacturer. Three days post-transfection total RNA was obtained from cells using Triazole RNA STAT-60 and phenol chloroform extraction. 2 µg of total RNA was reverse transcribed using AMV Reverse Transcriptase (Promega) according to the manufacturer’s instructions. qPCR was performed in a 20 µl reaction containing cDNA per 1× SYBR Green PCR master mix (Eurogentec) and 0.1 µM of each primer. PCR products were amplified, N1-3′E87 primers (forward, 5′- TCTCCAAGCTCAATCAGGCAGCAT -3′ and reverse, 5′- CACAGCCCTCTAAGTGTTGTGTCA -3′), N1-3′E90 primers (forward, 5′- AGTTGGACGTCTCAGTCTCAAGGA -3′ and reverse, 5′- TTTGATGGCTGAGCCCACACAATG -3′), KASH primers (forward, 5′-CGAGGCAAGTGTAGTCTCTCACAG-3′ and reverse, 5′-AGGGCCATTCGTGTATCTGAGCAT-3′) and GAPDH primers (forward, 5′-CGACCACTTTGTCAAGCTC-3′ and reverse, 5′- CAAGGGTCTACATGGCAAC-3′). The cycling parameters were 94°C for 15 seconds followed by a single step annealing and extension at 60°C for 60 seconds. Amplifications were performed on RotorGene-3000 (Corbett). Fold changes between samples were calculated by the delta-delta CT method.
Supporting Information
Footnotes
Competing Interests: The authors have declared that no competing interests exist.
Funding: Medical Research Council and the British Heart Foundation provided funding for this study. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1.Zhang Q, Skepper JN, Yang F, Davies JD, Hegyi L, et al. Nesprins: a novel family of spectrin-repeat-containing proteins that localize to the nuclear membrane in multiple tissues. J Cell Sci. 2001;114:4485–4498. doi: 10.1242/jcs.114.24.4485. [DOI] [PubMed] [Google Scholar]
- 2.Zhang Q, Ragnauth CD, Skepper JN, Worth NF, Warren DT, et al. Nesprin-2 is a multi-isomeric protein that binds lamin and emerin at the nuclear envelope and forms a subcellular network in skeletal muscle. J Cell Sci. 2005;118:673–687. doi: 10.1242/jcs.01642. [DOI] [PubMed] [Google Scholar]
- 3.Wilhelmsen K, Litjens SH, Kuikman I, Tshimbalanga N, Janssen H, et al. Nesprin-3, a novel outer nuclear membrane protein, associates with the cytoskeletal linker protein plectin. J Cell Biol. 2005;171:799–810. doi: 10.1083/jcb.200506083. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Roux KJ, Crisp ML, Liu Q, Kim D, Kozlov S, et al. Nesprin 4 is an outer nuclear membrane protein that can induce kinesin-mediated cell polarization. Proc Natl Acad Sci U S A. 2009;106:2194–2199. doi: 10.1073/pnas.0808602106. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Crisp M, Liu Q, Roux K, Rattner JB, Shanahan C, et al. Coupling of the nucleus and cytoplasm: role of the LINC complex. J Cell Biol. 2006;172:41–53. doi: 10.1083/jcb.200509124. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Stewart-Hutchinson PJ, Hale CM, Wirtz D, Hodzic D. Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness. Exp Cell Res. 2008;314:1892–1905. doi: 10.1016/j.yexcr.2008.02.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Zhang Q, Ragnauth C, Greener MJ, Shanahan CM, Roberts RG. The nesprins are giant actin-binding proteins, orthologous to Drosophila melanogaster muscle protein MSP-300. Genomics. 2002;80:473–481. [PubMed] [Google Scholar]
- 8.Zhen YY, Libotte T, Munck M, Noegel AA, Korenbaum E. NUANCE, a giant protein connecting the nucleus and actin cytoskeleton. J Cell Sci. 2002;115:3207–3222. doi: 10.1242/jcs.115.15.3207. [DOI] [PubMed] [Google Scholar]
- 9.Ketema M, Wilhelmsen K, Kuikman I, Janssen H, Hodzic D, et al. Requirements for the localization of nesprin-3 at the nuclear envelope and its interaction with plectin. J Cell Sci. 2007;120:3384–3394. doi: 10.1242/jcs.014191. [DOI] [PubMed] [Google Scholar]
