Divalent Heavy Metal Cations Block the TRPV1 Ca²⁺ Channel

Abstract

Transient receptor potential vanilloid 1 (TRPV1) is a non-selective cation channel involved in pain sensation and in a wide range of non-pain-related physiological and pathological conditions. The aim of the present study was to explore the effects of selected heavy metal cations on the function of TRPV1. The cations ranked in the following sequence of pore-blocking activity: Co²⁺ [half-maximal inhibitory concentration (IC₅₀) = 13 μM] > Cd²⁺ (IC₅₀ = 38 μM) > Ni²⁺ (IC₅₀ = 62 μM) > Cu²⁺ (IC₅₀ = 200 μM). Zn²⁺ proved to be a weak (IC₅₀ = 27 μM) and only partial inhibitor of the channel function, whereas Mg²⁺, Mn²⁺ and La³⁺ did not exhibit any substantial effect. Co²⁺, the most potent channel blocker, was able not only to compete with Ca²⁺ but also to pass with it through the open channel of TRPV1. In response to heat activation or vanilloid treatment, Co²⁺ accumulation was verified in TRPV1-transfected cell lines and in the TRPV1+ dorsal root ganglion neurons. The inhibitory effect was also demonstrated in vivo. Co²⁺ applied together with vanilloid agonists attenuated the nocifensive eye wipe response in mice. Different rat TRPV1 pore point mutants (Y627W, N628W, D646N and E651W) were created that can validate the binding site of previously used channel blockers in agonist-evoked ⁴⁵Ca²⁺ influx assays in cells expressing TRPV1. The IC₅₀ of Co²⁺ on these point mutants were determined to be reasonably comparable to those on the wild type, which suggests that divalent cations passing through the TRPV1 channel use the same negatively charged amino acids as Ca²⁺.

Introduction

Small-diameter sensory neurons in the peripheral nervous system (PNS) express the transient receptor potential/vanilloid receptor subtype 1 (TRPV1). Four identical subunits of this protein form a functional Ca²⁺ channel. Similarly to other transient receptor potential channel members, the TRPV1 channel belongs in the large superfamily of cation channels with six transmembrane (TM) segments. Following agonist-induced channel opening, a pore loop between segments TM5 and TM6 serves as a cation filter and entry site [1].

When endovanilloids are produced under various inflammatory conditions around the C and Aδ afferents of these PNS neurons, TRPV1 transmits a specific pain sensation to the brain [2–4]. Besides endovanilloids such as anandamide [5, 6], TRPV1 is activated by acids (pH < 6.3) and chemo-irritants such as the exovanilloid capsaicin (CAPS) or resiniferatoxin, a naturally occurring, ultrapotent CAPS analogue with excellent specificity for TRPV1 [2, 7–9]. Moreover, TRPV1 can integrate the effects of heat and vanilloids. The heat-sensing domain has been mapped to the C-terminal intracellular region [3, 9, 10].

The vanilloid binding site is localized between segments TM3 and TM4 of TRPV1 [5]. The pain signal, however, is generated by opening of the Ca²⁺ channel situated between domains TM5 and TM6 of four identical subunits [11, 12]. An acidic peptide motif in the pore loop region of TRPV1 (DXEXXEXXD) may serve as a docking site for positively charged ions and channel blockers [13]. However, our sequence comparison and previous in silico model-building efforts have not revealed any obvious homology to other divalent metal ion (M²⁺)-binding structures such as the EF-hand (DXDXDGXXDXXE) or the Excalibur (DXDXDXXXCE) [13].

Various studies have demonstrated that positively charged molecules can act as TRPV1 receptor channel blockers by plugging the pore. Ruthenium Red (RuRed) (a well-known, but non-specific TRPV1 pore blocker) [11], R₄W₂ (a positively charged hexapeptide) [14] and anti-calmodulins/antipsychotic tricyclics [13] have been shown to be able to bind to the DXEXXEXXD domain of TRPV1, whereby they block the movement of Ca²⁺ through the pore region.

