Skip to main content
Evolutionary Bioinformatics Online logoLink to Evolutionary Bioinformatics Online
. 2012 Jun 21;8:321–355. doi: 10.4137/EBO.S9369

AP2/ERF Transcription Factor in Rice: Genome-Wide Canvas and Syntenic Relationships between Monocots and Eudicots

Muhammad Rashid 1,✉, He Guangyuan 1, Yang Guangxiao 1, Javeed Hussain 1, Yan Xu 1
PMCID: PMC3396566  PMID: 22807623

Abstract

The transcription factor family intimately regulates gene expression in response to hormones, biotic and abiotic factors, symbiotic interactions, cell differentiation, and stress signalling pathways in plants. In this study, 170 AP2/ERF family genes are identified by phylogenetic analysis of the rice genome (Oryza sativa l. japonica) and they are divided into a total of 11 groups, including four major groups (AP2, ERF, DREB, and RAV), 10 subgroups, and two soloists. Gene structure analysis revealed that, at position-6, the amino acid threonine (Thr-6) is conserved in the double domain AP2 proteins compared to the amino acid arginine (Arg-6), which is preserved in the single domain of ERF proteins. In addition, the histidine (His) amino acid is found in both domains of the double domain AP2 protein, which is missing in single domain ERF proteins. Motif analysis indicates that most of the conserved motifs, apart from the AP2/ERF domain, are exclusively distributed among the specific clades in the phylogenetic tree and regulate plausible functions. Expression analysis reveals a widespread distribution of the rice AP2/ERF family genes within plant tissues. In the vegetative organs, the transcripts of these genes are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues, the gene expression of this family is observed high in the embryo and lemma. From chromosomal localization, it appears that repetition and tandem-duplication may contribute to the evolution of new genes in the rice genome. In this study, interspecies comparisons between rice and wheat reveal 34 rice loci and unveil the extent of collinearity between the two genomes. It was subsequently ascertained that chromosome-9 has more orthologous loci for CRT/DRE genes whereas chromosome-2 exhibits orthologs for ERF subfamily members. Maximum conserved synteny is found in chromosome-3 for AP2 double domain subfamily genes. Macrosynteny between rice and Arabidopsis, a distant, related genome, uncovered 11 homologs/orthologs loci in both genomes. The distribution of AP2/ERF family gene paralogs in Arabidopsis was most frequent in chromosome-1 followed by chromosome-5. In Arabidopsis, ERF subfamily gene orthologs are found on chromosome-1, chromosome-3, and chromosome-5, whereas DRE subfamily genes are found on chromosome-2 and chromosome-5. Orthologs for RAV and AP2 with double domains in Arabidopsis are located on chromosome-1 and chromosome-3, respectively. In conclusion, the data generated in this survey will be useful for conducting genomic research to determine the precise role of the AP2/ERF gene during stress responses with the ultimate goal of improving crops.

Keywords: AP2/ERF, CBF/DREB, RAV, phylogenetic analysis, rice, wheat, Arabidopsis

Introduction

Plants encounter various natural affronts, from pests, diseases, and ecological changes, including those affecting temperature and water. These factors greatly impinge on a plant’s endurance, growth, and production. In order to stay alive and grow in diverse environments, plants have developed a complex signalling network at the molecular, cellular, and system levels. Gene co-expression at the transcription level is the foremost regulatory mechanism in biological processes. Transcription factors (TFs) control the majority of multiple stress response genes in a synchronized manner and are characterized as attractive targets for application in molecular plant biology. Among different TFs, the ethylene responsive transcription factors (ERF) family plays a vital role in plant growth and enables plants capable of fighting ambiance changes.1–4 Therefore, it is important to understand the function of these genes in order to ameliorate crop yield and allow them to grow in sundry environmental conditions.

In the plant Kingdom, APETALA2/ethylene-responsive element-binding protein (AP2/EREBP) is a large family of TFs that contain AP2, RAV, and ERF family genes. This super family is characterized by the conserved AP2/ERF DNA binding domain, comprising of 60–70 amino acid residues.5,6 This domain, first reported in the homeotic gene AP2 of Arabidopsis, is involved in flower development.7 The ERF domain was first described as a conserved motif in four DNA-binding proteins (EREBP1, 2, 3, and 4; presently renamed ERF1, 2, 3, and 4, respectively) in tobacco plants. This domain binds to a GCC box, which is a DNA sequence involved in the ethylene-responsive transcription of genes.8 In tomatoes, three proteins (Pti-4, Pti-5, and Pti-6) are reported to interact with disease resistance proteins, determined using yeast two-hybrid assays,9 and each protein has a domain homologous to the AP2/ERF domain. Based on the number of AP2/ERF domains and their gene function, the AP2/ERF gene family is divided into four subfamilies: AP2, RAV, dehydration-responsive element-binding protein (DREB), and ERF.10

The AP2 family genes possess two repeats of the AP2/ERF domain and the ERF family proteins contain a single AP2/ERF domain whereas RAV (related to VP1/ABI3) family proteins have an additional B3 DNA binding domain. The AP2 subfamily is further subdivided into two monophyletic groups: AP2 and AINTEGUMENTA (ANT).11 Based on ERF domain binding to DNA sequences, the ERF family is further split up into two subfamilies: ERF and CBF/DREB.6 Proteins encoded by ERF subfamily genes bind to the core motif AGCCGCC;8,12 whereas, CBF/DREB subfamily genes containing C-repeats recognize the cis-acting element, A/GCCGAC.13

ERF subfamily genes have conserved alanine (Ala) at position-14 and aspartic acid (Asp) at position-19, while CBF/DREB subfamily genes have valanine (Val) at position-14 and glutamine (Glu) at position-19.14 The three-dimensional structure of the AP2/ERF domain from AtERF1 is portrayed using hetero-nuclear multidimensional Nuclear Magnetic Resonance and is comprised of three anti-parallel β-sheets and an α-helix.15 Moreover, tryptophan (Trp) and arginine (Arg) residues present in the β-sheets come into contact with DNA during transcription.14

The AP2/ERF family is identified in the Arabidopsis,6,10 grapevine,16 poplar,17 and rice genomes with 145, 132, 200, and 163 genes, respectively.18 Using genetic and molecular approaches, AP2/ERF proteins were determined to play an imperative role in the transcriptional regulation of diverse biological processes. These processes are related to plant growth, development, and response to environmental stimuli.2,19 The genes in this family participate in different pathways in response to hormones and biotic and abiotic stresses, such a jasmonate,20,21 abscisic acid (ABA),22,23 drought,24,25 salinity,26,27 cold,28,29 disease,21,30,31 and flooding stress.32 The AP2 family contributes to the regulation of developmental processes, such as flower development,7,33 early floral meristem identity,34 crown and lateral roots,35,36 and somatic embryogenesis.37 In addition, the involution of RAV family members is reported in the AP2/ERF family in response to ethylene,38 brassinosteroid,39,40 and biotic and abiotic stresses.30,41,42

Determination of the phylogenetic relationship is a crucial step in elucidating the evolution of crop species. In the past, AP2/ERF genes were considered plant specific but,5 recently, this domain was reported in non-plants for the first time in the ciliate Tetrahymena thermophila,43 cyanobacterium Trichodesmium erythraeum, and viruses Enterobacteria phage Rb49 and Bacteriophage Felix 01.44 The non-plant AP2-domain containing proteins have HNH domains edging the AP2/ERF domain. These are known as HNH endonuclease encoded by the His-Ans-His sequence motif.45 It is hypothesized that AP2/ERF TFs may have originated by horizontal transfer of the (HNH)-AP2 endonuclease from bacteria/viruses into plants via transpositions and homing processes.44

The above cited work was done on different plants whereas the present work is reported on rice. Belonging to the gramene family, rice is the world’s most important staple crop that ensures food security. In addition to its agricultural utility and small genome size (394Mb), rice provides an excellent model plant system to study plant-pathogen interactions, hormonal pathways, and resistance to environmental stresses. Some AP2/ERF family genes have been cloned from rice, but the function of the majority of them remains unclear. The completion of high-quality sequencing of the rice genome has furnished an excellent opportunity for elaborate gene analysis.

In this study, 170 OsAP2/ERF rice genes are obtained from different database searches and are classified into their respective clades according to their homology with known genes. The functional analysis of each transcriptional factor belonging to the AP2/ERF family is carried out keeping in mind their functional redundancy. In addition, phylogenetic analysis of AP2/ERF genes, complete alignment of each subfamily gene, and distribution of the conserved motifs outside the AP2/ERF domain exhibiting the specificity for gene function is performed. Moreover, to generate a clear picture of AP2/ERF genes, the position of each gene on the chromosomes is determined and gene expression profile canvasing is executed to determine tissue specificity. Comparative mapping between a monocot (wheat) and a eudicot (Arabidopsis) is performed to identify homologs/orthologs among the genomes. The data brought forth in this canvas will help in the selection of appropriate genes for further functional characterization and understanding of precise regulatory checkpoints operating during development and stress responses in crop plants.

Materials and Methods

Identification of AP2/ERF genes in rice genome

First, rice AP2/ERF genes were identified in the genome of Oryza sativa l. japonica cultivar Nipponbare using ESTs and cDNA sequences. The data were downloaded from various public repositories, including The National Centre for Biotechnology Information (NCBI),46 The Database of Rice Transcription Factors (DRTF),47 The MSU Rice Genome Annotation Project Database,48 Knowledge-based Oryza Molecular Biological Encyclopedia (KOME),49 and Plant Genome Database (PlantGDB).50 Next, all retrieved sequences were subjected to the BLAT online tool available on the RAP-DB website to find homologous sequences in the rice genome.51 The sequences showing more than 80% coverage areas were expanded approximately 2000 bp on both sides of the hit to find the open reading frame (ORF) using the GENSCAN online tool.52 Data assembly was performed using a DNA Assembly Sequence Programme CAP3.53 In addition, Simple Modular Architecture Research Tool (SMART) is used to confirm the presence of the AP2/ERF domain in the resulting sequences.54

Phylogenetic and MEME motif analysis

The AP2/ERF domain comprising protein sequences obtained from various sources are aligned using ClustalX 2.054 and redundant entries are removed.55 A combined un-rooted neighbor-joining (NJ) tree was generated in MEGA 4.056 with the following default parameters:56 poisson correction, pairwise deletion, and bootstrap (5000 replicates). Conserved motifs in rice AP2/ERF protein sequences were identified using a motif based sequence analysis tool, MEME Suite version 4.7.0,57 with following parameters: optimum width 6–200 amino acids, any number of repetitions of a motif, and maximum number of motifs set at 25. The BLAST search for the resulting motifs in NCBI and MS-Homology databases was carried out to determine their significance.

Intron/exon size distribution of AP2/ERF family genes

Intron positions in genes are ascertained through the identification of gaps in alignment of full-length cDNA transcripts with genomic sequences using the online tool Gene Structure Display Server (GSDS).58 Concisely, for a single full-length cDNA aligned against a conterminous stretch of genomic sequence, exons are proximal blocks of homologous sequence between full-length cDNA and genomic sequences, whereas introns are gaps between exons consisting entirely of genomic sequence. The general distribution of introns within each coding DNA sequence (CDS) is analyzed by the distribution of exon sizes. The mean exon size for a full length cDNA containing ni introns (regardless of pattern of distribution) is calculated as [Length of coding DNA sequence/(ni + 1)].59 The total length of a gene is calculated by adding the length of all of the exons of each gene. Moreover, exon size and total gene length of each gene are plotted graphically to clarify the range and size of AP2/ERF family genes.

Gene expression analysis

To further investigate and confirm AP2/ERF gene expression, the rice expression profile database (RiceXPro), which is a repository of gene expression data derived from microarray experiments encompassing the entire life cycle of the rice plant from germination, seedling, tillering, stem elongation, panicle initiation, booting, heading, flowering, and ripening stage,60 was used. This tool generates a heat map of normalized signal intensity values for each plant tissue for each gene and provides a quantitative measure of the transcript of particular genes.

In Silico identification of AP2/ERF gene family orthologs/homologs in rice, wheat and Arabidopsis genomes

Comparative genetic mapping among closely related (wheat) and distantly related (Arabidopsis) genomes divulges a high level of synteny in gene content and gene function. The Arabidopsis AP2/ERF genes were retrieved from the supplementary file provided by a genome wide survey of ERF family genes in Arabidopsis and rice,10 and were confirmed using a database of genetic and molecular biology for the model plant Arabidopsis thaliana (TAIR).61 Regarding wheat (Triticum aestivum), AP2/ERF sequences were retrieved from NCBI,46 Plant Genome Database (PlantGDB),50 and Chinese-Spring draft genome assembly or raw sequence reads using BLAST available online at CerealsDB, University of Bristol. Wheat and Arabidopsis AP2/ERF consensus gene sequences were used to BLAST against rice annotated genes and rice full length (FL) cDNAs with BLASTx and BLASTn, respectively, to identify orthologs/homologs between the genomes.

Results and Discussions

To ascertain the AP2/ERF family genes in the rice genome, sequences obtained from various resources as mentioned in the materials and methods were assembled using the CAP3 online tool. After confirmation of the AP2/ERF domain using the SMART online tool and removing the redundant sequences by alignment using ClustalX 2.0, it was determined that 170 sequences encode the AP2/ERF domain (Supplementary File 2). It was also discovered that 143 genes encode a single AP2/ERF domain. Twenty-three genes are anticipated to encode proteins comprising double AP2/ERF domains whereas four genes are prognosticated to encode a single AP2/ERF domain together with one B3 domain. Based on these results, the former and latter genes are appointed to the AP2 with double domain and the RAV families, respectively.

These results are an improvement on the AP2/ERF super family described by Nakano and his co-workers as they do not use these two subfamilies in their investigation under genome-wide analysis of the ERF gene family in Arabidopsis and rice (Supplementary File 2).10 Regarding the importance of the AP2 subfamily genes with double domains, the ANT gene plays a critical role in the development of gynoecium marginal tissues (eg, stigma, style, and septa), and in the fusion of carpels and medial ridges that lead to ovule primordial.62 BABY BOOM (BBM) promotes cell proliferation, differentiation, and morphogenesis, especially during embryogenesis.63 WRINKLED (WRl) genes are involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. These are involved in the activation of a subset of sugar-responsive genes and the control of carbon flow from sucrose import to oil accumulation in developing seeds.64 The PLETHORA (PLT) gene acts as a transcriptional activator and functions as a master regulator of basal/root fate; it is essential for root quiescent centre (QC) and columella specification, stem cell activity, as well as for the establishment of the stem cell niche during embryogenesis. PLT also modulates root polar auxin transport by regulating the distribution of PIN genes and plays an essential role in specifying pattern and polarity in damaged roots.65 Besides, genes with floral homeotic proteins promote early floral meristem identity and are subsequently required for the transition of an inflorescence meristem into a floral meristem; they play a central role in the specification of floral identity, particularly for the normal development of sepals and petals in the wild-type flower.66

Other subfamily genes with one B3 domain function as negative regulators of plant growth and development. These genes are expressed in all tissues: roots, rosette leaves, cauline leaves, inflorescence stems, flowers, and siliques. They have highest expression in roots and rosette leaves and low expression in flowers.39

Phylogenetic relationships between AP2/ERF family transcription factors in rice

To dissect the phylogenetic relationships between rice AP2/ERF family proteins, multiple alignment analyses were executed using the amino acid sequences of the AP2/ERF domains. The alignment predicts that Gly-4, Val-5, Gly-11, Ile-17, Arg-26, Trp-28, Leu-29, Gly-30, Ala-38, Ala-39, Asp-43, Gly-51, Asn-58, and Phe-59 are completely conserved in all AP2/ERF single domain family members in rice (Fig. 2A). In addition, more than 95% of ERF members have conserved Arg-3, Arg-6, Arg-8, Glu-16, Arg-18, Ala-35, Ala-45, Ala-46, and Ala-55 amino acid residues. The AP2/ERF proteins with a single domain in the AP2/ERF subfamily contain conserved Alanine (Ala) at position-14 and Aspartic acid (Asp) at position-19, whereas the CBF/DREB subfamily genes have Valine (Val) at position-14 and Glutamine acid (Glu) at position-19 (Fig. 1).14 Instead, few gene domains are without Glu-19 and exhibit significant similarity with the rest of the domain although genes in the RAV family with a B3 domain have Gly-14 instead of (Val/Ala-14) (Fig. 2A).

Figure 2.

Figure 2

Alignment of the AP2/ERF domains from Rice (O. sativa) cv. japonica ERF proteins. (A and B) displayed the alignment of single AP2/ERF and double AP2/ERF double domain proteins respectively.

Notes: The arrows represent the predicted helix and sheets. Asterisks exhibited the conserved amino acid residues among the AP2/ERF domain proteins.

Figure 1.

Figure 1

The conserved amino acid residues found in ERF (A) and CBF/DREB (B).

The multiple alignments of the amino acid sequences of AP2/ERF double domain proteins were determined. The amino acid residues were as follows: Gly-4, Val-5, Gly-12, Glu-15, His-17, Asp-20, Gly-38, Ala-46, Ala-47, Arg-48, Ala-49, Asp-51, Ala-53, Ala-54, Lys-56, Gly-59, Asn-67, and Phe-68. These were found to be conserved in the first domain of AP2/ERF double domain proteins. It is of note that at position-6, Thr-6 is conserved in the double domain AP2 genes compared to the Arg-6 conserved in single domain ERF proteins. Moreover, the His-amino acid is found in both the domains of double domain AP2/ERF proteins that are missing in the single domain AP2/ERF proteins. In the second domain of AP2/ERF double domain proteins, the alignment indicated that the amino acid residues Tyr-2, Arg-3, Gly-4, Val-5, Gly-12, Arg-13, Trp-14, Ala-16, Arg-17, Gly-19, Ala-44, Tyr-45, Asp-46, Ala-48, Ala-49, Ile-50, Gly-54, Thr-59, Asn-60, and Phe-61 are highly conserved (Fig. 2B).

Based on these observations, a phylogenetic tree of 170 AP2/ERF genes was constructed using bootstrap analysis (5000 replicates) based on the multiple sequence alignments of their protein domains (Fig. 3). The bootstrap values for the nodes in this phylogenetic tree are not high in every case, similar to the results of the phylogenetic analysis done on Arabidopsis ERF proteins.10 The phylogram is alienated into a total of 11 groups with four main groups, namely group-I to group-IV. The members of the ERF gene family are classified into 10 groups in Arabidopsis.10 Group-I is distinguished into three sub groups: I-a, I-b, and I-c. The proteins categorized in group-I are characterized with a double domain. These proteins play important roles in Arabidopsis, rice, Brassica napus (Rape), and Medicago truncatula for vegetative to embryonic growth, somatic embryogenesis, seed development, lateral roots formation, petal cell identity, floral meristem identity and transition to flowering time.33,36,37,63,64,67–69 The genes in this group are expressed more in the flower, leaves, and stem as opposed to the roots.70

Figure 3.