- 10.Hale CM, Shrestha AL, Khatau SB, Stewart-Hutchinson PJ, Hernandez L, et al. Dysfunctional connections between the nucleus and the actin and microtubule networks in laminopathic models. Biophys J. 2008;95:5462–5475. doi: 10.1529/biophysj.108.139428. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Lammerding J, Schulze PC, Takahashi T, Kozlov S, Sullivan T, et al. Lamin A/C deficiency causes defective nuclear mechanics and mechanotransduction. J Clin Invest. 2004;113:370–378. doi: 10.1172/JCI19670. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Lammerding J, Hsiao J, Schulze PC, Kozlov S, Stewart CL, et al. Abnormal nuclear shape and impaired mechanotransduction in emerin-deficient cells. J Cell Biol. 2005;170:781–791. doi: 10.1083/jcb.200502148. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Verstraeten VL, Ji JY, Cummings KS, Lee RT, Lammerding J. Increased mechanosensitivity and nuclear stiffness in Hutchinson-Gilford progeria cells: effects of farnesyltransferase inhibitors. Aging Cell. 2008;7:383–393. doi: 10.1111/j.1474-9726.2008.00382.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Fairley EA, Kendrick-Jones J, Ellis JA. The Emery-Dreifuss muscular dystrophy phenotype arises from aberrant targeting and binding of emerin at the inner nuclear membrane. J Cell Sci 112 (Pt. 1999;15):2571–2582. doi: 10.1242/jcs.112.15.2571. [DOI] [PubMed] [Google Scholar]
- 15.Puckelwartz MJ, Kessler E, Zhang Y, Hodzic D, Randles KN, et al. Disruption of nesprin-1 produces an Emery Dreifuss muscular dystrophy-like phenotype in mice. Hum Mol Genet. 2009;18:607–620. doi: 10.1093/hmg/ddn386. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Raffaele Di Barletta M, Ricci E, Galluzzi G, Tonali P, Mora M, et al. Different mutations in the LMNA gene cause autosomal dominant and autosomal recessive Emery-Dreifuss muscular dystrophy. Am J Hum Genet. 2000;66:1407–1412. doi: 10.1086/302869. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Zhang Q, Bethmann C, Worth NF, Davies JD, Wasner C, et al. Nesprin-1 and -2 are involved in the pathogenesis of Emery Dreifuss muscular dystrophy and are critical for nuclear envelope integrity. Hum Mol Genet. 2007;16:2816–2833. doi: 10.1093/hmg/ddm238. [DOI] [PubMed] [Google Scholar]
- 18.Gros-Louis F, Dupre N, Dion P, Fox MA, Laurent S, et al. Mutations in SYNE1 lead to a newly discovered form of autosomal recessive cerebellar ataxia. Nat Genet. 2007;39:80–85. doi: 10.1038/ng1927. [DOI] [PubMed] [Google Scholar]
- 19.Lindholm E, Ekholm B, Shaw S, Jalonen P, Johansson G, et al. A schizophrenia-susceptibility locus at 6q25, in one of the world’s largest reported pedigrees. Am J Hum Genet. 2001;69:96–105. doi: 10.1086/321288. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Tessema M, Willink R, Do K, Yu YY, Yu W, et al. Promoter methylation of genes in and around the candidate lung cancer susceptibility locus 6q23–25. Cancer Res. 2008;68:1707–1714. doi: 10.1158/0008-5472.CAN-07-6325. [DOI] [PubMed] [Google Scholar]
- 21.Warren DT, Tajsic T, Mellad JA, Searles R, Zhang Q, et al. Novel nuclear nesprin-2 variants tether active extracellular signal-regulated MAPK1 and MAPK2 at promyelocytic leukemia protein nuclear bodies and act to regulate smooth muscle cell proliferation. J Biol Chem. 2010;285:1311–1320. doi: 10.1074/jbc.M109.032557. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Gough LL, Fan J, Chu S, Winnick S, Beck KA. Golgi localization of Syne-1. Mol Biol Cell. 2003;14:2410–2424. doi: 10.1091/mbc.E02-07-0446. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Gough LL, Beck KA. The spectrin family member Syne-1 functions in retrograde transport from Golgi to ER. Biochim Biophys Acta. 2004;1693:29–36. doi: 10.1016/j.bbamcr.2004.04.004. [DOI] [PubMed] [Google Scholar]