We set out to assess the effects of various metal cations at different concentrations on the vanilloid -or heat-induced activity of the TRPV1 channel, focusing on the investigation of the most potent cations in vitro and in vivo. Moreover, in our experiments we aimed to shed light on the characteristics of the gating of the TRPV1 channel in order to improve the understanding of the structure and function of the TRPV1 pore region, which may lead to the development of potentially useful painkiller drugs that modulate the activity of this receptor.

Materials and Methods

Reagents

Stock solutions (200 mM) of CoCl₂, NiCl₂, ZnSO₄, CdCl₂, CuSO₄, CaCl₂, CoCl₂ and LaCl₃ were dissolved in water and diluted as required to the working concentrations. To avoid the precipitation of insoluble La(OH)₃ and La(CO₃)₃, the formation of radiocolloids and the loss of La³⁺ by adsorption to container surfaces, LaCl₃ solution was prepared fresh daily in polyethylene vials [15]. RuRed and capsazepine (CapZ; Sigma-Aldrich, St. Louis, MO) were dissolved in DMSO. CAPS was dissolved initially as a stock solution of 3 mM in 95 % ethanol. The peptide R₄W₂ was synthetized in our laboratories and then dissolved in water and used as a 25 mM stock solution. Amitriptyline (AMI), purchased from Sigma-Aldrich, was dissolved in water.

Plasmids

The C-terminally epsilon-tagged rat TRPV1ε plasmid construct was prepared in the metallothionein (pMTH) plasmid vector as described earlier [9]. To avoid cell loss through the Ca²⁺-excytotoxic mechanism that occurs when TRPV1 is overexpressed at 37 °C, only the basal activity of the pMTH promoter was used. The protein kinase C ε epitope tag allowed immunological detection of the TRPV1ε protein, as earlier described [16]. Mutants Y627W, N628W, D646N and E651W were kindly given by Dr. K. J. Swartz (National Institutes of Health, Bethesda, MD 20892, USA) [17] and subcloned into an EF-promoter-driven green fluorescent protein (EGFP)-tagging plasmid vector. The EGFP tag was used for visual determination of the transfection rate by flow cytofluorometry with a FACSCalibur instrument (Becton Dickinson, San Jose, CA, USA).

Cell Lines Expressing TRPV1 Ectopically

The HaCaT keratinocyte cell line was a kind gift of Prof. B. Farkas (Department of Dermatology, University of Cologne, Federal Republic of Germany) [18]. The COS-7 (CRL-1651) and BALB/c-3T3 (CCL-163) cell lines were obtained from ATCC. The 3T3 and HaCaT cell lines permanently expressing the rat TRPV1 channel were prepared as described earlier [19]. COS7 cells were transiently transfected with plasmid containing the sequence of the Y627W, N628W, D646N or E651W TRPV1 mutants or the wild-type TRPV1 channel, by using the Fugene transfection reagent (Roche, Mannheim, Germany). The transfection efficacy was determined by flow cytofluorometry.

Primary Dorsal Root Ganglion Cultures

Were prepared from E16 embryonic rats as reported earlier [9]. Briefly, dorsal root ganglions (DRGs) were dissected and then processed in Hank’s balanced salt buffer until plated in Dulbecco’s Modified Eagle Medium (DMEM). The DMEM contained 20 mM HEPES, pH 7.4, 7.5 % foetal bovine serum, 7.5 % horse serum, 5 mg/ml uridine supplemented with 2 mg/ml 5-fluoro-2′-deoxyuridine and 40 ng/ml nerve growth factor to inhibit cell division and to promote the differentiation of long neuronal processes, respectively. Cells were seeded on 25 mm glass coverslips.