Figure 3

An unrooted phylogenetic tree of Rice AP2/ERF proteins is constructed using NJ method.

Notes: The line marked distinction between ERF and CRT/DREB protein sub families. Scale bar represents 0.01 amino acid substitution per site.

AP2/ERF genes in Group-II consist of one additional B3 domain and are distinguished as RAV proteins. The function of these proteins in Arabidopsis are as negative regulators of plant growth and development and in the tomato play a pivotal modulator role in defense mediated pathways.39,30 The remaining genes fall in into group-III and group-IV and have a single AP2/ERF domain. The genes in group-III are part of the ERF subfamily that are used in crop plants to defend against biotic resistance, such as pathogens and diseases. The role of these genes have been studied extensively in Arabidopsis, rice, tomato, and tobacco plants with respect to hormone response (jasmonic acid, salicylic acid, absicic acid, and ethylene),10 pathogen/disease’s resistance,4,12,31,71–77 and insect damage (Supplementary Table S2).78 Some family members play crucial roles in transcription inhibition due to the presence of an EAR motif.10,79 It is reported that ERF is over expressed in shoots due to low temperature, but expressed little in cultured cells and roots.3,80,81

Finally, the genes in Group-IV are characterized into CBF, DREB, and TINY proteins, which are used for abiotic factors, such as cold, salt, and drought resistance. These genes are characterized in Arabidopsis, rice, maize, rape seed, sunflower, tomato, and tobacco plants for their response to abiotic factors (Supplementary Table S2).6,25,82–93 The inclusion of these genes in distinct groups based on their protein similarities need to be characterized according to different stress regimes, which may help in correlating function within their phylogenetic placement.

Distribution of conserved motifs

Complete AP2/ERF protein sequences of rice were analyzed for the presence of conserved motifs using the MEME Suite version 4.7.0. Overall, 19 conserved motifs were identified and named 1–19. The consensus sequences of these motifs are provided in Supplementary File 1. Motifs 1, 2, 3, 4, 5, 6, and 9, correspond to the AP2/ERF domain region. The remaining 18 motifs were found to characterize specific clades in the phylogentic tree. The distribution of these conserved motifs in proteins of relevant clades in the phylograms is laid out in Figure 4.

Figure 4A.

Figure 4A

The phylogenetic relationship in the AP2/ERF family genes. Group-Ia, Ib and group-Ic represent the AP2/ERF double domain proteins with their conserved motifs. Group-II exhibited the RAV family genes with one B3 domain. Their conserved motifs determined by the MEME online tools are given the Supplementary File 1.

Conserved motifs outside the AP2/ERF domain

In general, transcription factors comprise functionally important conserved motifs outside the DNA binding domain, which are related to transcriptional activity, nuclear localization, and protein-protein interactions.10 Such functional amino acid sequences motifs are often conserved among members of a subgroup in large families of transcription factors in plants; proteins with these motifs in their subgroups are likely to have similar functions.94

An investigation of the conserved motifs in the proteins of each clade in the AP2/ERF family of rice was accomplished using multiple alignment analysis with ClustalX 2.0.55 The conserved motifs found in the OsAP2/ERF family are summarized in Supplementary Table S1. Most of the motifs are selectively distributed among the specific clades. For instance, in Arabidopsis, the conserved motifs CM-16 and CM-17 found in the C-terminal region of group-II with consensus sequences KGVLLNFED[A/G][A/E/D]GKVW[R/K]FRYSYWNSSQSYV and [AW]AR[ED][HP]LF[DE]K[AT]VTPSDVGKLNRLV[IV]PKQ[HQ]AE[KR]HFP[LF], respectively, function as a transcriptional repressor for plant growth and development (Fig. 5 and Supplementary Table S1).39,49 CM-18, MCGGAI[LI]AD[LF]IP, and CM-19, D[DE] D[FW]EA[AD]F[ER]EF[EDL][DSV][DR][DS][DGH]D[DS][DE]D[ED], are found in the N- terminal region of members of group-III. They have two small blocks of conserved amino acid’s sequences, eg, MCCGAI and DFEA, which play a role in ethylene transcriptional activation (Fig. 6, Supplementary Table S1).95,96 CM-11 in the members of group-IVc and IVd have, at the C- terminal, the consensus sequence [LR]PR[PA]A[ST]A[SA]PKD[VI][QR]AAAA[LA]AAA[AM]ARPPP. The alignment of the members predicted four small blocks of conserved amino acid residues: LPR[P/A], D[I/V]QAA, D[I/V]R[A/L/R] AA, and [L/R]AAA. These are the essential signatures in Arabidopsis for CBL-interacting serine/threonine-protein kinase-12, Ethylene-responsive transcription factor ERF037, dehydration responsive element binding proteins-1C, and proteins-1G and Auxin response factor-19, respectively (Fig. 7, Supplementary Table S1).97–100 The [L/R]AAA motif is a homologue of auxin response factors (ARFs). It binds specifically to the DNA sequence 5′-TGTCTC-3′ and is discovered in the auxin-responsive promoter elements (AuxREs). This motif acts as a transcriptional activator and is involved in ethylene responses and it regulates lateral root formation through direct regulation of LBD16 and/or LBD29.101 The conserved amino acid sequence LPR[P/A] detected in the CBL proteins (serine-threonine protein kinases) binds to the regulatory NAF domain of the CIPK protein and activates the kinase in a calcium-dependent pathway.97 The [H/V/A/D/E/R/Q]LNFP motif is found to be involved in disease resistance.102

Figure 5.

Figure 5

RAV like motif sequences conserved in the C-terminal region of group-II in rice.

Notes: The conserved sequences are under lined calculated by MEME programme. Consensus amino acid sequences are given below the line.

Figure 6.

Figure 6

The conserved motif amino acid sequences in group-III are identified in the N-terminal region.

Note: The consensus sequences are given under the line.

Figure 7.

Figure 7

The conserved motif amino acid sequences in group-IVc and group-IVd respectively are identified in the C-terminal region.

Note: The consensus sequences are given under the line.

Four small preserved amino acid residues were found after alignment in the CM-10 motif with the consensus sequence PEMEKLDFTEAPWDESETFHLRKYPSWEIDWDSILS (Fig. 8, Supplementary Table S1). Among them, a unique small conserved sequence of amino acids, LDF[S/T]E at the C-terminal region, plays a key role in disease resistance.103 The APWDE motif was found to be involved in transcriptional regulation and acts as a histone acetyltransferase, which mediates the acetylation of histone H3 and H4 of target loci. It is also implied in an auxin-independent regulation of shoot, branching, and flowering time. In addition, it is expressed in leaves, buds, flowers, stems, and over-methylated genomic DNA.104 The KYPS motif is involved in the DNA methylation process, which plays an important role in genome management and in regulating gene expression during development.105 A distinctive small motif, EIDWD, was also found to be involved in Arabidopsis response to ethylene.106 It is clear that most of the conserved motifs identified in this study have plausible features in their amino acid compositions as shown in Supplementary Table S1.

Figure 8.

Figure 8

The conserved motif amino acid sequences in group-IVa are identified in the C-terminal region.

Note: The consensus sequences are given under the line.

Characteristics of each group in the rice AP2/ERF gene family

The characteristics of each group of the rice AP2/ERF family are described below. For reference, current information regarding the functions of the genes in the AP2/ERF family is summarized in Supplementary Table S2.

Group-I

Group-I is divided into three subgroups: Ia, Ib, and Ic (Fig. 4, Group-Ia, Ib and Ic). All genes in this group have double AP2/ERF domains except OsAP2/EREBP-049, OsAP2/EREBP-018, OsAP2/EREBP-037, and OsAP2/EREBP-092. These genes fall in group-I due to their domain similarities. At this time, the functions of the OsAP2/EREBP-079-2b, OsAP2/ EREBP-092-2b, and OsAP2/EREBP-099-2b genes are unknown. All genes have the conserved motifs CM-7 and CM-14 that separates the two domains. The loci with these two conserved motifs are provided in Supplementary File 2 and are reported as ANT, BBM, and AP2 like (AIL) proteins of Arabidopsis.10,37,67 Genes grouped in group-Ia, Ib, and group-Ic are involved in seed (embryonic growth, seed development, seed germination) and flower traits (petal cell identity, flowering time, and floral meristem identity).33,63,64,67,69,

Group-II

Group-II proteins share three conserved motifs: CM-7, CM-16 and CM-17 in the C-terminal region (Fig. 4, Group-II), which are contiguous with the AP2/ERF domain. In addition to a single AP2/ERF domain, these genes have one B3 domain. The RAV family proteins act as negative regulators of plant growth and development in Arabidopsis and take part in defence mediated responses in tomatoes against different stresses.39,40,30

Group-IIIa

Group-IIIa consists of 32 genes (Fig. 4, group-IIIa). The AP2/ERF genes with the generic names OsAP2/ EREBP-010, OsAP2/EREBP-011, OsAP2/EREBP-046, OsAP2/EREBP-051, and OsAP2/EREBP-057 interact as a transcriptional activator and are involved in disease resistance pathways in Arabidopsis, rice, tobacco, and tomato plants.4,31,71,72 Their domains bind to the GCC-box pathogenesis-related promoter element. They are involved in the regulation of gene expression induced by stress factors mediated by ethylene that seem dependent on a protein kinase cascade. The genes, coded as OsAP2/EREBP-009 and OsAP2/EREBP-012, are transcriptional inhibitors and may regulate the expression of other genes in a co-expression manner. The N-terminal regions of the genes OsAP2/EREBP-009, OsAP2/EREBP-122, OsAP2/EREBP-134, and OsAP2/EREBP-166 consist of the conserved motif CM-19. Furthermore, defence-related phytohormones, such as ethylene, jasmonate, and salicylic acid differentially induce the expression of this group of genes.10

Group-IIIb

This subgroup of AP2/ERF genes is also related to biotic stresses, such as disease and pathogen resistance and responds to jasmonite and ethylene signal transduction pathways. Out of the 32 genes, the function of nine of these genes has not been studied. This group shares two motifs, CM-18 and CM-19, in the N-terminal region (Fig. 4, group-IIIb). The functional characterization of the two small conserved proteins blocks, MCGGAI and DFEA, are studied by comparing with the Arabidopsis ERF genes.95,96 The OsAP2/ EREBP-074 and OsAP2/EREBP-084 (EREBP1) genes in wheat and cotton repress GCC box-mediated transcription by improving pathogen and abiotic stress tolerance in transgenic plants.73,74 Recently, genes OsAP2/EREBP-020, OsAP2/EREBP-027, and OsAP2/EREBP-124 (ERF3), are up regulated by the feeding of the rice striped stem borer on rice.78 In addition, OsAP2/EREBP-003, OsAP2/EREBP-006, OsAP2/EREBP-024, OsAP2/EREBP-078, OsAP2/ EREBP-093, and OsAP2/EREBP-163 display important roles in cultured cells and roots.80,81

Group-IIIc

Group-IIIc consists of 16 genes (Fig. 4. group-IIIc). The function of three genes, OsAP2/EREBP-015, OsAP2/EREBP-036, and OsAP2/EREBP-108 has not previously been studied. Except for the gene OsAP2/ EREBP-063 (TINY), which plays an important part in abiotic stresses, the other genes have a crucial function in biotic stresses (insect resistance, responsive to stress hormones like jasmonic acid, salicylic acid, abscisic acid, and ethylene).10

Group-IVa

Except for the genes OsAP2/EREBP-019, OsAP2/ EREBP-053, OsAP2/EREBP-103, OsAP2/EREBP-047, and OsAP2/EREBP-119, genes in this group contain the CM-10 motif in the C-terminal region of the AP2/ERF domain (Fig. 4 group-IVa). Close inspection of this conserved motif divides it into four blocks with the following protein sequences: APWDE, LDF[S/T]E, EIDWD, and KYPS. In Arabidopsis, these four conserved protein blocks play key roles in disease resistance, auxin responsiveness, and regulation of genes during expression and transcription activation (Supplementary Table S1).103–106 The overexpression of the genes OsAP2/EREBP-132 and OsAP2/EREBP-113 in Arabidopsis are characterized for high salt resistance.6

Group-IVb

This small group consists of only six genes. Among them, the gene OsAP2/EREBP-167 is involved in water deficit tolerance in rice and sunflowers.25,82 Moreover, the OsAP2/EREBP-095 gene is a disease resistance gene in Arabidopsis.31 The gene OsAP2/EREBP-025 requires characterization (Fig. 4 group-IVb).

Group-IVc

The roles of the genes in subgroup-IVc have been extensively studied. These genes play essential functions in response to high salinity and cold-stress.6 Although the functions of the OsAP2/EREBP-031, OsAP2/EREBP-055, OsAP2/EREBP-070, OsAP2/ EREBP-083, OsAP2/EREBP-91, OsAP2/EREBP-94, OsAP2/EREBP-101, and OsAP2/EREBP-139 genes are unknown, these genes may play a role as transcriptional activators in gene expression in response to abiotic stresses due to their placement in the phylogram (Fig. 4 group-IVc). In Arabidopsis and corn, TINY (OsAP2/EREBP-142 and OsAP2/EREBP-135) is a homolog of the group-IVc and responds to cold stress.92,93

Group-IVd

The proteins in group-IVd possess the CM-11 motif that is homologous to proteins of group-IVc. Possession of these motifs and their phylogenetic relationships indicate a strong similarity between groups-IVd and IVc (Fig. 4 group-IVd). The function of genes with the generic names, OsAP2/EREBP-002, OsAP2/ EREBP-042, OsAP2/EREBP-056, OsAP2/EREBP-105, OsAP2/EREBP-136, and OsAP2/EREBP-157, need to be investigated. The CM-11 motif has a conserved [H/V/A/D/E/R/Q]LNFP amino acid residue sequence whose function is studied in rice and other homologous plant species.102 Another conserved protein sequence, LPR[P/A] in motif CM-11, also plays an important role in serine-threonine protein kinase mechanisms to activate the kinase in a calcium-dependent manner.97 The functional characterization of these genes for low temperature, salt, dehydration, drought resistance, and osmotic tolerance has been investigated in tomato, rice, Arabidopsis, and corn plants.

Gene length with respect to intron/exon size

Usually, the intron/exon position in the CDS furnishes clues on evolutionary relationships of genomes.10 To explore the rice genome to find more AP2/ERF family genes, the full cDNA information is computed using the coverage of 2000 bp region on both sides of the hit to avoid any possible gene losses. It was found that gene length ranged from 781.1 to 1679.7 bp with an average gene length of 1230.4 ± 449.3 bp. These findings indicate that the average gene length is within the 2000 bp limit used in our survey to find these genes. Therefore, it is evident that every exon covered the ESTs and this makes it possible to map the rice genome and this 2000 bp limit ensures that there is no loss of genes (Fig. 9A). For furthering probing, we analyzed the size distribution of exons in our cDNA region by comparing the CDS with genomic sequences in each gene. It was found that the length of exons ranges between 138.4 to 274.79 bp with the average size of exons being 205.3 bp with a standard deviation of 68.96, which is also within the limit and indicates that all the genes are in the expanding range of 2000 bp on both side of the hit (Fig. 9B, Supplementary Table S3).

Figure 9.

Figure 9

Distribution of AP2/ERF family genes with full cDNA information. (A) Distribution of gene length in 2000 bp mapping hits. (B) Exon size distribution in gene length.

Expression profile analysis of the AP2/ERF gene family

Rice, being a staple food crop, suffers yield losses as a result of environmental cues and pathogens during plant development. It is evident that AP2/ERF family genes play important roles in plant development in response to biotic and abiotic stresses and thus, they present as ideal candidates to investigate the molecular regulation of these processes. To determine the expression pattern of putative AP2/ERF family genes, the RiceXPro database was probed for 12 different kinds of rice tissues. The expression of these genes was detected in the root, stem, leaf, sheath, inflorescence, ovary, anther, embryo, pistil, lemma, palea, and endosperm. Most of the AP2/ERF genes indicate some degree of tissue specificity.107 Among the vegetative organs, the expression of these genes was found most abundant in the root (14%), followed by the leaf (8%) and stem (6%). With regards to reproductive organs, they were most common in the embryo (12%) and lemma (11%) (Fig. 10). The expression analysis of each gene in different tissues is determined by signal intensity values derived from the RiceXPro database. Most of the genes have a similar degree of tissue specificity except for OsAP2/ ERF#001, OsAP2/ERF#128, and OsAP2/ERF#048, which exhibit more expression in 12, 10, and 9 rice tissues, respectively (Fig. 11). It should be noted that the genes with higher expression levels belong to the subgroups IIIc, IVc, IVb, and Ib. The genes in group-IIIb and group-IVd have the same level of gene expression. It is apparent that the members of the subgroup Ia and group-II have the lowest gene expression in the rice tissues used in this canvas (Fig. 11).

Figure 10.

Figure 10

Distribution of rice AP2/ERF family genes in vegetative (root, stem, leaf and sheath) and reproductive tissues (inflorescence, ovary, anther, embryo, pistil, lemma, palea and endosperm).

Note: The expression profile is determined by using the RiceXPro database.

Figure 11.

Figure 11

Gene’s classification according to their expression level in each tissue.

Furthermore, the function of genes in each group divulges that the members of group-IIIb were highly present in the root. Gene expression during inflorescence, pistil, and anther development was high in members of group-IIIa. During embryogenesis, expression was high in group-Ia and group-IIIb genes. During the heading stage in rice, these AP2/ERF genes were expressed in the lemma and palea in members of group-IVd. Moderate gene expression in the leaf was observed in group-IIIa, whereas the lowest expression of AP2/ERF genes in the stem, sheath, and endosperm was observed in all groups (Fig. 12).

Figure 12.

Figure 12

Tissue specific expression of the AP2/ERF family genes in each group.

