Official websites use .gov
A
.gov website belongs to an official
government organization in the United States.
Secure .gov websites use HTTPS
A lock (
) or https:// means you've safely
connected to the .gov website. Share sensitive
information only on official, secure websites.
PAR1 peptide fragments generated by APC or thrombin proteolysis
| Fragment | Retention time, min | Cleaved by | Exp mass, Da | Calculated mass, Da | PAR1 peptide (33-62) | Cleavage site |
|---|---|---|---|---|---|---|
| A | 8.2 | IIa/APC | 1001 | 1000 | ATNATLDPR-41 | R41 |
| B | 9.7 | APC | 635 | 635 | 42-SFLLR-46 | R46 |
| C | 11.0 | APC | 2053 | 2053 | 47-NPNDKYEPFWEDEEKN | R46 |
| D | 12.6 | IIa/APC | 2670 | 2670 | 42-SFLLRNPNDKYEPFWEDEEKN | R41 |
| E | 13.8 | — | 3651 | 3652 | ATNATLDPRSFLLRNPNDKYEPFWEDEEKN | — |
— indicates not applicable.