Cobalt Histochemistry

Rat DRG cells attached to the coverslips were washed in buffer A (in millimolars: NaCl, 57.5; KCl, 5; MgCl₂, 2; HEPES, 10; glucose, 12; sucrose, 139; pH 7.4) for 2 min, and then incubated at 37 °C for 10 min in Co²⁺-uptake solution (buffer A + 5 mM CoCl₂) containing 20 μM CAPS. High (20 μM) capsaicin concentration is used in order to obtain a robust and easily detectable Co²⁺ signal. Following a brief wash in buffer A, the water-soluble Co²⁺ taken up by the cells was precipitated with 0.12 % ammonium polysulphide (Sigma-Aldrich) in buffer A, which resulted in the formation of dark, water-insoluble CoS in TRPV1+ cells. Cells were fixed in 4 % formaldehyde and mounted on glass slides, using Kaiser’s glycerol gelatine (Merck, Darmstadt, FRG). Cells were examined under a Nikon light microscope (Melville, NY, USA) and photographed with a SPOT RT-SE™ Digital Camera (Diagnostic Instruments). Pictures of the cells were analysed by means of ImageJ 1.45 s software (National Institutes of Health, USA), and the subsequent statistical analyses were performed with PRISM™ 3.01 software (GraphPad Software, Inc. San Diego, CA, USA).

Vanilloid-Induced ⁴⁵Ca²⁺ Uptake

Vanilloid-induced ⁴⁵Ca²⁺ transport was assayed in the HaCaT adherent cell lines ectopically expressing the C-terminally ε-tagged rat TRPV1 (3 × 10⁴ cells/well) and Cos7 cells transiently transfected with rat TRPV1 mutants, seeded in poly-d lysine-coated 96-well plates. Immediately before the transport assay, the cells were washed three times with physiological saline solution at room temperature (20–25 °C). We had previously found that TRPV1-transformed cells functioned in the same manner at room temperature as at 30 °C (data not shown). ⁴⁵Ca²⁺ uptake was performed for 10 min with 0.1 μCi ⁴⁵Ca²⁺ as radioactive tracer in a final volume of 100 μl (1.8 μM). CAPS was diluted from a 3 mM ethanol stock solution to the indicated final concentrations. For the termination of ⁴⁵Ca²⁺ uptake, cells were rapidly washed four additional times with 0.2 ml PBS solution, and then lysed in 80 μl/well RIPA buffer (50 mM Tris–HCl, pH 7.5, 150 mM NaCl, 1 % Triton X-100, 0.5 % deoxycholate, 0.1 % SDS and 5 mM EDTA) for 30 min [8, 9, 20, 21]. Aliquots of the solubilised cell extracts were mixed with 120 μl SuperMiX and counted in a 96-well plate liquid scintillation counter (TopCount-NXT, Packard). To measure the effect of temperature on the TRPV1 function in the ⁴⁵Ca²⁺-uptake assay, TRPV1/HaCaT cells were plated on six-well plates. ⁴⁵Ca²⁺ uptake was evoked with 10 ml preheated buffer. The procedure was followed as described above.

After the measurement, the data were corrected for the basal activity of TRPV1 and normalized from zero to one, where zero denotes the counts per minute in TRPV1/HaCaT cells without CAPS and one denotes the counts per minute in TRPV1/HaCaT cells with CAPS. The results of three parallel measurements were averaged and evaluated with PRISM™ 3.01 software (GraphPad Software, Inc. San Diego, CA, USA). During curve fitting, the “Analyze/Nonlinear regression (curve fit)/Sigmoidal dose–response” menu of PRISM™ software was applied. The curve-fitting equation was: Y = Y _min + (Y _max − Y _min)/(1 + 10^(logEC50-X)), where X = logarithm of concentration and Y = the response.

Eye Wipe Tests

Eye wipe tests were performed on CD1 mice. A 100 μM CAPS solution, or a solution containing 100 μM CAPS and 1 mM CoCl₂, or a solution containing 100 μM CAPS and 5 μM CapZ was dropped into the eye, and the number of defensive wiping movements was then counted.

Statistical Analysis

One-way ANOVA followed by Turkey’s post-tests was performed with GraphPad Prism version 3.01 software (GraphPad Software, Inc. San Diego, CA, USA).