Recently, transcriptome analysis of rice in mature root tissue by massive parallel sequencing unveiled previously unrecognized tissue-specific expression profiles and render an interesting platform to study the differential regulation of transcribed regions of root tissues.108 Moreover, this technique foregoes canvas spotlighting in which OsDREB1B (a DREB subfamily gene) was expressed significantly in roots compared to the leaves, shoots, growing points, mature seeds, and other tissues of unstressed rice plants.109 The subfamily gene, OsAP211, is extremely prominent in shoot tips in mature rice and immature seeds at the booting stage compared to other rice tissues.110 The ERF subfamily gene, OsAP25, is detected in the leaves, shoots, roots, growing points, flower, immature seeds, and mature seeds of rice.111 In wheat, 9 types of tissues are used for expression profile analysis and the transcripts of these genes are most abundant in leaves followed by roots, seeds, and stem.107

Chromosome position of the identified rice AP2/ERF genes

To examine the genomic distribution of AP2/EREBP genes on rice chromosomes (chr), we identified their positions using a Rice TOGO Browser database search.112 A total of 170 rice AP2/EREBP genes were localized on the 12 chromosomes with an uneven distribution. A similar situation also occurred with respect to the OsERF and AtERF family genes, thereby indicating that ERF genes are distributed widely among monocot and eudicot genomes.10 The OsAP2/EREBP genes are present in all regions on a single chromosome (eg, at the telomeric ends, near the centromere, and in between) and are distributed individually or in clusters (Fig. 13). Chr2 has the maximum number (26) of OsAP2/EREBP genes, and chr4 and chr6 have 22 and 20 genes, respectively. The high number of AP2/ERF sequences in these chromosomes is due to the repetition of adjacent genes. Interestingly, the same tendency was found for the chromosomal location of group-II (RAV binding domain) genes. Only four OsAP2/EREBP genes were identified on chr11, all of which are found on the short arm. Two OsAP2/ EREBP genes (Os07g0410300 and Os07g0410700) arranged as tandem duplications were found around the centromere on chr7. Less than 10 chromosome locations are found on each of chr10, chr11, and chr12.

Figure 13.

Figure 13

The physical location of the AP2/ERF genes on rice chromosomes.

Notes: The chromosome number is indicated at the top of each chromosome. The genes are indicated on the locus by their generic names and function.

Comparative mapping between rice, wheat, and Arabidopsis genomes

To explore orthologs/homologs, wheat and Arabidopsis sequences were used to BLAST against the rice genome using BLASTx and BLASTn, respectively. The aligned sequences with more than 60% similarity to rice genes elsewhere in rice genome produced high-scoring pairs (HSPs). These HSPs were selected based on similarity percentage criteria (Supplementary Tables S4 and 5), which facilitate the differentiation of orthologous regions in the genome with high sureness and, subsequently, describes shared duplications between these genomes. These syntenic surveys facilitate finding different orthologous/homologous gene annotations in the comparative study of rice, wheat, and Arabidopsis genomes.113–117

In wheat (Triticum aestivum L.), AP2/ERF family genes were compared to rice orthologous loci in the rice genome on chr1 to chr9, and not chr10, chr11, or chr12.118 The microcollinearity allowed a higher resolution of distribution in chr9, followed by chr3, chr2, and chr6, while the minimum predicted orthology was found in chr7. Comparison with rice chromosomes predicts 25% gene orthologs in chr9 followed by 13% on chr2 (Supplementary Table S4). CRT/DRE subfamily genes from wheat found syntenic loci on rice on chr1, chr2, chr4, chr6, chr8, and chr9. The majority of these genes were conserved on chr9 followed by chr1 and chr8. In addition, ERF subfamily gene orthlogous loci were found on chr1, chr2, chr3, chr6, and chr9 respective to their similarity, and maximum syntenic regions were mapped on chr2. Regarding the AP2 family with double domains, these genes were distributed on chr3, chr7, and chr8, and the maximum conserved loci were preserved on chr3 (Fig. 14). The comparative distribution of wheat genes to the rice genome clearly designates that rice chromosomes have passed through different phylogenies.118

Figure 14.

Figure 14

Comparative mapping of wheat AP2/ERF genes on rice chromosomes.

Comparative mapping between rice and Arabidopsis displayed 11 orthologous/homologous loci, unveiling the broad extent of collinearity between these genomes.119,120 The homologs in rice genome were found on chr1, chr2, chr4, chr5, chr6, chr9, and chr11; whereas, in Arabidopsis, this collinearity was found preserved on chr1, chr2, chr3, and chr5. The chromosomal distribution of the AP2/ERF family genes revealed that chr1 in Arabidopsis has more homologs (45%) followed by chr5 (27%). These findings are consistent with the evolution and divergence of the ERF family genes in Arabidopsis.10 In rice, the conserved homology is found in chr2 (36%) followed by chr4 (27%) (Supplementary Table S5). The ERF subfamily genes of Arabidopsis on chr1, chr3, and chr5 have syntenic loci in rice on chr2, chr4, chr6, and chr9. The genes related to abiotic stresses, such as DRE and TINY on Arabidopsis chr2 and chr5 have their orthologs on rice chr2 and chr4, respectively. The subfamily genes with B3 domains in Arabidopsis found on chr1 have orthologs on rice chr1 and chr5, whereas the subfamily gene with AP2 double domains in Arabidopsis on chr3 is syntenic to rice chr11 (Fig. 15). It is reported that 98% of homologs of known maize, wheat, and barley proteins are found in rice. Synteny and gene homology between monocot (rice and the other cereal) genomes are extensive, whereas synteny with dicots (Arabidopsis) is limited.121 Moreover, scant collinearity in gene order is also observed between rice and Arabidopsis genomes using comparative genomics.122

Figure 15.

Figure 15

Comparative mapping of rice and Arabidopsis AP2/ERF family.

Conclusions

Transcription factor proteins primarily regulate a web of biological processes and have egressed as a powerful tool for the manipulation of composite metabolic pathways. In this study, 170 AP2/ERF genes are identified from different rice databases available in the public domain. The results reveal much about the diversification of AP2/ERF family genes in the rice genome. Gene translocation and segmental duplication might have imparted towards the expansion of the AP2/ERF gene family. During the enlargement of the AP2/ERF gene family, many groups and subgroups evolved, resulting in a high level of functional divergence. The conserved motifs present in their respective clades suggest the specificity of the genes for function in this group. Comparative mapping revealed that the homologs/orthologs are present in rice, wheat, and Arabidopsis indicating that many of the genes in these species antedated the divergence of monocots and eudicots. The expression analysis of AP2/ERF family genes furnishes a new avenue for functional analyses in rice. During the domestication of rice, selection pressure may lead to selecting the genotypes that have specific conserved motifs and have related molecular functions against natural confronts. Modern bioinformatics and biotechnology tools may predict and characterized these genes in their respective clades. As a model plant, and having a great synteny with the grass family with respect to gene structure, the information generated about the AP2/ERF gene family in rice will also provide a platform for predicting the function of genes of crops whose genome sequences are in their infancy.

Supplementary Data

Table S1.

The functional description of conserved motifs found on both sides of the AP2/ERF domain.

Motif Species Protein name Reference
[A/W]R[D/E][H/P]LF[D/E]K[T/A]
VTPSDVGKLNRLV[I/V]PKQ[H/Q]
AEKHFP[L/F]
KGVLLNFED[A/G][A/E/D]
GKVW[R/K]FRYSYWNSSQSYV
Arabidopsis AP2/ERF and B3 domain-containing protein
Function as negative regulator of plant growth and development
39
MCGGAI Arabidopsis Ethylene-responsive transcription factor RAP2-3, RAP2-2, RAP2-12 95
DFEA Rice Ethylene-responsive transcription factor 1 96
LPR[P/A] Arabidopsis CBL-interacting serine/threonine-protein kinase-12 97
D[I/V]QAA Arabidopsis Ethylene-responsive transcription factor ERF037 98
D[I/V]R[A/L/R]AA Arabidopsis Dehydration responsive element binding proteins-1C and proteins-G in rice 99
[L/R]AAA Arabidopsis Auxin response factor-19 100
[H/V/A/D/E/R/Q]LNFP Rice Germin-like protein 8–4 102
LDF[S/T]E Arabidopsis Putative disease resistance protein At4g19050 103
APWDE Arabidopsis Methyl-CpG-binding domain-containing protein 9 104
KYPS Arabidopsis Probable methyltransferase PMT18 105
EIDWD Arabidopsis Ethylene-responsive transcription factor ERF060, 057, 056, RAP2-13 106

Table S2.

AP2/ERF family genes whose biological functions are reported.

Group Gene Function Plant References
I BBM
BBM1
Vegetative to embryonic growth, somatic embryogenesis, mostly expressed in developing seeds, crown, and lateral roots formation Arabidopsis, Brassica napus (Rape), Medicago truncatula 36,37,63
I WRL1 Required for embryo development, seed germination Arabidopsis 64
I ANT Petal cell identity and mediates down-regulation of AG in flower whorl Arabidopsis 67
I ERF Adaptive responses to flooding stress in rice Rice 32
I RAP2.7 Regulates negatively the transition to flowering time Arabidopsis 33
I FHP Floral meristem identity in synergy with LEAFY Arabidopsis 69
I RAP2.1 Expressed in flowers, leaves, and stems, and at very low levels in roots Arabidopsis 70
II RAV Negative regulator of plant growth and development Arabidopsis 30,39
II RAV Defense mediated pathway in tomato Tomato 30
III RAP2.6 Responsive to stress hormones like jasmonic acid, salicylic acid, abscisic acid and ethylene Arabidopsis 10
III ERF1 Disease resistance Arabidopsis, rice, tobacco, 4,31,71
III ERF2 Disease resistance Tobacco 71
III TSRF1 Disease resistance Tomato 72
III ERF3 Up-regulated by feeding of the rice striped stem borer Rice 78
III EREBP5 Regulation of gene expression by stress factors and components of stress signal transduction pathways Arabidopsis, Tobacco 75,76
III EREBP1 Improved pathogen and abiotic stress tolerance in transgenic plants Wheat, cotton 73,74
III EREBP6 Transcription activator. Regulation of gene expression by stress factors Arabidopsis 12
III EREBP4 Involved in the regulation of gene expression by stress factors like jasmonate (JA), cold, drought and salt Arabidopsis, Tobacco 75,77
III EREBP
9,11,12
Transcriptional inhibitor having EAR motif Arabidopsis 79
III EREBP3 Transcriptional repressor, Little expressed in roots and cultured cells Tobacco, rice 80,81
III RAP2.11 Strongly induced by low temperatures in shoot tips Rice 3
IV CBF like Cold tolerance Brassica napus (Rape) 83
IV CBF3 Up regulated in response to low temperature Tomato 84
IV DREB1E Transcriptional activator, play a key role in freezing tolerance and cold acclimation Arabidopsis, rice 6,88
IV DREB1F Transcriptional activator, play a key role in freezing tolerance and cold acclimation Arabidopsis 6,89
IV TINY Transcriptional activator, induced by cold stress Maize 93
IV DREB2F Dehydration and cold Arabidopsis 6
IV DREB1A Transcriptional activator, confers resistance to high cold and drought stress Arabidopsis, Rice, Maize 85–87
IV DREB1F Enhance tolerance to salt, drought and low temperature Rice, Arabidopsis 6,90
IV DREB2 Tolerance to water deficit stress Rice, sun flower 25,82
IV DREB1C Transcriptional activator, mediates high salinity- and dehydration-inducible transcription Arabidopsis, rice 6,88
IV DREB1I Mediates high salinity- and dehydration-inducible transcription Rice 89
IV DREB2A Tolerance to osmotic, salt and dehydration stresses Rice, Arabidopsis 6,91
IV DREB2B Involved in drought and heat-shock stress tolerance Arabidopsis, rice 6,92
IV DREB2C Transcriptional activator, mediates high salinity- and abscisic acid-inducible transcription Arabidopsis, rice 6,92

Abbreviations: ANT, Antigumenta; FHP, Floral homeotic protein; BBM, Baby Boom; WRL1, Wrinkled1; TSRF1, Tomato stress responsive factor1.

Table S3.

Full length cDNA ascertained with respect to intron, exon size distribution.

Generic name MSU (LOC_OS ID) Average gene length Average exon length No. of introns
OsAP2/ERF#022 LOC_Os02g51300.1 1284.0 160.5 7
OsAP2/ERF#153 LOC_Os09g25600.1 792.0 198.0 3
OsAP2/ERF#068 LOC_Os08g07440.1 828.0 118.3 6
OsAP2/ERF#052 LOC_Os05g45954.1 1350.0 270.0 4
OsAP2/ERF#099 LOC_Os06g05340.1 1200.0 200.0 5
OsAP2/ERF#109 LOC_Os08g34360.1 867.0 216.8 3
OsAP2/ERF#079 LOC_Os01g59780.1 825.0 275.0 2
OsAP2/ERF#155 LOC_Os12g03290.1 1332.0 222.0 5
OsAP2/ERF#131 LOC_Os11g03540.1 1350.0 225.0 5
OsAP2/ERF#049 LOC_Os05g32270.1 913.0 152.2 5
OsAP2/ERF#044 LOC_Os04g55970.1 828.0 207.0 3
OsAP2/ERF#086 LOC_Os03g19900.1 1473.0 163.7 8
OsAP2/ERF#088 LOC_Os03g56050.1 2086.0 260.8 7
OsAP2/ERF#141 LOC_Os07g03250.1 945.0 189.0 4
OsAP2/ERF#137 LOC_Os03g12950.1 973.0 324.3 2
OsAP2/ERF#026 LOC_Os03g07940.1 1242.0 177.4 6
OsAP2/ERF#118 LOC_Os11g19060.1 1680.0 210.0 7
OsAP2/ERF#005 LOC_Os01g67410.1 2088.0 261.0 7
OsAP2/ERF#060 LOC_Os06g44750.1 792.0 99.0 7
OsAP2/ERF#018 LOC_Os02g40070.1 2103.0 262.9 7
OsAP2/ERF#037 LOC_Os04g42570.1 1977.0 247.1 7
OsAP2/ERF#092 LOC_Os05g28800.1 543.0 181.0 2
OsAP2/ERF#059 LOC_Os06g43220.1 1005.0 111.7 8
OsAP2/ERF#073 LOC_Os07g13170.1 1311.0 131.1 9
OsAP2/ERF#033 LOC_Os03g60430.1 1293.0 129.3 9
OsAP2/ERF#043 LOC_Os04g55560.1 1383.0 138.3 9
OsAP2/ERF#090 LOC_Os05g03040.2 1539.0 192.4 7
OsAP2/ERF#085 LOC_Os03g06920.1 1260.0 420.0 2
OsAP2/ERF#045 LOC_Os04g56150.1 420.0 210.0 1
Over all length 1230.4 205.3
SD 449.3 68.985
Minimum length 781.1 138.4
Maximum length 1679.7 274.79
Base pair used for search of exons on both side of the hit 2000

Table S4.

Synteny between rice and wheat AP2/ERF family genes.

Coded wheat genes Rice genome alignment Rice genes (output homology) Annotation


Chr_Start Chr_End Similarity Chr Rice gene Generic name
95,107 33765994 33766955 0.606 1 LOC_Os01g58420.1 OsAP2/ERF-4 ERF-3
13,16 1745445 1752065 0.616 1 LOC_Os01g04020.1 OsAP2/ERF-1 RAP2.6
40 11783003 11783631 0.746 1 LOC_Os01g21120.1 OsAP2/ERF-3 EREB3
4,19,90,113 3355682 3357394 0.691 1 LOC_Os01g07120.2 OsAP2/ERF-167 DREB2
10,47,81,100 5688636 5689867 0.728 2 LOC_Os02g10760.1 OsAP2/ERF-12 ERF
12,21,60,103 17569037 17575069 0.768 2 LOC_Os02g29550.2 OsAP2/ERF-13 CHP
24,54 31643379 31644457 0.775 2 LOC_Os02g51670.1 OsAP2/ERF-132 DREB2B
52,72,86,111 33194322 33195272 0.814 2 LOC_Os02g54160.1 OsAP2/ERF-84 EREB1
95 3164706 3165049 0.802 2 LOC_Os02g06330.1 OsAP2/ERF-10 ERF2
1,11,17 34351602 34357234 0.717 3 LOC_Os03g60430.2 OsAP2/ERF-33 FHP
3,11,14 6993827 6995351 0.811 3 LOC_Os03g12950.1 OsAP2/ERF-137 BBM
28,39,62,84,91,110 4347196 4349534 0.633 3 LOC_Os03g08470.1 OsAP2/ERF-125 RAP2.6
29,42,76,101 4366392 4367330 0.636 3 LOC_Os03g08490.1 OsAP2/ERF-28 EREBP
4,90,114 21076935 21077459 0.794 4 LOC_Os04g34970.1 OsAP2/ERF-36 ERF
9 27332155 27332997 0.71 4 LOC_Os04g46400.1 OsAP2/ERF-40 DREB1F
9 27354771 27355159 0.792 4 LOC_Os04g46440.1 OsAP2/ERF-42 ERF
16,51,78,85,105 32845591 32846458 0.651 4 LOC_Os04g55520.1 OsAP2/ERF-128 DREB2F
63 19480884 19483547 0.75 4 LOC_Os04g32620.1 OsAP2/ERF-89 ERF
71 10307892 10308114 0.814 4 LOC_Os04g18650.1 OsAP2/ERF-34 TSRF1
55 24381783 24382150 0.698 5 LOC_Os05g41780.1 OsAP2/ERF-51 ERF-2
31,45,61,94 17187004 17187406 0.746 5 LOC_Os05g29810.1 OsAP2/ERF-93 ERFEB2
5,27,34,37 1433939 1434443 0.737 6 LOC_Os06g03670.1 OsAP2/ERF-98 CBF
10,47,81,100 23897673 23900241 0.77 6 LOC_Os06g40150.1 OsAP2/ERF-57 ERF1
19,52,111 4730450 4736020 0.721 6 LOC_Os06g09390.1 OsAP2/ERF-124 ERF3
68,106 6304249 6304712 0.825 6 LOC_Os06g11860.1 OsAP2/ERF-105 CHP
69 3336324 3336716 0.833 6 LOC_Os06g07030.1 OsAP2/ERF-142 RAP2.6
1,11,17 7544758 7548437 0.679 7 LOC_Os07g13170.1 OsAP2/ERF-73 AP2-like
6,7,8 4175116 4177421 0.811 8 LOC_Os08g07440.1 OsAP2/ERF-68 AP2D
56 27322278 27322451 0.782 8 LOC_Os08g43210.1 OsAP2/ERF-161 CRT/DREBF10
67,82,89,99 23351479 23352053 0.729 8 LOC_Os08g36920.1 OsAP2/ERF-152 CHP
109 19545283 19545935 0.739 8 LOC_Os08g31580.1 OsAP2/ERF-170 DREB
22,23,34,58 15960437 15961590 0.701 9 LOC_Os09g26420.1 OsAP2/ERF-64 ERF2
18,25,26,30,43,48,49,59,65,97,106 20394824 20395662 0.693 9 LOC_Os09g35010.1 OsAP2/ERF-169 CRT/DRE-
33,54,77,109 12212469 12217153 0.686 9 LOC_Os09g20350.1 OsAP2/ERF-113 DREBF1
56,57,73,83,93,102,112 20398977 20399625 0.659 9 LOC_Os09g35020.1 OsAP2/ERF-65 CBF3
67,82,89,99 17305377 17308135 0.713 9 LOC_Os09g28440.1 OsAP2/ERF-123 CHP

Table S5.