- 24.Kobayashi Y, Katanosaka Y, Iwata Y, Matsuoka M, Shigekawa M, et al. Identification and characterization of GSRP-56, a novel Golgi-localized spectrin repeat-containing protein. Exp Cell Res. 2006;312:3152–3164. doi: 10.1016/j.yexcr.2006.06.026. [DOI] [PubMed] [Google Scholar]
- 25.Dou Y, Milne TA, Tackett AJ, Smith ER, Fukuda A, et al. Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF. Cell. 2005;121:873–885. doi: 10.1016/j.cell.2005.04.031. [DOI] [PubMed] [Google Scholar]
- 26.Marme A, Zimmermann HP, Moldenhauer G, Schorpp-Kistner M, Muller C, et al. Loss of Drop1 expression already at early tumor stages in a wide range of human carcinomas. Int J Cancer. 2008;123:2048–2056. doi: 10.1002/ijc.23763. [DOI] [PubMed] [Google Scholar]
- 27.Nedivi E, Fieldust S, Theill LE, Hevron D. A set of genes expressed in response to light in the adult cerebral cortex and regulated during development. Proc Natl Acad Sci U S A. 1996;93:2048–2053. doi: 10.1073/pnas.93.5.2048. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Cottrell JR, Borok E, Horvath TL, Nedivi E. CPG2: a brain- and synapse-specific protein that regulates the endocytosis of glutamate receptors. Neuron. 2004;44:677–690. doi: 10.1016/j.neuron.2004.10.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Simpson JG, Roberts RG. Patterns of evolutionary conservation in the nesprin genes highlight probable functionally important protein domains and isoforms. Biochem Soc Trans. 2008;36:1359–1367. doi: 10.1042/BST0361359. [DOI] [PubMed] [Google Scholar]
- 30.Luke Y, Zaim H, Karakesisoglou I, Jaeger VM, Sellin L, et al. Nesprin-2 Giant (NUANCE) maintains nuclear envelope architecture and composition in skin. J Cell Sci. 2008;121:1887–1898. doi: 10.1242/jcs.019075. [DOI] [PubMed] [Google Scholar]
- 31.Kandert S, Luke Y, Kleinhenz T, Neumann S, Lu W, et al. Nesprin-2 giant safeguards nuclear envelope architecture in LMNA S143F progeria cells. Hum Mol Genet. 2007;16:2944–2959. doi: 10.1093/hmg/ddm255. [DOI] [PubMed] [Google Scholar]
- 32.Xin D, Hu L, Kong X. Alternative promoters influence alternative splicing at the genomic level. PLoS One. 2008;3:e2377. doi: 10.1371/journal.pone.0002377. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Pecci A, Viegas LR, Baranao JL, Beato M. Promoter choice influences alternative splicing and determines the balance of isoforms expressed from the mouse bcl-X gene. J Biol Chem. 2001;276:21062–21069. doi: 10.1074/jbc.M008665200. [DOI] [PubMed] [Google Scholar]
- 34.Shmelkov SV, Jun L, St Clair R, McGarrigle D, Derderian CA, et al. Alternative promoters regulate transcription of the gene that encodes stem cell surface protein AC133. Blood. 2004;103:2055–2061. doi: 10.1182/blood-2003-06-1881. [DOI] [PubMed] [Google Scholar]
- 35.Zaika AI, Slade N, Erster SH, Sansome C, Joseph TW, et al. DeltaNp73, a dominant-negative inhibitor of wild-type p53 and TAp73, is up-regulated in human tumors. J Exp Med. 2002;196:765–780. doi: 10.1084/jem.20020179. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Quelle DE, Zindy F, Ashmun RA, Sherr CJ. Alternative reading frames of the INK4a tumor suppressor gene encode two unrelated proteins capable of inducing cell cycle arrest. Cell. 1995;83:993–1000. doi: 10.1016/0092-8674(95)90214-7. [DOI] [PubMed] [Google Scholar]
- 37.Vagner S, Waysbort A, Marenda M, Gensac MC, Amalric F, et al. Alternative translation initiation of the Moloney murine leukemia virus mRNA controlled by internal ribosome entry involving the p57/PTB splicing factor. J Biol Chem. 1995;270:20376–20383. doi: 10.1074/jbc.270.35.20376. [DOI] [PubMed] [Google Scholar]