Synteny between rice and Arabidopsis AP2/ERF family genes.

Arabidopsis genes Generic name Chr Rice genome alignment Rice genes (output homology) Annotation


Chr_Start Chr_End Similarity Chr Rice gene Generic name
AT1G15360.1 AtAP2/EREBP#001 1 24775898 24776037 0.80 6 LOC_Os06g40150.1 OsAP2/EREBP#057 ERF3
AT1G15360.1 AtAP2/EREBP#002 1 5688851 5691552 0.68 2 LOC_Os02g10760.1 OsAP2/EREBP#012 ERF1
AT2G35700.1 AtAP2/EREBP#003 2 27381026 27381177 0.71 2 LOC_Os02g43940.1 OsAP2/EREBP#021 DREB2B
AT5G11590.1 AtAP2/EREBP#004 5 22622513 22622610 0.76 4 LOC_Os04g36640.1 OsAP2/EREBP#087 TINY
AT5G67190.1 AtAP2/EREBP#005 5 33530573 33530696 0.81 4 LOC_Os04g55520.1 OsAP2/EREBP#128 DREB2F
AT3G14230.1 AtAP2/EREBP#006 3 34056887 34056986 0.87 2 LOC_Os02g54160.1 OsAP2/EREBP#084 EREBP1
AT5G44210.1 AtAP2/EREBP#007 5 20013422 20013492 0.78 4 LOC_Os04g32790.1 OsAP2/EREBP#035 EREBP12
AT1G46768.1 AtAP2/EREBP#008 1 27380978 27381083 0.66 2 LOC_Os02g43940.1 OsAP2/EREBP#021 RAP2.1
AT3G54320.3 AtAP2/EREBP#009 3 1369944 1366400 0.724 11 LOC_Os11g03540.1 OsAP2/EREBP#131 WRL1
AT1G25560.1 AtAP2/EREBP#010 1 27240408 27244907 0.63 5 LOC_Os05g47650.1 OsAP2/EREBP#096 RAV
AT1G79700.2 AtAP2/EREBP#011 1 15361747 15367611 0.747 9 LOC_Os09g25600.1 OsAP2/EREBP#153 AP2.1
AT1G68840.1 AtAP2/EREBP#012 1 28619028 28619859 0.654 1 LOC_Os01g49830.1 OsAP2/EREBP#127 RAV
Supplementary File 1

Conserved motifs discovered using the MEME Suite version 4.7.0.

ebo-8-2012-321s1a.tif (1.1MB, tif)
ebo-8-2012-321s1b.tif (1.3MB, tif)
ebo-8-2012-321s1c.tif (1.3MB, tif)

Supplementary File 2.

AP2/ERF family genes in rice.

This study Nakano et al10

Group Generic name MSU (LOC_OS ID) RAP (Os ID) Gene name
Ia AP2/EREBP#022 LOC_Os02g51300.12b Os02g0747600 BBM1
Ia AP2/EREBP#153 LOC_Os09g25600.12b Os09g0423800 AP2-1
Ia AP2/EREBP#068 LOC_Os08g07440.12b Os08g0171100 WRINKLED1
Ia AP2/EREBP#155 LOC_Os12g03290.12b Os12g0126300 AP2-1
Ia AP2/EREBP#131 LOC_Os11g03540.12b Os11g0129700 AP2-1
Ia AP2/EREBP#079 LOC_Os01g59780.12b Os01g0813300
Ia AP2/EREBP#049 LOC_Os05g32270.1 Os05g0389000 AP2-1
Ia AP2/EREBP#109 LOC_Os08g34360.12b Os08g0442400 BBM
Ia AP2/EREBP#052 LOC_Os05g45954.12b Os05g0536250 AP2D4
Ia AP2/EREBP#099 LOC_Os06g05340.12b Os06g0145700
Ib AP2/EREBP#044 LOC_Os04g55970.12b Os04g0653600 ANT
Ib AP2/EREBP#086 LOC_Os03g19900.12b Os03g0313100 ANT
Ib AP2/EREBP#088 LOC_Os03g56050.12b Os03g0770700 ANT
Ib AP2/EREBP#137 LOC_Os03g12950.12b Os03g0232200 BBM
Ib AP2/EREBP#141 LOC_Os07g03250.12b Os07g0124700 PLETHORA
Ib AP2/EREBP#026 LOC_Os03g07940.12b Os03g0176300 WRINKLED1
Ib AP2/EREBP#118 LOC_Os11g19060.12b Os11g0295900 BBM1
Ib AP2/EREBP#005 LOC_Os01g67410.12b Os01g0899800 ERF
Ib AP2/EREBP#060 LOC_Os06g44750.12b Os06g0657500 ANT
Ib AP2/EREBP#018 LOC_Os02g40070.1 Os02g0614300 ANT
Ib AP2/EREBP#037 LOC_Os04g42570.1 Os04g0504500 ERF
Ic AP2/EREBP#092 LOC_Os05g28800.1 Os05g0356201
Ic AP2/EREBP#043 LOC_Os04g55560.12b Os04g0649100 ERF
Ic AP2/EREBP#059 LOC_Os06g43220.12b Os06g0639200 ERF
Ic AP2/EREBP#090 LOC_Os05g03040.22b Os05g0121600 RAP2.7
Ic AP2/EREBP#033 LOC_Os03g60430.12b Os03g0818800 FHP
Ic AP2/EREBP#073 LOC_Os07g13170.12b Os07g0235800 ERF
II AP2/EREBP#085 LOC_Os03g06920.1 Os03g0165200
II AP2/EREBP#077 LOC_Os01g04750.1-B3 Os01g0140700 RAV
II AP2/EREBP#129 LOC_Os01g04800.1-B3 Os01g0141000 RAV
II AP2/EREBP#096 LOC_Os05g47650.1-B3 Os05g0549800 RAV
II AP2/EREBP#127 LOC_Os01g49830.1-B3 Os01g0693400 RAV
IIIa AP2/EREBP#045 LOC_Os04g56150.1 Os04g0655700
IIIa AP2/EREBP#089 LOC_Os04g32620.1 Os04g0398000 ERF Os04g32620
IIIa AP2/EREBP#023 LOC_Os02g55380.1 Os02g0797100 Os02g55380
IIIa AP2/EREBP#012 LOC_Os02g10760.1 Os02g0202000 ERF Os02g10760
IIIa AP2/EREBP#057 LOC_Os06g40150.1 Os06g0604000 ERF1 Os06g40150
IIIa AP2/EREBP#159 LOC_Os12g39330.1 Os12g0582900 RAP2.11 Os12g39330
IIIa AP2/EREBP#075 LOC_Os07g38750.1 Os07g0575000 Os07g38750
IIIa AP2/EREBP#072 LOC_Os07g10410.1 Os07g0204000 Os07g10410
IIIa AP2/EREBP#008 LOC_Os12g41030.1 Os12g0602966 Os12g41030
IIIa AP2/EREBP#009 LOC_Os12g41060.1 Os12g0603300 ERF3 Os12g41060
IIIa AP2/EREBP#122 LOC_Os09g11460.1 Os09g0286600 ERF Os09g11460
IIIa AP2/EREBP#166 LOC_Os09g11480.1 Os09g0287000 EREBP5 Os09g11480
IIIa AP2/EREBP#164 LOC_Os05g25260.1 Os05g0316800 EREBP9 Os05g25260
IIIa AP2/EREBP#032 LOC_Os03g60120.1 Os03g0815800 EREBPP5 Os03g60120
IIIa AP2/EREBP#145 LOC_Os07g12510.1 Os07g0227600 ERF Os07g12510
IIIa AP2/EREBP#134 LOC_Os01g12440.1 Os01g0224100 Os01g12440
IIIa AP2/EREBP#162 LOC_Os01g46870.1 Os01g0657400 EREBP5 Os01g46870
IIIa AP2/EREBP#146 LOC_Os06g06540.1 Os06g0160500 Os06g06540
IIIa AP2/EREBP#058 LOC_Os06g42990.1 Os06g0636000 ANT Os06g42990
IIIa AP2/EREBP#014 LOC_Os02g32040.1 Os02g0520000 Os02g32040
IIIa AP2/EREBP#035 LOC_Os04g32790.1 Os04g0399800 EREBP12 Os04g32790
IIIa AP2/EREBP#069 LOC_Os08g07700.1 Os08g0173700 EREBP4 Os08g07700
IIIa AP2/EREBP#133 LOC_Os07g47330.1 Os07g0669500 BSL Os07g47330
IIIa AP2/EREBP#017 LOC_Os02g38090.1 Os02g0594300 ESR1 Os02g38090
IIIa AP2/EREBP#149 LOC_Os04g52090.1 Os04g0610400 RAP2.6 Os04g52090
IIIa AP2/EREBP#051 LOC_Os05g41780.1 Os05g0497300 ERF2 Os05g41780
IIIa AP2/EREBP#004 LOC_Os01g58420.1 Os01g0797600 ERF3 Os01g58420
IIIa AP2/EREBP#165 LOC_Os05g41760.1 Os05g0497200 EREBP11 Os05g41760
IIIa AP2/EREBP#046 LOC_Os04g57340.1 Os04g0669200 ERF2 Os04g57340
IIIa AP2/EREBP#011 LOC_Os02g09650.1 Os02g0189600 ERF2 Os02g09650
IIIa AP2/EREBP#061 LOC_Os06g47590.1 Os06g0691100 ERF Os06g47590
IIIa AP2/EREBP#010 LOC_Os02g06330.1 Os02g0158000 ERF2 Os02g06330
IIIb AP2/EREBP#151 LOC_Os05g37640.1 Os05g0448700 Os05g37640
IIIb AP2/EREBP#062 LOC_Os05g37640.1 Os05g0448675 ERF
IIIb AP2/EREBP#067 LOC_Os09g39850.1 Os09g0572000 ERF Os09g39850
IIIb AP2/EREBP#106 LOC_Os07g22730.1 Os07g0410300 ERF Os07g22730
IIIb AP2/EREBP#074 LOC_Os07g22770.1 Os07g0410700 EREBP1 Os07g22770
IIIb AP2/EREBP#163 LOC_Os03g64260.1 Os03g0860100 EREBP2 Os03g64260
IIIb AP2/EREBP#097 LOC_Os05g49010.1 Os05g0564700 Os05g49010
IIIb AP2/EREBP#168 LOC_Os04g46220.1 Os04g0546800 ERF Os04g46220
IIIb AP2/EREBP#147 LOC_Os02g43790.1 Os02g0654700 EREBP5 Os02g43790
IIIb AP2/EREBP#034 LOC_Os04g18650.1 Os04g0257500 TSRF1 Os04g18650
IIIb AP2/EREBP#024 LOC_Os03g05590.1 Os03g0150200 EREBP5 Os03g05590
IIIb AP2/EREBP#154 LOC_Os10g30840.1 Os10g0445100 Os10g30840
IIIb AP2/EREBP#066 LOC_Os09g39810.1 Os09g0571700 Os09g39810
IIIb AP2/EREBP#071 LOC_Os08g44960.1 Os08g0563600 ERF Os08g44960
IIIb AP2/EREBP#078 LOC_Os01g54890.1 Os01g0752500 EREBP6 Os01g54890
IIIb AP2/EREBP#116 LOC_Os10g41330.1 Os10g0562900 ERF Os10g41330
IIIb AP2/EREBP#020 LOC_Os02g43820.1 Os02g0655200 ERF3 Os02g43820
IIIb AP2/EREBP#038 LOC_Os04g46240.1 Os04g0547500 Os04g46240
IIIb AP2/EREBP#039 LOC_Os04g46250.1 Os04g0547600 ERF Os04g46250
IIIb AP2/EREBP#027 LOC_Os03g08460.1 Os03g0182800 ERF3 Os03g08460
IIIb AP2/EREBP#030 LOC_Os03g22170.1 Os03g0341000 RAP2.2 Os03g22170
IIIb AP2/EREBP#076 LOC_Os07g47790.1 Os07g0674800 EREBP Os07g47790
IIIb AP2/EREBP#003 LOC_Os01g21120.1 Os01g0313300 EREBP3 Os01g21120
IIIb AP2/EREBP#093 LOC_Os05g29810.1 Os05g0361700 EREBP2 Os05g29810
IIIb AP2/EREBP#125 LOC-Os03g08470.1 Os03g0183000 RAP2.6 Os03g08470
IIIb AP2/EREBP#107 LOC_Os07g42510.1 Os07g0617000 ERF2 Os07g42510
IIIb AP2/EREBP#064 LOC_Os09g26420.1 Os09g0434500 ERF2 Os09g26420
IIIb AP2/EREBP#124 LOC_Os06g09390.1 Os06g0194000 ERF3 Os06g09390
IIIb AP2/EREBP#084 LOC_Os02g54160.1 Os02g0782700 EREBP1 Os02g54160
IIIb AP2/EREBP#029 LOC_Os03g08500.1 Os03g0183300 CHP Os03g08500
IIIb AP2/EREBP#028 LOC_Os03g08490.1 Os03g0183200 CHP Os03g08490
IIIb AP2/EREBP#006 LOC_Os10g25170.1 Os10g0390800 EREBP3 Os10g25170
IIIc AP2/EREBP#063 LOC_Os09g13940.1 Os09g0309700 TINY Os09g13940
IIIc AP2/EREBP#108 LOC_Os08g27220.1 Os08g0360800 Os08g27220
IIIc AP2/EREBP#110 LOC_Os08g41030.1 Os08g0521600 ERF Os08g41030
IIIc AP2/EREBP#015 LOC_Os02g32140.1 Os02g0521100 Os02g32140
IIIc AP2/EREBP#001 LOC_Os01g04020.1 Os01g0131600 RAP2.6 Os01g04020
IIIc AP2/EREBP#111 LOC_Os08g42550.1 Os08g0537900 ERF3 Os08g42550
IIIc AP2/EREBP#152 LOC_Os08g36920.1 Os08g0474000 RAP2.6 Os08g36920
IIIc AP2/EREBP#123 LOC_Os09g28440.1 Os09g0457900 EREBPP LIKE Os09g28440
IIIc AP2/EREBP#130 LOC_Os02g52670.1 Os02g0764700 EREBP4 Os02g52670
IIIc AP2/EREBP#036 LOC_Os04g34970.1 Os04g0429050 Os04g34970
IIIc AP2/EREBP#120 LOC_Os02g34260.1 Os02g0546600 ERF Os02g34260
IIIc AP2/EREBP#016 LOC_Os02g34270.1 Os02g0546800 ERF Os02g34270
IIIc AP2/EREBP#117 LOC_Os11g06770.1 Os110168500 RAP2.6 Os11g06770
IIIc AP2/EREBP#158 LOC_Os12g07030.1 Os12g0168100 RAP2.6 Os12g07030
IIIc AP2/EREBP#080 LOC_Os01g64790.1 Os01g0868000 ERF Os01g64790
IIIc AP2/EREBP#050 LOC_Os05g36100.1 Os05g36100 ERF Os05g36100
IV-a AP2/EREBP#053 LOC_Os05g49700.1 Os05g0572000 CHP Os05g49700
IV-a AP2/EREBP#170 LOC_Os08g31580.1 Os08g0408500 ERF Os08g31580
IV-a AP2/EREBP#113 LOC_Os09g20350.1 Os09g0369000 DREBF1 Os09g20350
IV-a AP2/EREBP#019 LOC_Os02g42585.1 Os02g0638650 ERF
IVa AP2/EREBP#047 AP004768.3 AP004768.3
IV-a AP2/EREBP#119 LOC_Os04g44670.1 Os04g0529100 ERF Os04g44670
IV-a AP2/EREBP#156 LOC_Os10g22600.1 Os10g0371100 ERF Os10g22600
IV-a AP2/EREBP#121 LOC_Os03g09170.1 Os03g0191900 ERF Os03g09170
IV-a AP2/EREBP#103 LOC_Os06g09810.1 Os06g0198400 Os06g09810
IV-a AP2/EREBP#132 LOC_Os02g51670.1 Os02g0752800 DREB2B Os02g51670
IV-b AP2/EREBP#150 LOC_Os05g28350.1 Os05g0351200 ERF Os05g28350
IV-b AP2/EREBP#095 LOC_Os05g39590.1 Os05g0473300 ERF1 Os05g39590
IV-b AP2/EREBP#025 LOC_Os03g07830.1 Os03g0174400 CHP Os03g07830
IV-b AP2/EREBP#112 LOC_Os08g45110.1 Os08g0565200 ERF Os08g45110
IV-b AP2/EREBP#167 LOC_Os01g07120.1 Os01g0165000 DREB2 Os01g07120
IV-b AP2/EREBP#048 LOC_Os05g27930.1 Os05g0346200 DRE Os05g27930
IV-c AP2/EREBP#094 LOC_Os05g34730.1 Os05g0420300 Os05g34730
IVc AP2/EREBP#091 LOC_Os01g66270.1 Os01g0885900 Os01g66270
IV-c AP2/EREBP#128 LOC_Os04g55520.1 Os04g0648900 DREB2F Os04g55520
IV-c AP2/EREBP#142 LOC_Os06g07030.1 Os06g0166400 TINY Os06g07030
IV-c AP2/EREBP#102 LOC_Os06g09790.1 Os06g0198200 CBF LIKE Os06g09790
IV-c AP2/EREBP#139 ------- Os02g0767800
IV-c AP2/EREBP#135 LOC_Os03g15660.1 Os03g0263000 TINY Os03g15660
IV-c AP2/EREBP#070 LOC_Os08g35240.1 Os08g0454000 Os08g35240
IV-c AP2/EREBP#144 LOC_Os04g48330.1 Os04g0572200 ERF027
IV-c AP2/EREBP#143 LOC_Os06g11940.1 Os06g0223100 DREB Os06g11940
IV-c AP2/EREBP#104 LOC_Os06g10780.1 Os06g0210300 ERF Os06g10780
IV-c AP2/EREBP#083 LOC_Os02g54050.1 Os02g0781300 Os02g54050
IV-c AP2/EREBP#100 LOC_Os06g08340.1 Os06g0181700 ERF Os06g08340
IV-c AP2/EREBP#055 LOC_Os06g09760.1 Os06g197900 Os06g09760
IVc AP2/EREBP#031 AP006056 ------ AP006056
IV-c AP2/EREBP#101 LOC_Os06g09717.1 Os06g0197200
IV-d AP2/EREBP#042 LOC_Os04g46440.1 Os04g0550200 Os04g46440
IV-d AP2/EREBP#041 LOC_Os04g46410.1 Os04g0549800 DREB1C Os04g46410
IV-d AP2/EREBP#148 LOC_Os02g43970.1 Os02g0657000 RAP211 Os02g43970
IV-d AP2/EREBP#007 LOC_Os10g41130.1 Os10g0560700 TINY Os10g41130
IV-d AP2/EREBP#021 LOC_Os02g43940.1 Os02g0656600 DREB2B Os02g43940
IV-d AP2/EREBP#040 LOC_Os04g46400.1 Os04g0549700 DREB1F Os04g46400
IV-d AP2/EREBP#002 LOC_Os01g10370.1 Os01g0200600 Os01g10370
IV-d AP2/EREBP#082 LOC_Os02g13710.1 Os02g0231000 TINY Os02g13710
IV-d AP2/EREBP#056 LOC_Os06g36000.1 Os06g0553700 Os06g36000
IV-d AP2/EREBP#105 LOC_Os06g11860.1 Os06g0222400 CHP Os06g11860
IV-d AP2/EREBP#157 LOC_Os11g13840.1 Os11g0242300 Os11g13840
IV-d AP2/EREBP#087 LOC_Os04g36640.1 Os04g0443800 DREB Os04g36640
IV-d AP2/EREBP#140 LOC_Os02g35240.1 Os02g0558700 DREB Os02g35240
IV-d AP2/EREBP#126 LOC_Os02g45420.1 Os02g0676800 DREB1E Os02g45420
IV-d AP2/EREBP#115 LOC_Os10g38000.1 Os10g0523900 DREB Os10g38000
IV-d AP2/EREBP#136 LOC_Os03g02650.1 Os03g0117900
IV-d AP2/EREBP#081 LOC_Os01g73770.1 Os01g0968800 DREB1F Os01g73770
IV-d AP2/EREBP#138 LOC_Os02g45450.1 Os02g0677300 CRT/DREB1 Os02g45450
IV-d AP2/EREBP#160 LOC_Os04g48350.1 Os04g0572400 CRT/DREB1 Os04g48350
IV-d AP2/EREBP#098 LOC_Os06g03670.1 Os06g0127100 CBF Os06g03670
IV-d AP2/EREBP#169 LOC_Os09g35010.1 Os09g0522000 CBF
IV-d AP2/EREBP#161 LOC_Os08g43210.1 Os08g0545500 DREB1I Os08g43210
IV-d AP2/EREBP#065 LOC_Os09g35020.1 Os09g0522100 CBF3 Os09g35020
IV-d AP2/EREBP#114 LOC_Os09g35030.1 Os09g0522200 DREB1A Os09g35030
Soloist AP2/EREBP#054 LOC_Os06g06970.1 Os06g0165600 CRT/DRE
AP2/EREBP#013 LOC_Os02g29550.1 Os02g0499000 CHP
Total = 170

Note:

**

The OS RAP (ID) number is mentioned because OsAP2/ERF#139 does not have the MSU locus identifier.

ebo-8-2012-321s2.tif (748.4KB, tif)

Figure 4B.

Figure 4B

Figure 4B

The phylogenetic relationship among the AP2/ERF family genes in rice. Group-IIIa, IIIb and IIIc corresponds to the AP2/ERF single domain proteins. Group-IIIa, IIIb and IIIc falls in the ERF. Their conserved motifs determined by the MEME online tools are given the Supplementary File 1.

Figure 4C.

Figure 4C

The phylogenetic relationship among the AP2/ERF family genes in rice. Group-IV symbolises the AP2/ERF single domain proteins. Group-IVa, IVb, IVc and IVd are predicted to relate CBF/DREB genes. Their conserved motifs determined by the MEME online tools are given the Supplementary File 1.

Footnotes

Author Contributions

Conceived and designed the experiments: M.R. Analysed the data: M.R. Wrote the first draft of the manuscript: M.R. Contributed to the writing of the manuscript: M.R. Agree with manuscript results and conclusions: M.R., G.H. and Y.G. Jointly developed the structure and arguments for the paper: M.R., J.H. Made critical revisions and approved final version: M.R., X.Y. All authors reviewed and approved of the final manuscript.

Competing Interests

Author(s) disclose no potential conflicts of interest.

Disclosures and Ethics

As a requirement of publication author(s) have provided to the publisher signed confirmation of compliance with legal and ethical obligations including but not limited to the following: authorship and contributorship, conflicts of interest, privacy and confidentiality and (where applicable) protection of human and animal research subjects. The authors have read and confirmed their agreement with the ICMJE authorship and conflict of interest criteria. The authors have also confirmed that this article is unique and not under consideration or published in any other publication, and that they have permission from rights holders to reproduce any copyrighted material. Any disclosures are made in this section. The external blind peer reviewers report no conflicts of interest.

Funding

This work is supported by the National Major Specific Project of the People’s Republic of China (2011 ZX 08002-004, 2009 ZX 08016-001A, 2009 ZX 08002- 013B) and the International Science and Technology Cooperation project of China MoST (2009 DFB 20290).