- 38.Melefors O, Hentze MW. Iron regulatory factor–the conductor of cellular iron regulation. Blood Rev. 1993;7:251–258. doi: 10.1016/0268-960x(93)90012-s. [DOI] [PubMed] [Google Scholar]
- 39.Eldad N, Yosefzon Y, Arava Y. Identification and characterization of extensive intra-molecular associations between 3′-UTRs and their ORFs. Nucleic Acids Res. 2008;36:6728–6738. doi: 10.1093/nar/gkn754. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Aronov S, Aranda G, Behar L, Ginzburg I. Axonal tau mRNA localization coincides with tau protein in living neuronal cells and depends on axonal targeting signal. J Neurosci. 2001;21:6577–6587. doi: 10.1523/JNEUROSCI.21-17-06577.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Tanguay RL, Gallie DR. Translational efficiency is regulated by the length of the 3′ untranslated region. Mol Cell Biol. 1996;16:146–156. doi: 10.1128/mcb.16.1.146. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Loya A, Pnueli L, Yosefzon Y, Wexler Y, Ziv-Ukelson M, et al. The 3′-UTR mediates the cellular localization of an mRNA encoding a short plasma membrane protein. RNA. 2008;14:1352–1365. doi: 10.1261/rna.867208. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Mathonnet G, Fabian MR, Svitkin YV, Parsyan A, Huck L, et al. MicroRNA inhibition of translation initiation in vitro by targeting the cap-binding complex eIF4F. Science. 2007;317:1764–1767. doi: 10.1126/science.1146067. [DOI] [PubMed] [Google Scholar]
- 44.Fabian MR, Andrew White K. Extracting viral RNAs from plant protoplasts. Curr Protoc Microbiol Chapter 16: Unit 16E 11. 2007. [DOI] [PubMed]
- 45.Dahiya A, Gavin MR, Luo RX, Dean DC. Role of the LXCXE binding site in Rb function. Mol Cell Biol. 2000;20:6799–6805. doi: 10.1128/mcb.20.18.6799-6805.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Utsumi T, Sato M, Nakano K, Takemura D, Iwata H, et al. Amino acid residue penultimate to the amino-terminal gly residue strongly affects two cotranslational protein modifications, N-myristoylation and N-acetylation. J Biol Chem. 2001;276:10505–10513. doi: 10.1074/jbc.M006134200. [DOI] [PubMed] [Google Scholar]
- 47.Koutelou E, Sato S, Tomomori-Sato C, Florens L, Swanson SK, et al. Neuralized-like 1 (Neurl1) targeted to the plasma membrane by N-myristoylation regulates the Notch ligand Jagged1. J Biol Chem. 2008;283:3846–3853. doi: 10.1074/jbc.M706974200. [DOI] [PubMed] [Google Scholar]
- 48.Dawe HR, Adams M, Wheway G, Szymanska K, Logan CV, et al. Nesprin-2 interacts with meckelin and mediates ciliogenesis via remodelling of the actin cytoskeleton. J Cell Sci. 2009;122:2716–2726. doi: 10.1242/jcs.043794. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Padmakumar VC, Abraham S, Braune S, Noegel AA, Tunggal B, et al. Enaptin, a giant actin-binding protein, is an element of the nuclear membrane and the actin cytoskeleton. Exp Cell Res. 2004;295:330–339. doi: 10.1016/j.yexcr.2004.01.014. [DOI] [PubMed] [Google Scholar]
- 50.Nikolova-Krstevski V, Leimena C, Xiao XH, Kesteven S, Tan JC, et al. Nesprin-1 and actin contribute to nuclear and cytoskeletal defects in lamin A/C-deficient cardiomyopathy. J Mol Cell Cardiol. 2011;50:479–486. doi: 10.1016/j.yjmcc.2010.12.001. [DOI] [PubMed] [Google Scholar]
- 51.Attali R, Warwar N, Israel A, Gurt I, McNally E, et al. Mutation of SYNE-1, encoding an essential component of the nuclear lamina, is responsible for autosomal recessive arthrogryposis. Hum Mol Genet. 2009;18:3462–3469. doi: 10.1093/hmg/ddp290. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.