References

  • 1.Abogadallah GM, Nada RM, Malinowski R, Quick P. Overexpression of HARDY, an AP2/ERF gene from Arabidopsis, improves drought and salt tolerance by reducing transpiration and sodium uptake in transgenic Trifolium alexandrinum L. Planta. 2011;233:1265–76. doi: 10.1007/s00425-011-1382-3. [DOI] [PubMed] [Google Scholar]
  • 2.Agarwal P, Agarwal PK, Joshi AJ, Sopory SK, Reddy MK. Overexpression of PgDREB2A transcription factor enhances abiotic stress tolerance and activates downstream stress-responsive genes. Molecular Biology Reports. 2010;37(2):1125–35. doi: 10.1007/s11033-009-9885-8. [DOI] [PubMed] [Google Scholar]
  • 3.Gao FC JM, Xiong AS, Peng RH, Liu JG, Cai B, Yao QH. Isolation and characterization of a novel AP2/EREBP-type transcription factor OsAP211 in Oryza sativa. Biologia Plantarum. 2009;53(4):643–9. [Google Scholar]
  • 4.Hu Y, Zhao L, Chong K, Wang T. Overexpression of OsERF1, a novel rice ERF gene, up-regulates ethylene-responsive genes expression besides affects growth and development in Arabidopsis. Journal of Plant Physiology. 2008;165(16):1717–25. doi: 10.1016/j.jplph.2007.12.006. [DOI] [PubMed] [Google Scholar]
  • 5.Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription factors. Biological Chemistry. 1998;379:633–46. doi: 10.1515/bchm.1998.379.6.633. [DOI] [PubMed] [Google Scholar]
  • 6.Sakuma YL Q, Dubouzet JG, Abe H, Shinozaki K, Yamaguchi-Shinozaki K. DNA-binding specificity of the ERF/AP2 domain of Arabidopsis DREBs, transcription factors involved in dehydration-and cold-inducible gene expression. Biochemical and Biophysical Research Communications. 2002;290(3):998–1009. doi: 10.1006/bbrc.2001.6299. [DOI] [PubMed] [Google Scholar]
  • 7.Jofuku KD, Boer BGW, Montagu MV, Okamuro JK. Control of Arabidopsis flower and seed development by the homeotic gene APETALA2. The Plant Cell Online. 1994;6(9):1211–25. doi: 10.1105/tpc.6.9.1211. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Ohme-Takagi M, Shinshi H. Ethylene-inducible DNA binding proteins that interact with an ethylene-responsive element. The Plant Cell Online. 1995;7(2):173–82. doi: 10.1105/tpc.7.2.173. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Zhou J, Tang X, Martin GB. The Pto kinase conferring resistance to tomato bacterial speck disease interacts with proteins that bind a cis-element of pathogenesis-related genes. The EMBO Journal. 1997;16(11):3207–18. doi: 10.1093/emboj/16.11.3207. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiology. 2006;140(2):411–32. doi: 10.1104/pp.105.073783. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Shigyo M, Ito M. Analysis of gymnosperm two-AP2-domain-containing genes. Development Genes and Evolution. 2004;214(3):105–14. doi: 10.1007/s00427-004-0385-5. [DOI] [PubMed] [Google Scholar]
  • 12.Hao D, Ohme-Takagi M, Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. Journal of Biological Chemistry. 1998;273(41):26857–61. doi: 10.1074/jbc.273.41.26857. [DOI] [PubMed] [Google Scholar]
  • 13.Yamaguchi-Shinozaki K, Shinozaki K. A novel cis-acting element in an Arabidopsis gene is involved in responsiveness to drought, low-temperature, or high-salt stress. The Plant Cell Online. 1994;6(2):251–64. doi: 10.1105/tpc.6.2.251. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Sharma MKK R, Solanke AU, Sharma R, Tyagi AK, Sharma AK. Identification, phylogeny, and transcript profiling of ERF family genes during development and abiotic stress treatments in tomato. Molecular Genetics and Genomics. 2010;284:455–75. doi: 10.1007/s00438-010-0580-1. [DOI] [PubMed] [Google Scholar]
  • 15.Allen MD, Yamasaki K, Ohme-Takagi M, Tateno M, Suzuki M. A novel mode of DNA recognition by a β-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA. The EMBO Journal. 1998;17(18):5484–96. doi: 10.1093/emboj/17.18.5484. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Jaillon OAJM, Noel B, Policriti A, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature. 2007;449(7161):463–7. doi: 10.1038/nature06148. [DOI] [PubMed] [Google Scholar]
  • 17.Zhuang JC B, Peng RH, Zhu B, Jin XF, et al. Genome-wide analysis of the AP2/ERF gene family in Populus trichocarpa. Biochemical and Biophysical Research Communications. 2008;371(3):468–74. doi: 10.1016/j.bbrc.2008.04.087. [DOI] [PubMed] [Google Scholar]
  • 18.Sharoni AMN M, Satoh K, Shimizu T, et al. Gene structures, classification and expression models of the AP2/EREBP transcription factor family in rice. Plant and Cell Physiology. 2011;52(2):344–60. doi: 10.1093/pcp/pcq196. [DOI] [PubMed] [Google Scholar]
  • 19.Zhu QZ J, Gao X, Tong J, Xiao L, Li W, Zhang H. The Arabidopsis AP2/ ERF transcription factor RAP2. 6 participates in ABA, salt and osmotic stress responses. Gene. 2010;457(1–2):1–12. doi: 10.1016/j.gene.2010.02.011. [DOI] [PubMed] [Google Scholar]
  • 20.Zarei AK AP, Younessi P, Montiel G, Champion A, Memelink J. Two GCC boxes and AP2/ERF-domain transcription factor ORA59 in jasmonate/ ethylene-mediated activation of the PDF1.2 promoter in Arabidopsis. Plant Molecular Biology. 2011;75:321–31. doi: 10.1007/s11103-010-9728-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Yu ZXL, JX, Yang CQ, Hu WL, Wang LJ, Chen XY. The Jasmonate-Responsive AP2/ERF Transcription Factors AaERF1 and AaERF2 Positively Regulate Artemisinin Biosynthesis in Artemisia annua L. Molecular Plant. 2011:1–13. doi: 10.1093/mp/ssr087. [DOI] [PubMed] [Google Scholar]
  • 22.Mizoi J, Shinozaki K, Yamaguchi-Shinozaki K. AP2/ERF family transcription factors in plant abiotic stress responses. Biochimica et Biophysica Acta (BBA)-Gene Regulatory Mechanisms. 2011;1819(2):86–96. doi: 10.1016/j.bbagrm.2011.08.004. [DOI] [PubMed] [Google Scholar]
  • 23.Song CPA M, Ohta M, Guo Y, Halfter U, Wang P, Zhu JK. Role of an Arabidopsis AP2/EREBP-type transcriptional repressor in abscisic acid and drought stress responses. The Plant Cell Online. 2005;17(8):2384–96. doi: 10.1105/tpc.105.033043. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Liu QK M, Sakuma Y, Abe H, Miura S, Yamaguchi-Shinozaki K, Shinozaki K. Two transcription factors, DREB1 and DREB2, with an EREBP/AP2 DNA binding domain separate two cellular signal transduction pathways in drought-and low-temperature-responsive gene expression, respectively, in Arabidopsis. The Plant Cell Online. 1998;10(8):1391–406. doi: 10.1105/tpc.10.8.1391. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Bihani P, Char B, Bhargava S. Transgenic expression of sorghum DREB2 in rice improves tolerance and yield under water limitation. The Journal of Agricultural Science. 2011;149(01):95–101. [Google Scholar]
  • 26.Nakashima KS ZK, Sakuma Y, Seki M, Miura S, Shinozaki K, Yamaguchi-Shinozaki K. Organization and expression of two Arabidopsis DREB2 genes encoding DRE-binding proteins involved in dehydration-and high-salinity-responsive gene expression. Plant Molecular Biology. 2000;42(4):657–65. doi: 10.1023/a:1006321900483. [DOI] [PubMed] [Google Scholar]
  • 27.Golldack D, Lüking I, Yang O. Plant tolerance to drought and salinity: stress regulating transcription factors and their functional significance in the cellular transcriptional network. Plant Cell Reports. 2011;30:1383–91. doi: 10.1007/s00299-011-1068-0. [DOI] [PubMed] [Google Scholar]
  • 28.Carvallo MAP, MT, Jeknić Z, et al. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana. Journal of Experimental Botany. 2011;62(11):3807–19. doi: 10.1093/jxb/err066. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Maki HSM, Ogawa K, Kaida R, Yamamoto N, Kaneko ST. Cloning and expression profile of an ERF gene isolated from cold-stressed poplar cells (Populus nigra) Cytologia. 2011;76(1):11–8. [Google Scholar]
  • 30.Li CWS, RC, Cheng CP, You SJ, Hsieh TH, Chao TC, Chan MT. Tomato RAV transcription factor is a pivotal modulator involved in the AP2/EREBP-mediated defense pathway. Plant Physiology. 2011;156(1):213–27. doi: 10.1104/pp.111.174268. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Zhou YLX, MR, Zhao MF, et al. Genome-wide gene responses in a transgenic rice line carrying the maize resistance gene Rxo1 to the rice bacterial streak pathogen, Xanthomonas oryzae pv. oryzicola. BMC Genomics. 2010;11(1):78. doi: 10.1186/1471-2164-11-78. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Rzewuski G, Sauter M. Ethylene biosynthesis and signaling in rice. Plant Science. 2008;175(1):32–42. [Google Scholar]
  • 33.Aukerman MJ, Sakai H. Regulation of flowering time and floral organ identity by a microRNA and its APETALA2-like target genes. The Plant Cell Online. 2003;15(11):2730–41. doi: 10.1105/tpc.016238. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Kirch T, Simon R, Grünewald M, Werr W. The DORNRÖSCHEN/ ENHANCER OF SHOOT REGENERATION1 gene of Arabidopsis acts in the control of meristem cell fate and lateral organ development. The Plant Cell Online. 2003;15(3):694–705. doi: 10.1105/tpc.009480. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Kitomi YI H, Hobo T, Aya K, Kitano H, Inukai Y. The auxin responsive AP2/ERF transcription factor CROWN ROOTLESS5 is involved in crown root initiation in rice through the induction of OsRR1, a type-A response regulator of cytokinin signaling. The Plant Journal. 2011;67(3):472–84. doi: 10.1111/j.1365-313X.2011.04610.x. [DOI] [PubMed] [Google Scholar]
  • 36.Imin N, Nizamidin M, Wu T, Rolfe BG. Factors involved in root formation in Medicago truncatula. Journal of Experimental Botany. 2007;58(3):439–51. doi: 10.1093/jxb/erl224. [DOI] [PubMed] [Google Scholar]
  • 37.El Ouakfaoui S, Schnell J, Abdeen A, et al. Control of somatic embryogenesis and embryo development by AP2 transcription factors. Plant Molecular Biology. 2010;74:313–26. doi: 10.1007/s11103-010-9674-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Alonso JM, Stepanova AN, Leisse TJ, et al. Genome-wide insertional muta-genesis of Arabidopsis thaliana. Science. 2003;301(5633):653–7. doi: 10.1126/science.1086391. [DOI] [PubMed] [Google Scholar]
  • 39.Yu Xin H, Yong Hong W, Xin Fang L, Jia Yang L. Arabidopsis RAV1 is down-regulated by brassinosteroid and may act as a negative regulator during plant development. Cell Research. 2004;14(1):8–15. doi: 10.1038/sj.cr.7290197. [DOI] [PubMed] [Google Scholar]
  • 40.Salvi SS G, Morgante M, Tomes D, et al. Conserved noncoding genomic sequences associated with a flowering-time quantitative trait locus in maize. Proceedings of the National Academy of Sciences. 2007;104(27):11376–81. doi: 10.1073/pnas.0704145104. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Sohn KH, Lee SC, Jung HW, Hong JK, Hwang BK. Expression and functional roles of the pepper pathogen-induced transcription factor RAV1 in bacterial disease resistance, and drought and salt stress tolerance. Plant Molecular Biology. 2006;61(6):897–915. doi: 10.1007/s11103-006-0057-0. [DOI] [PubMed] [Google Scholar]
  • 42.Zhuang J, Sun CC, Zhou XR, Xiong AS, Zhang J. Isolation and characterization of an AP2/ERF-RAV transcription factor BnaRAV-1-HY15 in Brassica napus L. HuYou15. Molecular Biology Reports. 2011;38:3921–8. doi: 10.1007/s11033-010-0508-1. [DOI] [PubMed] [Google Scholar]
  • 43.Wuitschick JD, Lindstrom PR, Meyer AE, Karrer KM. Homing endonucleases encoded by germ line-limited genes in Tetrahymena thermophila have APETELA2 DNA binding domains. Eukaryotic Cell. 2004;3(3):685–94. doi: 10.1128/EC.3.3.685-694.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Magnani E, Sjölander K, Hake S. From endonucleases to transcription f actors: evolution of the AP2 DNA binding domain in plants. The Plant Cell Online. 2004;16(9):2265–77. doi: 10.1105/tpc.104.023135. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Dalgaard JZ, Klar AJ, Moser MJ, Holley WR, Chatterjee A, Mian IS. Statistical modeling and analysis of the LAGLIDADG family of site-specific endonucleases and identification of an intein that encodes a site-specific endonuclease of the HNH family. Nucleic Acids Research. 1997;25(22):4626–38. doi: 10.1093/nar/25.22.4626. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Sayers EW, Barrett T, Benson DA, et al. Database resources of the national center for biotechnology information. Nucleic Acids Research. 2011;39(Suppl 1):D38–51. doi: 10.1093/nar/gkq1172. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Gao G, Zhong Y, Guo A, et al. DRTF: a database of rice transcription factors. Bioinformatics. 2006;22(10):1286–7. doi: 10.1093/bioinformatics/btl107. [DOI] [PubMed] [Google Scholar]
  • 48.Ouyang S, Zhu W, Hamilton J, et al. The TIGR rice genome annotation resource: improvements and new features. Nucleic Acids Research. 2007;35(Suppl 1):D883–7. doi: 10.1093/nar/gkl976. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Kikuchi S, Satoh K, Nagata T, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science. 2003;301(5631):376–9. doi: 10.1126/science.1081288. [DOI] [PubMed] [Google Scholar]
  • 50.Dong Q, Schlueter SD, Brendel V. PlantGDB, plant genome database and analysis tools. Nucleic Acids Research. 2004;32(Suppl 1):D354–9. doi: 10.1093/nar/gkh046. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Tanaka T, Antonio BA, Kikuchi S, et al. The rice annotation project database (RAP-DB): 2008 update. Nucleic Acids Research. 2008;36(Suppl 1):D1028–33. doi: 10.1093/nar/gkm978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Burge C, Karlin S. Prediction of complete gene structures in human genomic DNA1. Journal of Molecular Biology. 1997;268(1):78–94. doi: 10.1006/jmbi.1997.0951. [DOI] [PubMed] [Google Scholar]
  • 53.Huang X, Madan A. CAP3: A DNA sequence assembly program. Genome Research. 1999;9(9):868–77. doi: 10.1101/gr.9.9.868. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Schultz J, Milpetz F, Bork P, Ponting CP. SMART, a simple modular architecture research tool: identification of signaling domains. Proceedings of the National Academy of Sciences. 1998;95(11):5857–64. doi: 10.1073/pnas.95.11.5857. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Larkin M, Blackshields G, Brown N, et al. Clustal W and Clustal X version 2.0. Bioinformatics. 2007;23(21):2947–8. doi: 10.1093/bioinformatics/btm404. [DOI] [PubMed] [Google Scholar]
  • 56.Tamura K, Dudley J, Nei M, Kumar S. MEGA4: molecular evolutionary genetics analysis (MEGA) software version 4.0. Molecular Biology and Evolution. 2007;24(8):1596–9. doi: 10.1093/molbev/msm092. [DOI] [PubMed] [Google Scholar]
  • 57.Bailey TL, Boden M, Buske FA, et al. MEME SUITE: tools for motif discovery and searching. Nucleic Acids Research. 2009;37(Suppl 2):W202–8. doi: 10.1093/nar/gkp335. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Guo AY, Zhu QH, Chen X, Luo JC. GSDS: a gene structure display server] Yi chuan = Hereditas/Zhongguo yi chuan xue hui bian ji. 2007;29(8):1023–6. [PubMed] [Google Scholar]
  • 59.Lynch M, Kewalramani A. Messenger RNA surveillance and the evolutionary proliferation of introns. Molecular Biology and Evolution. 2003;20(4):563–71. doi: 10.1093/molbev/msg068. [DOI] [PubMed] [Google Scholar]
  • 60.Sato Y, Antonio BA, Namiki N, et al. RiceXPro: a platform for monitoring gene expression in japonica rice grown under natural field conditions. Nucleic Acids Research. 2011;39(Suppl 1):D1141–8. doi: 10.1093/nar/gkq1085. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Rhee SY, Beavis W, Berardini TZ, et al. The Arabidopsis Information Resource (TAIR): a model organism database providing a centralized, curated gateway to Arabidopsis biology, research materials and community. Nucleic Acids Research. 2003;31(1):224–8. doi: 10.1093/nar/gkg076. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Mizukami Y, Fischer RL. Plant organ size control: AINTEGUMENTA regulates growth and cell numbers during organogenesis. Proceedings of the National Academy of Sciences. 2000;97(2):942–497. doi: 10.1073/pnas.97.2.942. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Boutilier K, Offringa R, Sharma VK, et al. Ectopic expression of BABY BOOM triggers a conversion from vegetative to embryonic growth. The Plant Cell Online. 2002;14(8):1737–49. doi: 10.1105/tpc.001941. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Cernac A, Benning C. WRINKLED1 encodes an AP2/EREB domain protein involved in the control of storage compound biosynthesis in Arabidopsis. The Plant Journal. 2004;40(4):575–85. doi: 10.1111/j.1365-313X.2004.02235.x. [DOI] [PubMed] [Google Scholar]
  • 65.Aida M, Beis D, Heidstra R, et al. The PLETHORA genes mediate patterning of the Arabidopsis root stem cell niche. Cell. 2004;119(1):109–20. doi: 10.1016/j.cell.2004.09.018. [DOI] [PubMed] [Google Scholar]
  • 66.Drews GN, BJ, Meyerowitz EM. Negative regulation of the Arabidopsis homeotic gene AGAMOUS by the APETALA2 product. Cell. 1991;14(65):991–1002. doi: 10.1016/0092-8674(91)90551-9. [DOI] [PubMed] [Google Scholar]
  • 67.Krizek BA, Prost V, Macias A. AINTEGUMENTA promotes petal identity and acts as a negative regulator of AGAMOUS. The Plant Cell Online. 2000;12(8):1357–66. doi: 10.1105/tpc.12.8.1357. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Meyer K, Damude HG, Everard JD, Ripp KG, Stecca KL. Use of a seed specific promoter to drive odp1 expression in cruciferous oilseed plants to increase oil content while maintaining normal germination. 20,100/257,635. US Patent App. 2010
  • 69.Klucher KM, Chow H, Reiser L, Fischer RL. The AINTEGUMENTA gene of Arabidopsis required for ovule and female gametophyte development is related to the floral homeotic gene APETALA2. The Plant Cell Online. 1996;8(2):137–53. doi: 10.1105/tpc.8.2.137. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Okamuro JK, Caster B, Villarroel R, Van Montagu M, Jofuku KD. The AP2 domain of APETALA2 defines a large new family of DNA binding proteins in Arabidopsis. Proceedings of the National Academy of Sciences. 1997;94(13):7076–81. doi: 10.1073/pnas.94.13.7076. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Nishiuchi T, Suzuki K, Kitajima S, Sato F, Shinshi H. Wounding activates immediate early transcription of genes for ERFs in tobacco plants. Plant Molecular Biology. 2002;49(5):473–82. doi: 10.1023/a:1015553232309. [DOI] [PubMed] [Google Scholar]
  • 72.Zhang H, Zhang D, Chen J, et al. Tomato stress-responsive factor TSRF1 interacts with ethylene responsive element GCC box and regulates pathogen resistance to Ralstonia solanacearum. Plant Molecular Biology. 2004;55(6):825–34. doi: 10.1007/s11103-004-2140-8. [DOI] [PubMed] [Google Scholar]
  • 73.Xu ZS, Xia LQ, Chen M, et al. Isolation and molecular characterization of the Triticum aestivum L. ethylene-responsive factor 1 (TaERF1) that increases multiple stress tolerance. Plant Molecular Biology. 2007;65(6):719–32. doi: 10.1007/s11103-007-9237-9. [DOI] [PubMed] [Google Scholar]
  • 74.Meng X, Li F, Liu C, Zhang C, Wu Z, Chen Y. Isolation and characterization of an ERF transcription factor gene from cotton (Gossypium barbadense L.) Plant Molecular Biology Reporter. 2010;28(1):176–83. [Google Scholar]
  • 75.Fujimoto SY, Ohta M, Usui A, Shinshi H, Ohme-Takagi M. Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box–mediated gene expression. The Plant Cell Online. 2000;12(3):393–404. doi: 10.1105/tpc.12.3.393. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Ashida Y, Yokobatake N, Kohchi C, Shimoda K, Hirata T. Cloning of cDNA encoding ethylene-responsive element binding protein-5 in the cultured cells of Nicotiana tabacum. Mitochondrial DNA. 2000;11(1–2):125–9. doi: 10.3109/10425170009033979. [DOI] [PubMed] [Google Scholar]
  • 77.Ohta M, Ohme-Takagi M, Shinshi H. Three ethylene-responsive transcription factors in tobacco with distinct transactivation functions. The Plant Journal. 2000;22(1):29–38. doi: 10.1046/j.1365-313x.2000.00709.x. [DOI] [PubMed] [Google Scholar]
  • 78.Lu J, Ju H, Zhou G, et al. An EAR-motif-containing ERF transcription factor affects herbivore-induced signaling, defense and resistance in rice. The Plant Journal. 2011;68(4):583–96. doi: 10.1111/j.1365-313X.2011.04709.x. [DOI] [PubMed] [Google Scholar]
  • 79.Ohta M, Matsui K, Hiratsu K, Shinshi H, Ohme-Takagi M. Repression domains of class II ERF transcriptional repressors share an essential motif for active repression. The Plant Cell Online. 2001;13(8):1959–68. doi: 10.1105/TPC.010127. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 80.Koyama T, Okada T, Kitajima S, Ohme-Takagi M, Shinshi H, Sato F. Isolation of tobacco ubiquitin-conjugating enzyme cDNA in a yeast two-hybrid system with tobacco ERF3 as bait and its characterization of specific interaction. Journal of Experimental Botany. 2003;54(385):1175–81. doi: 10.1093/jxb/erg136. [DOI] [PubMed] [Google Scholar]
  • 81.Ye R, Yao QH, Xu ZH, Xue HW. Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development. The Plant Journal. 2004;38(2):348–57. doi: 10.1111/j.1365-313X.2004.02037.x. [DOI] [PubMed] [Google Scholar]
  • 82.Díaz-Martín J, Almoguera C, Prieto-Dapena P, Espinosa JM, Jordano J. Functional interaction between two transcription factors involved in the developmental regulation of a small heat stress protein gene promoter. Plant Physiology. 2005;139(3):1483–94. doi: 10.1104/pp.105.069963. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 83.Jaglo KR, Kleff S, Amundsen KL, et al. Components of the Arabidopsis C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved inbrassica napus and other plant species. Plant Physiology. 2001;127(3):910–7. [PMC free article] [PubMed] [Google Scholar]
  • 84.Zhang X, Fowler SG, Cheng H, et al. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. The Plant Journal. 2004;39(6):905–19. doi: 10.1111/j.1365-313X.2004.02176.x. [DOI] [PubMed] [Google Scholar]
  • 85.Ito Y, Katsura K, Maruyama K, et al. Functional analysis of rice DREB1/ CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant and Cell Physiology. 2006;47(1):141–53. doi: 10.1093/pcp/pci230. [DOI] [PubMed] [Google Scholar]
  • 86.Alonso-Blanco C, Gomez-Mena C, Llorente F, Koornneef M, Salinas J, Martínez-Zapater JM. Genetic and molecular analyses of natural variation indicate CBF2 as a candidate gene for underlying a freezing tolerance quantitative trait locus in Arabidopsis. Plant Physiology. 2005;139(3):1304–12. doi: 10.1104/pp.105.068510. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87.Wang L, Luo Y, Zhang L, et al. Isolation and characterization of a C-repeat binding transcription factor from maize. Journal of Integrative Plant Biology. 2008;50(8):965–74. doi: 10.1111/j.1744-7909.2008.00683.x. [DOI] [PubMed] [Google Scholar]
  • 88.Dubouzet JG, Sakuma Y, Ito Y, et al. OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. The Plant Journal. 2003;33(4):751–63. doi: 10.1046/j.1365-313x.2003.01661.x. [DOI] [PubMed] [Google Scholar]
  • 89.Matsumoto T, Wu J, Kanamori H, et al. The map-based sequence of the rice genome. Nature. 2005;436(7052):793–800. doi: 10.1038/nature03895. [DOI] [PubMed] [Google Scholar]
  • 90.Wang Q, Guan Y, Wu Y, Chen H, Chen F, Chu C. Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature tolerance in both Arabidopsis and rice. Plant Molecular Biology. 2008;67(6):589–602. doi: 10.1007/s11103-008-9340-6. [DOI] [PubMed] [Google Scholar]
  • 91.Mallikarjuna G, Mallikarjuna K, Reddy M, Kaul T. Expression of OsDREB2 A transcription factor confers enhanced dehydration and salt stress tolerance in rice (Oryza sativa L.) Biotechnology Letters. 2011;33:1689–97. doi: 10.1007/s10529-011-0620-x. [DOI] [PubMed] [Google Scholar]
  • 92.Matsukura S, Mizoi J, Yoshida T, et al. Comprehensive analysis of rice DREB2-type genes that encode transcription factors involved in the expression of abiotic stress-responsive genes. Molecular Genetics and Genomics. 2010;283(2):185–96. doi: 10.1007/s00438-009-0506-y. [DOI] [PubMed] [Google Scholar]
  • 93.Alexandrov NN, Brover VV, Freidin S, et al. Insights into corn genes derived from large-scale cDNA sequencing. Plant Molecular Biology. 2009;69(1):179–94. doi: 10.1007/s11103-008-9415-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 94.Reyes JC, Muro-Pastor MI, Florencio FJ. The GATA family of transcription factors in Arabidopsis and rice. Plant Physiology. 2004;134(4):1718–32. doi: 10.1104/pp.103.037788. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 95.Büttner M, Singh KB. Arabidopsis thaliana ethylene-responsive element binding protein (AtEBP), an ethylene-inducible, GCC box DNA-binding protein interacts with an ocs element binding protein. Proceedings of the National Academy of Sciences. 1997;94(11):5961–6. doi: 10.1073/pnas.94.11.5961. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 96.Cheong YH, Moon BC, Kim JK, et al. BWMK1, a rice mitogen-activated protein kinase, locates in the nucleus and mediates pathogenesis-related gene expression by activation of a transcription factor. Plant Physiology. 2003;132(4):1961–72. doi: 10.1104/pp.103.023176. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 97.Albrecht V, Ritz O, Linder S, Harter K, Kudla J. The NAF domain defines a novel protein–protein interaction module conserved in Ca2+-regulated kinases. The EMBO Journal. 2001;20(5):1051–63. doi: 10.1093/emboj/20.5.1051. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 98.Qu LJ, Zhu YX. Transcription factor families in Arabidopsis: major progress and outstanding issues for future research. Current Opinion in Plant Biology. 2006;9(5):544–9. doi: 10.1016/j.pbi.2006.07.005. [DOI] [PubMed] [Google Scholar]
  • 99.Feng JX, Liu D, Pan Y, et al. An annotation update via cDNA sequence analysis and comprehensive profiling of developmental, hormonal or environmental responsiveness of the Arabidopsis AP2/EREBP transcription factor gene family. Plant Molecular Biology. 2005;59(6):853–68. doi: 10.1007/s11103-005-1511-0. [DOI] [PubMed] [Google Scholar]
  • 100.Hagen G, Guilfoyle T. Auxin-responsive gene expression: genes, promoters and regulatory factors. Plant Molecular Biology. 2002;49(3):373–85. [PubMed] [Google Scholar]
  • 101.Li J, Dai X, Zhao Y. A role for auxin response factor 19 in auxin and ethylene signaling in Arabidopsis. Plant Physiology. 2006;140(3):899–908. doi: 10.1104/pp.105.070987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 102.Manosalva PM, Davidson RM, Liu B, et al. A germin-like protein gene family functions as a complex quantitative trait locus conferring broad- spectrum disease resistance in rice. Plant Physiology. 2009;149(1):286–96. doi: 10.1104/pp.108.128348. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 103.Meyers BC, Kozik A, Griego A, Kuang H, Michelmore RW. Genome-wide analysis of NBS-LRR–encoding genes in Arabidopsis. The Plant Cell Online. 2003;15(4):809–34. doi: 10.1105/tpc.009308. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 104.Yaish MWF, Peng M, Rothstein SJ. AtMBD9 modulates Arabidopsis development through the dual epigenetic pathways of DNA methylation and histone acetylation. The Plant Journal. 2009;59(1):123–35. doi: 10.1111/j.1365-313X.2009.03860.x. [DOI] [PubMed] [Google Scholar]
  • 105.Swarbreck D, Wilks C, Lamesch P, et al. The Arabidopsis Information Resource (TAIR): gene structure and function annotation. Nucleic Acids Research. 2008;36(Suppl 1):D1009–14. doi: 10.1093/nar/gkm965. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 106.Weber H, Hellmann H. Arabidopsis thaliana BTB/POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family. FEBS Journal. 2009;276(22):6624–35. doi: 10.1111/j.1742-4658.2009.07373.x. [DOI] [PubMed] [Google Scholar]
  • 107.Zhuang J, Chen JM, Yao QH, et al. Discovery and expression profile analysis of AP2/ERF family genes from Triticum aestivum. Molecular Biology Reports. 2011;38(2):745–53. doi: 10.1007/s11033-010-0162-7. [DOI] [PubMed] [Google Scholar]
  • 108.Kyndt T, Denil S, Haegeman A, et al. Transcriptome analysis of rice mature root tissue and root tips in early development by massive parallel sequencing. Journal of Experimental Botany. 2012 doi: 10.1093/jxb/err435. [DOI] [PubMed] [Google Scholar]
  • 109.Qin Q, Liu J, Zhang Z, et al. Isolation, optimization, and functional analysis of the cDNA encoding transcription factor OsDREB1B in Oryza Sativa L. Molecular Breeding. 2007;19(4):329–40. [Google Scholar]
  • 110.Gao F, Chen JM, Xiong AS, et al. Isolation and characterization of a novel AP2/EREBP-type transcription factor OsAP211 in Oryza sativa. Biologia Plantarum. 2009;53(4):643–9. [Google Scholar]
  • 111.Fu XY, Zhang Z, Peng RH, et al. Isolation and characterization of a novel cDNA encoding ERF/AP2-type transcription factor OsAP25 from Oryza Sativa L. Biotechnology Letters. 2007;29(8):1293–9. doi: 10.1007/s10529-007-9370-1. [DOI] [PubMed] [Google Scholar]
  • 112.Nagamura Y, Antonio BA, Sato Y, et al. Rice TOGO browser: a platform to retrieve integrated information on rice functional and applied genomics. Plant and Cell Physiology. 2011;52(2):230–7. doi: 10.1093/pcp/pcq197. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 113.Bailey P, McKibbin R, Lenton J, Holdsworth M, Flintham J, Gale M. Genetic map locations for orthologous Vp1 genes in wheat and rice. TAG Theoretical and Applied Genetics. 1999;98(2):281–4. [Google Scholar]
  • 114.Distelfeld A, Pearce SP, Avni R, et al. Divergent functions of orthologous NAC transcription factors in wheat and rice. Plant Molecular Biology. 2012:1–10. doi: 10.1007/s11103-012-9881-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115.Wu H, Dorse S, Bhave M. In silico identification and analysis of the protein disulphide isomerases in wheat and rice. Biologia. 2012;67(1):48–60. [Google Scholar]
  • 116.Choisne N, Demange N, Orjeda G, et al. The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications. BMC Biol. 2005;3:20. doi: 10.1186/1741-7007-3-20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 117.Deynze AE, Nelson JC, Yglesias ES, et al. Comparative mapping in grasses. Wheat relationships. Molecular and General Genetics MGG. 1995;248(6):744–54. doi: 10.1007/BF02191715. [DOI] [PubMed] [Google Scholar]
  • 118.Salse J, Bolot S, Throude M, et al. Identification and characterization of shared duplications between rice and wheat provide new insight into grass genome evolution. The Plant Cell Online. 2008;20(1):11–24. doi: 10.1105/tpc.107.056309. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 119.Salse J, Piégu B, Cooke R, Delseny M. Synteny between Arabidopsis thaliana and rice at the genome level: a tool to identify conservation in the ongoing rice genome sequencing project. Nucleic Acids Research. 2002;30(11):2316–28. doi: 10.1093/nar/30.11.2316. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 120.Devos KM, Beales J, Nagamura Y, Sasaki T. Arabidopsis–rice: will colin-earity allow gene prediction across the eudicot–monocot divide? Genome Research. 1999;9(9):825–9. doi: 10.1101/gr.9.9.825. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 121.Goff SA, Ricke D, Lan TH, et al. A draft sequence of the rice genome (Oryza sativa L. ssp. japonica) Science. 2002;296(5565):92–100. doi: 10.1126/science.1068275. [DOI] [PubMed] [Google Scholar]
  • 122.Liu H, Sachidanandam R, Stein L. Comparative genomics between rice and Arabidopsis shows scant collinearity in gene order. Genome Research. 2001;11(12):2020–6. doi: 10.1101/gr.194501. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Table S1.

The functional description of conserved motifs found on both sides of the AP2/ERF domain.

Motif Species Protein name Reference
[A/W]R[D/E][H/P]LF[D/E]K[T/A]
VTPSDVGKLNRLV[I/V]PKQ[H/Q]
AEKHFP[L/F]
KGVLLNFED[A/G][A/E/D]
GKVW[R/K]FRYSYWNSSQSYV
Arabidopsis AP2/ERF and B3 domain-containing protein
Function as negative regulator of plant growth and development
39
MCGGAI Arabidopsis Ethylene-responsive transcription factor RAP2-3, RAP2-2, RAP2-12 95
DFEA Rice Ethylene-responsive transcription factor 1 96
LPR[P/A] Arabidopsis CBL-interacting serine/threonine-protein kinase-12 97
D[I/V]QAA Arabidopsis Ethylene-responsive transcription factor ERF037 98
D[I/V]R[A/L/R]AA Arabidopsis Dehydration responsive element binding proteins-1C and proteins-G in rice 99
[L/R]AAA Arabidopsis Auxin response factor-19 100
[H/V/A/D/E/R/Q]LNFP Rice Germin-like protein 8–4 102
LDF[S/T]E Arabidopsis Putative disease resistance protein At4g19050 103
APWDE Arabidopsis Methyl-CpG-binding domain-containing protein 9 104
KYPS Arabidopsis Probable methyltransferase PMT18 105
EIDWD Arabidopsis Ethylene-responsive transcription factor ERF060, 057, 056, RAP2-13 106

Table S2.

AP2/ERF family genes whose biological functions are reported.

Group Gene Function Plant References
I BBM
BBM1
Vegetative to embryonic growth, somatic embryogenesis, mostly expressed in developing seeds, crown, and lateral roots formation Arabidopsis, Brassica napus (Rape), Medicago truncatula 36,37,63
I WRL1 Required for embryo development, seed germination Arabidopsis 64
I ANT Petal cell identity and mediates down-regulation of AG in flower whorl Arabidopsis 67
I ERF Adaptive responses to flooding stress in rice Rice 32
I RAP2.7 Regulates negatively the transition to flowering time Arabidopsis 33
I FHP Floral meristem identity in synergy with LEAFY Arabidopsis 69
I RAP2.1 Expressed in flowers, leaves, and stems, and at very low levels in roots Arabidopsis 70
II RAV Negative regulator of plant growth and development Arabidopsis 30,39
II RAV Defense mediated pathway in tomato Tomato 30
III RAP2.6 Responsive to stress hormones like jasmonic acid, salicylic acid, abscisic acid and ethylene Arabidopsis 10
III ERF1 Disease resistance Arabidopsis, rice, tobacco, 4,31,71
III ERF2 Disease resistance Tobacco 71
III TSRF1 Disease resistance Tomato 72
III ERF3 Up-regulated by feeding of the rice striped stem borer Rice 78
III EREBP5 Regulation of gene expression by stress factors and components of stress signal transduction pathways Arabidopsis, Tobacco 75,76
III EREBP1 Improved pathogen and abiotic stress tolerance in transgenic plants Wheat, cotton 73,74
III EREBP6 Transcription activator. Regulation of gene expression by stress factors Arabidopsis 12
III EREBP4 Involved in the regulation of gene expression by stress factors like jasmonate (JA), cold, drought and salt Arabidopsis, Tobacco 75,77
III EREBP
9,11,12
Transcriptional inhibitor having EAR motif Arabidopsis 79
III EREBP3 Transcriptional repressor, Little expressed in roots and cultured cells Tobacco, rice 80,81
III RAP2.11 Strongly induced by low temperatures in shoot tips Rice 3
IV CBF like Cold tolerance Brassica napus (Rape) 83
IV CBF3 Up regulated in response to low temperature Tomato 84
IV DREB1E Transcriptional activator, play a key role in freezing tolerance and cold acclimation Arabidopsis, rice 6,88
IV DREB1F Transcriptional activator, play a key role in freezing tolerance and cold acclimation Arabidopsis 6,89
IV TINY Transcriptional activator, induced by cold stress Maize 93
IV DREB2F Dehydration and cold Arabidopsis 6
IV DREB1A Transcriptional activator, confers resistance to high cold and drought stress Arabidopsis, Rice, Maize 85–87
IV DREB1F Enhance tolerance to salt, drought and low temperature Rice, Arabidopsis 6,90
IV DREB2 Tolerance to water deficit stress Rice, sun flower 25,82
IV DREB1C Transcriptional activator, mediates high salinity- and dehydration-inducible transcription Arabidopsis, rice 6,88
IV DREB1I Mediates high salinity- and dehydration-inducible transcription Rice 89
IV DREB2A Tolerance to osmotic, salt and dehydration stresses Rice, Arabidopsis 6,91
IV DREB2B Involved in drought and heat-shock stress tolerance Arabidopsis, rice 6,92
IV DREB2C Transcriptional activator, mediates high salinity- and abscisic acid-inducible transcription Arabidopsis, rice 6,92

Abbreviations: ANT, Antigumenta; FHP, Floral homeotic protein; BBM, Baby Boom; WRL1, Wrinkled1; TSRF1, Tomato stress responsive factor1.

Table S3.

Full length cDNA ascertained with respect to intron, exon size distribution.

Generic name MSU (LOC_OS ID) Average gene length Average exon length No. of introns
OsAP2/ERF#022 LOC_Os02g51300.1 1284.0 160.5 7
OsAP2/ERF#153 LOC_Os09g25600.1 792.0 198.0 3
OsAP2/ERF#068 LOC_Os08g07440.1 828.0 118.3 6
OsAP2/ERF#052 LOC_Os05g45954.1 1350.0 270.0 4
OsAP2/ERF#099 LOC_Os06g05340.1 1200.0 200.0 5
OsAP2/ERF#109 LOC_Os08g34360.1 867.0 216.8 3
OsAP2/ERF#079 LOC_Os01g59780.1 825.0 275.0 2
OsAP2/ERF#155 LOC_Os12g03290.1 1332.0 222.0 5
OsAP2/ERF#131 LOC_Os11g03540.1 1350.0 225.0 5
OsAP2/ERF#049 LOC_Os05g32270.1 913.0 152.2 5
OsAP2/ERF#044 LOC_Os04g55970.1 828.0 207.0 3
OsAP2/ERF#086 LOC_Os03g19900.1 1473.0 163.7 8
OsAP2/ERF#088 LOC_Os03g56050.1 2086.0 260.8 7
OsAP2/ERF#141 LOC_Os07g03250.1 945.0 189.0 4
OsAP2/ERF#137 LOC_Os03g12950.1 973.0 324.3 2
OsAP2/ERF#026 LOC_Os03g07940.1 1242.0 177.4 6
OsAP2/ERF#118 LOC_Os11g19060.1 1680.0 210.0 7
OsAP2/ERF#005 LOC_Os01g67410.1 2088.0 261.0 7
OsAP2/ERF#060 LOC_Os06g44750.1 792.0 99.0 7
OsAP2/ERF#018 LOC_Os02g40070.1 2103.0 262.9 7
OsAP2/ERF#037 LOC_Os04g42570.1 1977.0 247.1 7
OsAP2/ERF#092 LOC_Os05g28800.1 543.0 181.0 2
OsAP2/ERF#059 LOC_Os06g43220.1 1005.0 111.7 8
OsAP2/ERF#073 LOC_Os07g13170.1 1311.0 131.1 9
OsAP2/ERF#033 LOC_Os03g60430.1 1293.0 129.3 9
OsAP2/ERF#043 LOC_Os04g55560.1 1383.0 138.3 9
OsAP2/ERF#090 LOC_Os05g03040.2 1539.0 192.4 7
OsAP2/ERF#085 LOC_Os03g06920.1 1260.0 420.0 2
OsAP2/ERF#045 LOC_Os04g56150.1 420.0 210.0 1
Over all length 1230.4 205.3
SD 449.3 68.985
Minimum length 781.1 138.4
Maximum length 1679.7 274.79
Base pair used for search of exons on both side of the hit 2000

Table S4.

Synteny between rice and wheat AP2/ERF family genes.

Coded wheat genes Rice genome alignment Rice genes (output homology) Annotation


Chr_Start Chr_End Similarity Chr Rice gene Generic name
95,107 33765994 33766955 0.606 1 LOC_Os01g58420.1 OsAP2/ERF-4 ERF-3
13,16 1745445 1752065 0.616 1 LOC_Os01g04020.1 OsAP2/ERF-1 RAP2.6
40 11783003 11783631 0.746 1 LOC_Os01g21120.1 OsAP2/ERF-3 EREB3
4,19,90,113 3355682 3357394 0.691 1 LOC_Os01g07120.2 OsAP2/ERF-167 DREB2
10,47,81,100 5688636 5689867 0.728 2 LOC_Os02g10760.1 OsAP2/ERF-12 ERF
12,21,60,103 17569037 17575069 0.768 2 LOC_Os02g29550.2 OsAP2/ERF-13 CHP
24,54 31643379 31644457 0.775 2 LOC_Os02g51670.1 OsAP2/ERF-132 DREB2B
52,72,86,111 33194322 33195272 0.814 2 LOC_Os02g54160.1 OsAP2/ERF-84 EREB1
95 3164706 3165049 0.802 2 LOC_Os02g06330.1 OsAP2/ERF-10 ERF2
1,11,17 34351602 34357234 0.717 3 LOC_Os03g60430.2 OsAP2/ERF-33 FHP
3,11,14 6993827 6995351 0.811 3 LOC_Os03g12950.1 OsAP2/ERF-137 BBM
28,39,62,84,91,110 4347196 4349534 0.633 3 LOC_Os03g08470.1 OsAP2/ERF-125 RAP2.6
29,42,76,101 4366392 4367330 0.636 3 LOC_Os03g08490.1 OsAP2/ERF-28 EREBP
4,90,114 21076935 21077459 0.794 4 LOC_Os04g34970.1 OsAP2/ERF-36 ERF
9 27332155 27332997 0.71 4 LOC_Os04g46400.1 OsAP2/ERF-40 DREB1F
9 27354771 27355159 0.792 4 LOC_Os04g46440.1 OsAP2/ERF-42 ERF
16,51,78,85,105 32845591 32846458 0.651 4 LOC_Os04g55520.1 OsAP2/ERF-128 DREB2F
63 19480884 19483547 0.75 4 LOC_Os04g32620.1 OsAP2/ERF-89 ERF
71 10307892 10308114 0.814 4 LOC_Os04g18650.1 OsAP2/ERF-34 TSRF1
55 24381783 24382150 0.698 5 LOC_Os05g41780.1 OsAP2/ERF-51 ERF-2
31,45,61,94 17187004 17187406 0.746 5 LOC_Os05g29810.1 OsAP2/ERF-93 ERFEB2
5,27,34,37 1433939 1434443 0.737 6 LOC_Os06g03670.1 OsAP2/ERF-98 CBF
10,47,81,100 23897673 23900241 0.77 6 LOC_Os06g40150.1 OsAP2/ERF-57 ERF1
19,52,111 4730450 4736020 0.721 6 LOC_Os06g09390.1 OsAP2/ERF-124 ERF3
68,106 6304249 6304712 0.825 6 LOC_Os06g11860.1 OsAP2/ERF-105 CHP
69 3336324 3336716 0.833 6 LOC_Os06g07030.1 OsAP2/ERF-142 RAP2.6
1,11,17 7544758 7548437 0.679 7 LOC_Os07g13170.1 OsAP2/ERF-73 AP2-like
6,7,8 4175116 4177421 0.811 8 LOC_Os08g07440.1 OsAP2/ERF-68 AP2D
56 27322278 27322451 0.782 8 LOC_Os08g43210.1 OsAP2/ERF-161 CRT/DREBF10
67,82,89,99 23351479 23352053 0.729 8 LOC_Os08g36920.1 OsAP2/ERF-152 CHP
109 19545283 19545935 0.739 8 LOC_Os08g31580.1 OsAP2/ERF-170 DREB
22,23,34,58 15960437 15961590 0.701 9 LOC_Os09g26420.1 OsAP2/ERF-64 ERF2
18,25,26,30,43,48,49,59,65,97,106 20394824 20395662 0.693 9 LOC_Os09g35010.1 OsAP2/ERF-169 CRT/DRE-
33,54,77,109 12212469 12217153 0.686 9 LOC_Os09g20350.1 OsAP2/ERF-113 DREBF1
56,57,73,83,93,102,112 20398977 20399625 0.659 9 LOC_Os09g35020.1 OsAP2/ERF-65 CBF3
67,82,89,99 17305377 17308135 0.713 9 LOC_Os09g28440.1 OsAP2/ERF-123 CHP

Table S5.

Synteny between rice and Arabidopsis AP2/ERF family genes.

Arabidopsis genes Generic name Chr Rice genome alignment Rice genes (output homology) Annotation


Chr_Start Chr_End Similarity Chr Rice gene Generic name
AT1G15360.1 AtAP2/EREBP#001 1 24775898 24776037 0.80 6 LOC_Os06g40150.1 OsAP2/EREBP#057 ERF3
AT1G15360.1 AtAP2/EREBP#002 1 5688851 5691552 0.68 2 LOC_Os02g10760.1 OsAP2/EREBP#012 ERF1
AT2G35700.1 AtAP2/EREBP#003 2 27381026 27381177 0.71 2 LOC_Os02g43940.1 OsAP2/EREBP#021 DREB2B
AT5G11590.1 AtAP2/EREBP#004 5 22622513 22622610 0.76 4 LOC_Os04g36640.1 OsAP2/EREBP#087 TINY
AT5G67190.1 AtAP2/EREBP#005 5 33530573 33530696 0.81 4 LOC_Os04g55520.1 OsAP2/EREBP#128 DREB2F
AT3G14230.1 AtAP2/EREBP#006 3 34056887 34056986 0.87 2 LOC_Os02g54160.1 OsAP2/EREBP#084 EREBP1
AT5G44210.1 AtAP2/EREBP#007 5 20013422 20013492 0.78 4 LOC_Os04g32790.1 OsAP2/EREBP#035 EREBP12
AT1G46768.1 AtAP2/EREBP#008 1 27380978 27381083 0.66 2 LOC_Os02g43940.1 OsAP2/EREBP#021 RAP2.1
AT3G54320.3 AtAP2/EREBP#009 3 1369944 1366400 0.724 11 LOC_Os11g03540.1 OsAP2/EREBP#131 WRL1
AT1G25560.1 AtAP2/EREBP#010 1 27240408 27244907 0.63 5 LOC_Os05g47650.1 OsAP2/EREBP#096 RAV
AT1G79700.2 AtAP2/EREBP#011 1 15361747 15367611 0.747 9 LOC_Os09g25600.1 OsAP2/EREBP#153 AP2.1
AT1G68840.1 AtAP2/EREBP#012 1 28619028 28619859 0.654 1 LOC_Os01g49830.1 OsAP2/EREBP#127 RAV
Supplementary File 1

Conserved motifs discovered using the MEME Suite version 4.7.0.

ebo-8-2012-321s1a.tif (1.1MB, tif)
ebo-8-2012-321s1b.tif (1.3MB, tif)
ebo-8-2012-321s1c.tif (1.3MB, tif)

Supplementary File 2.

AP2/ERF family genes in rice.

This study Nakano et al10

Group Generic name MSU (LOC_OS ID) RAP (Os ID) Gene name
Ia AP2/EREBP#022 LOC_Os02g51300.12b Os02g0747600 BBM1
Ia AP2/EREBP#153 LOC_Os09g25600.12b Os09g0423800 AP2-1
Ia AP2/EREBP#068 LOC_Os08g07440.12b Os08g0171100 WRINKLED1
Ia AP2/EREBP#155 LOC_Os12g03290.12b Os12g0126300 AP2-1
Ia AP2/EREBP#131 LOC_Os11g03540.12b Os11g0129700 AP2-1
Ia AP2/EREBP#079 LOC_Os01g59780.12b Os01g0813300
Ia AP2/EREBP#049 LOC_Os05g32270.1 Os05g0389000 AP2-1
Ia AP2/EREBP#109 LOC_Os08g34360.12b Os08g0442400 BBM
Ia AP2/EREBP#052 LOC_Os05g45954.12b Os05g0536250 AP2D4
Ia AP2/EREBP#099 LOC_Os06g05340.12b Os06g0145700
Ib AP2/EREBP#044 LOC_Os04g55970.12b Os04g0653600 ANT
Ib AP2/EREBP#086 LOC_Os03g19900.12b Os03g0313100 ANT
Ib AP2/EREBP#088 LOC_Os03g56050.12b Os03g0770700 ANT
Ib AP2/EREBP#137 LOC_Os03g12950.12b Os03g0232200 BBM
Ib AP2/EREBP#141 LOC_Os07g03250.12b Os07g0124700 PLETHORA
Ib AP2/EREBP#026 LOC_Os03g07940.12b Os03g0176300 WRINKLED1
Ib AP2/EREBP#118 LOC_Os11g19060.12b Os11g0295900 BBM1
Ib AP2/EREBP#005 LOC_Os01g67410.12b Os01g0899800 ERF
Ib AP2/EREBP#060 LOC_Os06g44750.12b Os06g0657500 ANT
Ib AP2/EREBP#018 LOC_Os02g40070.1 Os02g0614300 ANT
Ib AP2/EREBP#037 LOC_Os04g42570.1 Os04g0504500 ERF
Ic AP2/EREBP#092 LOC_Os05g28800.1 Os05g0356201
Ic AP2/EREBP#043 LOC_Os04g55560.12b Os04g0649100 ERF
Ic AP2/EREBP#059 LOC_Os06g43220.12b Os06g0639200 ERF
Ic AP2/EREBP#090 LOC_Os05g03040.22b Os05g0121600 RAP2.7
Ic AP2/EREBP#033 LOC_Os03g60430.12b Os03g0818800 FHP
Ic AP2/EREBP#073 LOC_Os07g13170.12b Os07g0235800 ERF
II AP2/EREBP#085 LOC_Os03g06920.1 Os03g0165200
II AP2/EREBP#077 LOC_Os01g04750.1-B3 Os01g0140700 RAV
II AP2/EREBP#129 LOC_Os01g04800.1-B3 Os01g0141000 RAV
II AP2/EREBP#096 LOC_Os05g47650.1-B3 Os05g0549800 RAV
II AP2/EREBP#127 LOC_Os01g49830.1-B3 Os01g0693400 RAV
IIIa AP2/EREBP#045 LOC_Os04g56150.1 Os04g0655700
IIIa AP2/EREBP#089 LOC_Os04g32620.1 Os04g0398000 ERF Os04g32620
IIIa AP2/EREBP#023 LOC_Os02g55380.1 Os02g0797100 Os02g55380
IIIa AP2/EREBP#012 LOC_Os02g10760.1 Os02g0202000 ERF Os02g10760
IIIa AP2/EREBP#057 LOC_Os06g40150.1 Os06g0604000 ERF1 Os06g40150
IIIa AP2/EREBP#159 LOC_Os12g39330.1 Os12g0582900 RAP2.11 Os12g39330
IIIa AP2/EREBP#075 LOC_Os07g38750.1 Os07g0575000 Os07g38750
IIIa AP2/EREBP#072 LOC_Os07g10410.1 Os07g0204000 Os07g10410
IIIa AP2/EREBP#008 LOC_Os12g41030.1 Os12g0602966 Os12g41030
IIIa AP2/EREBP#009 LOC_Os12g41060.1 Os12g0603300 ERF3 Os12g41060
IIIa AP2/EREBP#122 LOC_Os09g11460.1 Os09g0286600 ERF Os09g11460
IIIa AP2/EREBP#166 LOC_Os09g11480.1 Os09g0287000 EREBP5 Os09g11480
IIIa AP2/EREBP#164 LOC_Os05g25260.1 Os05g0316800 EREBP9 Os05g25260
IIIa AP2/EREBP#032 LOC_Os03g60120.1 Os03g0815800 EREBPP5 Os03g60120
IIIa AP2/EREBP#145 LOC_Os07g12510.1 Os07g0227600 ERF Os07g12510
IIIa AP2/EREBP#134 LOC_Os01g12440.1 Os01g0224100 Os01g12440
IIIa AP2/EREBP#162 LOC_Os01g46870.1 Os01g0657400 EREBP5 Os01g46870
IIIa AP2/EREBP#146 LOC_Os06g06540.1 Os06g0160500 Os06g06540
IIIa AP2/EREBP#058 LOC_Os06g42990.1 Os06g0636000 ANT Os06g42990
IIIa AP2/EREBP#014 LOC_Os02g32040.1 Os02g0520000 Os02g32040
IIIa AP2/EREBP#035 LOC_Os04g32790.1 Os04g0399800 EREBP12 Os04g32790
IIIa AP2/EREBP#069 LOC_Os08g07700.1 Os08g0173700 EREBP4 Os08g07700
IIIa AP2/EREBP#133 LOC_Os07g47330.1 Os07g0669500 BSL Os07g47330
IIIa AP2/EREBP#017 LOC_Os02g38090.1 Os02g0594300 ESR1 Os02g38090
IIIa AP2/EREBP#149 LOC_Os04g52090.1 Os04g0610400 RAP2.6 Os04g52090
IIIa AP2/EREBP#051 LOC_Os05g41780.1 Os05g0497300 ERF2 Os05g41780
IIIa AP2/EREBP#004 LOC_Os01g58420.1 Os01g0797600 ERF3 Os01g58420
IIIa AP2/EREBP#165 LOC_Os05g41760.1 Os05g0497200 EREBP11 Os05g41760
IIIa AP2/EREBP#046 LOC_Os04g57340.1 Os04g0669200 ERF2 Os04g57340
IIIa AP2/EREBP#011 LOC_Os02g09650.1 Os02g0189600 ERF2 Os02g09650
IIIa AP2/EREBP#061 LOC_Os06g47590.1 Os06g0691100 ERF Os06g47590
IIIa AP2/EREBP#010 LOC_Os02g06330.1 Os02g0158000 ERF2 Os02g06330
IIIb AP2/EREBP#151 LOC_Os05g37640.1 Os05g0448700 Os05g37640
IIIb AP2/EREBP#062 LOC_Os05g37640.1 Os05g0448675 ERF
IIIb AP2/EREBP#067 LOC_Os09g39850.1 Os09g0572000 ERF Os09g39850
IIIb AP2/EREBP#106 LOC_Os07g22730.1 Os07g0410300 ERF Os07g22730
IIIb AP2/EREBP#074 LOC_Os07g22770.1 Os07g0410700 EREBP1 Os07g22770
IIIb AP2/EREBP#163 LOC_Os03g64260.1 Os03g0860100 EREBP2 Os03g64260
IIIb AP2/EREBP#097 LOC_Os05g49010.1 Os05g0564700 Os05g49010
IIIb AP2/EREBP#168 LOC_Os04g46220.1 Os04g0546800 ERF Os04g46220
IIIb AP2/EREBP#147 LOC_Os02g43790.1 Os02g0654700 EREBP5 Os02g43790
IIIb AP2/EREBP#034 LOC_Os04g18650.1 Os04g0257500 TSRF1 Os04g18650
IIIb AP2/EREBP#024 LOC_Os03g05590.1 Os03g0150200 EREBP5 Os03g05590
IIIb AP2/EREBP#154 LOC_Os10g30840.1 Os10g0445100 Os10g30840
IIIb AP2/EREBP#066 LOC_Os09g39810.1 Os09g0571700 Os09g39810
IIIb AP2/EREBP#071 LOC_Os08g44960.1 Os08g0563600 ERF Os08g44960
IIIb AP2/EREBP#078 LOC_Os01g54890.1 Os01g0752500 EREBP6 Os01g54890
IIIb AP2/EREBP#116 LOC_Os10g41330.1 Os10g0562900 ERF Os10g41330
IIIb AP2/EREBP#020 LOC_Os02g43820.1 Os02g0655200 ERF3 Os02g43820
IIIb AP2/EREBP#038 LOC_Os04g46240.1 Os04g0547500 Os04g46240
IIIb AP2/EREBP#039 LOC_Os04g46250.1 Os04g0547600 ERF Os04g46250
IIIb AP2/EREBP#027 LOC_Os03g08460.1 Os03g0182800 ERF3 Os03g08460
IIIb AP2/EREBP#030 LOC_Os03g22170.1 Os03g0341000 RAP2.2 Os03g22170
IIIb AP2/EREBP#076 LOC_Os07g47790.1 Os07g0674800 EREBP Os07g47790
IIIb AP2/EREBP#003 LOC_Os01g21120.1 Os01g0313300 EREBP3 Os01g21120
IIIb AP2/EREBP#093 LOC_Os05g29810.1 Os05g0361700 EREBP2 Os05g29810
IIIb AP2/EREBP#125 LOC-Os03g08470.1 Os03g0183000 RAP2.6 Os03g08470
IIIb AP2/EREBP#107 LOC_Os07g42510.1 Os07g0617000 ERF2 Os07g42510
IIIb AP2/EREBP#064 LOC_Os09g26420.1 Os09g0434500 ERF2 Os09g26420
IIIb AP2/EREBP#124 LOC_Os06g09390.1 Os06g0194000 ERF3 Os06g09390
IIIb AP2/EREBP#084 LOC_Os02g54160.1 Os02g0782700 EREBP1 Os02g54160
IIIb AP2/EREBP#029 LOC_Os03g08500.1 Os03g0183300 CHP Os03g08500
IIIb AP2/EREBP#028 LOC_Os03g08490.1 Os03g0183200 CHP Os03g08490
IIIb AP2/EREBP#006 LOC_Os10g25170.1 Os10g0390800 EREBP3 Os10g25170
IIIc AP2/EREBP#063 LOC_Os09g13940.1 Os09g0309700 TINY Os09g13940
IIIc AP2/EREBP#108 LOC_Os08g27220.1 Os08g0360800 Os08g27220
IIIc AP2/EREBP#110 LOC_Os08g41030.1 Os08g0521600 ERF Os08g41030
IIIc AP2/EREBP#015 LOC_Os02g32140.1 Os02g0521100 Os02g32140
IIIc AP2/EREBP#001 LOC_Os01g04020.1 Os01g0131600 RAP2.6 Os01g04020
IIIc AP2/EREBP#111 LOC_Os08g42550.1 Os08g0537900 ERF3 Os08g42550
IIIc AP2/EREBP#152 LOC_Os08g36920.1 Os08g0474000 RAP2.6 Os08g36920
IIIc AP2/EREBP#123 LOC_Os09g28440.1 Os09g0457900 EREBPP LIKE Os09g28440
IIIc AP2/EREBP#130 LOC_Os02g52670.1 Os02g0764700 EREBP4 Os02g52670
IIIc AP2/EREBP#036 LOC_Os04g34970.1 Os04g0429050 Os04g34970
IIIc AP2/EREBP#120 LOC_Os02g34260.1 Os02g0546600 ERF Os02g34260
IIIc AP2/EREBP#016 LOC_Os02g34270.1 Os02g0546800 ERF Os02g34270
IIIc AP2/EREBP#117 LOC_Os11g06770.1 Os110168500 RAP2.6 Os11g06770
IIIc AP2/EREBP#158 LOC_Os12g07030.1 Os12g0168100 RAP2.6 Os12g07030
IIIc AP2/EREBP#080 LOC_Os01g64790.1 Os01g0868000 ERF Os01g64790
IIIc AP2/EREBP#050 LOC_Os05g36100.1 Os05g36100 ERF Os05g36100
IV-a AP2/EREBP#053 LOC_Os05g49700.1 Os05g0572000 CHP Os05g49700
IV-a AP2/EREBP#170 LOC_Os08g31580.1 Os08g0408500 ERF Os08g31580
IV-a AP2/EREBP#113 LOC_Os09g20350.1 Os09g0369000 DREBF1 Os09g20350
IV-a AP2/EREBP#019 LOC_Os02g42585.1 Os02g0638650 ERF
IVa AP2/EREBP#047 AP004768.3 AP004768.3
IV-a AP2/EREBP#119 LOC_Os04g44670.1 Os04g0529100 ERF Os04g44670
IV-a AP2/EREBP#156 LOC_Os10g22600.1 Os10g0371100 ERF Os10g22600
IV-a AP2/EREBP#121 LOC_Os03g09170.1 Os03g0191900 ERF Os03g09170
IV-a AP2/EREBP#103 LOC_Os06g09810.1 Os06g0198400 Os06g09810
IV-a AP2/EREBP#132 LOC_Os02g51670.1 Os02g0752800 DREB2B Os02g51670
IV-b AP2/EREBP#150 LOC_Os05g28350.1 Os05g0351200 ERF Os05g28350
IV-b AP2/EREBP#095 LOC_Os05g39590.1 Os05g0473300 ERF1 Os05g39590
IV-b AP2/EREBP#025 LOC_Os03g07830.1 Os03g0174400 CHP Os03g07830
IV-b AP2/EREBP#112 LOC_Os08g45110.1 Os08g0565200 ERF Os08g45110
IV-b AP2/EREBP#167 LOC_Os01g07120.1 Os01g0165000 DREB2 Os01g07120
IV-b AP2/EREBP#048 LOC_Os05g27930.1 Os05g0346200 DRE Os05g27930
IV-c AP2/EREBP#094 LOC_Os05g34730.1 Os05g0420300 Os05g34730
IVc AP2/EREBP#091 LOC_Os01g66270.1 Os01g0885900 Os01g66270
IV-c AP2/EREBP#128 LOC_Os04g55520.1 Os04g0648900 DREB2F Os04g55520
IV-c AP2/EREBP#142 LOC_Os06g07030.1 Os06g0166400 TINY Os06g07030
IV-c AP2/EREBP#102 LOC_Os06g09790.1 Os06g0198200 CBF LIKE Os06g09790
IV-c AP2/EREBP#139 ------- Os02g0767800
IV-c AP2/EREBP#135 LOC_Os03g15660.1 Os03g0263000 TINY Os03g15660
IV-c AP2/EREBP#070 LOC_Os08g35240.1 Os08g0454000 Os08g35240
IV-c AP2/EREBP#144 LOC_Os04g48330.1 Os04g0572200 ERF027
IV-c AP2/EREBP#143 LOC_Os06g11940.1 Os06g0223100 DREB Os06g11940
IV-c AP2/EREBP#104 LOC_Os06g10780.1 Os06g0210300 ERF Os06g10780
IV-c AP2/EREBP#083 LOC_Os02g54050.1 Os02g0781300 Os02g54050
IV-c AP2/EREBP#100 LOC_Os06g08340.1 Os06g0181700 ERF Os06g08340
IV-c AP2/EREBP#055 LOC_Os06g09760.1 Os06g197900 Os06g09760
IVc AP2/EREBP#031 AP006056 ------ AP006056
IV-c AP2/EREBP#101 LOC_Os06g09717.1 Os06g0197200
IV-d AP2/EREBP#042 LOC_Os04g46440.1 Os04g0550200 Os04g46440
IV-d AP2/EREBP#041 LOC_Os04g46410.1 Os04g0549800 DREB1C Os04g46410
IV-d AP2/EREBP#148 LOC_Os02g43970.1 Os02g0657000 RAP211 Os02g43970
IV-d AP2/EREBP#007 LOC_Os10g41130.1 Os10g0560700 TINY Os10g41130
IV-d AP2/EREBP#021 LOC_Os02g43940.1 Os02g0656600 DREB2B Os02g43940
IV-d AP2/EREBP#040 LOC_Os04g46400.1 Os04g0549700 DREB1F Os04g46400
IV-d AP2/EREBP#002 LOC_Os01g10370.1 Os01g0200600 Os01g10370
IV-d AP2/EREBP#082 LOC_Os02g13710.1 Os02g0231000 TINY Os02g13710
IV-d AP2/EREBP#056 LOC_Os06g36000.1 Os06g0553700 Os06g36000
IV-d AP2/EREBP#105 LOC_Os06g11860.1 Os06g0222400 CHP Os06g11860
IV-d AP2/EREBP#157 LOC_Os11g13840.1 Os11g0242300 Os11g13840
IV-d AP2/EREBP#087 LOC_Os04g36640.1 Os04g0443800 DREB Os04g36640
IV-d AP2/EREBP#140 LOC_Os02g35240.1 Os02g0558700 DREB Os02g35240
IV-d AP2/EREBP#126 LOC_Os02g45420.1 Os02g0676800 DREB1E Os02g45420
IV-d AP2/EREBP#115 LOC_Os10g38000.1 Os10g0523900 DREB Os10g38000
IV-d AP2/EREBP#136 LOC_Os03g02650.1 Os03g0117900
IV-d AP2/EREBP#081 LOC_Os01g73770.1 Os01g0968800 DREB1F Os01g73770
IV-d AP2/EREBP#138 LOC_Os02g45450.1 Os02g0677300 CRT/DREB1 Os02g45450
IV-d AP2/EREBP#160 LOC_Os04g48350.1 Os04g0572400 CRT/DREB1 Os04g48350
IV-d AP2/EREBP#098 LOC_Os06g03670.1 Os06g0127100 CBF Os06g03670
IV-d AP2/EREBP#169 LOC_Os09g35010.1 Os09g0522000 CBF
IV-d AP2/EREBP#161 LOC_Os08g43210.1 Os08g0545500 DREB1I Os08g43210
IV-d AP2/EREBP#065 LOC_Os09g35020.1 Os09g0522100 CBF3 Os09g35020
IV-d AP2/EREBP#114 LOC_Os09g35030.1 Os09g0522200 DREB1A Os09g35030
Soloist AP2/EREBP#054 LOC_Os06g06970.1 Os06g0165600 CRT/DRE
AP2/EREBP#013 LOC_Os02g29550.1 Os02g0499000 CHP
Total = 170

Note:

**

The OS RAP (ID) number is mentioned because OsAP2/ERF#139 does not have the MSU locus identifier.

ebo-8-2012-321s2.tif (748.4KB, tif)

Articles from Evolutionary Bioinformatics Online are provided here courtesy of SAGE Publications

RESOURCES