Results

In the ⁴⁵Ca²⁺ uptake assay, the EC₅₀ of CAPS for wild-type TRPV1 was determined to be 0.0860 μM. Approximately 1 μM CAPS caused the full activation (EC₁₀₀) of TRPV1 at pH 7.5. Channel blocker-screening assays were therefore carried out with 2 μM CAPS (an excess amount of agonist), which does not cause Ca²⁺ cytotoxicity during the 10-min incubation period. The interactions of the metal ions with TRPV1 were studied by using a vanilloid-induced ⁴⁵Ca²⁺-uptake assay. Experiments were carried out on the TRPV1/HaCaT permanent indicator cell line. Channel opening was induced by CAPS in the presence of progressively increasing M²⁺ concentrations in the uptake solution. Incubation of the cells in uptake solutions containing both ⁴⁵Ca²⁺ and Mg²⁺, Mn²⁺ or La³⁺ (data not shown) resulted in little or no effect, even at the highest concentration (4 mM), whereas Zn²⁺ proved to be a weak [half-maximal inhibitory concentrations (IC₅₀) = 27 μM] and only partial inhibitor of the 2 μM CAPS-induced ⁴⁵Ca²⁺ uptake. The other cations effectively blocked the vanilloid-induced Ca²⁺ entry into TRPV1/HaCaT cells, with the following sequence of potency: Co²⁺ (IC₅₀ = 13 μM) > Cd²⁺ (IC₅₀ = 38 μM) > Ni²⁺ (IC₅₀ = 62 μM) > Cu²⁺ (IC₅₀ = 200 μM; Fig. 1a).

Fig. 1.

Ranking divalent cations as channel blockers in cell-based assays. a Efficacy of M²⁺ inhibitors of TRPV1 ranked by vanilloid-induced ⁴⁵Ca²⁺ uptake. b Co²⁺ inhibits heat-induced Ca²⁺ uptake at 37 °C and at 42 °C. c RuRed, R₄W₂ and AMI, previously validated selective channel blockers of TRPV1, were also tested for better comparison of inhibitors. Data are mean values ± standard deviation (SD) of the results of three independent experiments. Statistical significance was assessed by post hoc LSD t tests after significant one-way analysis of variance (ANOVA). P < 0.05

To assess the effect of Co²⁺, the most potent TRPV1 inhibitor, on the heat-activated TRPV1 channels, the activity of TRPV1 was investigated in the presence either of 2 μM CAPS alone or of 2 μM CAPS + 250 μM Co²⁺, at both 37 and 42 °C. The negative control did not contain CAPS. In this assay, high temperature activated the TRPV1 channels and also increased the CAPS-evoked ⁴⁵Ca²⁺ influx. Co²⁺ reduced both the heat and CAPS-induced ⁴⁵Ca²⁺ influx (Fig. 1b).

To compare the potency of Co²⁺ with those of the other positively charged channel blockers, we measured the IC₅₀ values of RuRed, AMI and R₄W₂, which are known to have a docking site in the pore loop of TRPV1. The inhibitor potentials of these pore blockers were measured via the CAPS-induced ⁴⁵Ca²⁺ uptake. All of them inhibited CAPS-activated TRPV1, with the following IC₅₀ values: RuRed = 1 μM, AMI = 20 μM and R₄W₂ = 100 μM (Fig. 1c).

For a better understanding of the inhibition kinetics of Co²⁺ on TRPV1, increasing concentrations of both Co²⁺ and CAPS were applied in the vanilloid-induced ⁴⁵Ca²⁺-uptake assays. The Ca²⁺ uptake of TRPV1/HaCaT cells was inhibited by the simultaneous presence of Co²⁺ in a dose-dependent manner. However, increasing concentrations of Co²⁺ decreased only the maximal response of efficacy (E _max) of Ca²⁺ entry; the affinity of CAPS for TRPV1 did not change. The inflection point in the CAPS dose–response curves in each of the Co²⁺ co-incubation studies was found at ∼0.08 μM (i.e. EC₅₀), independently of the Co²⁺ concentration. The Co²⁺ inhibition patterns unequivocally indicated channel blocking kinetics (Fig. 2a).

Fig. 2.

Co²⁺ inhibits Ca²⁺ entry through the TRPV1 channel. a Kinetics of inhibition of Ca²⁺ transport by Co²⁺ in TRPV1+ cells. Data are mean values ± SD of the results of three independent experiments. b Kinetics of competition between Co²⁺ and cold Ca²⁺ in TRPV1+ cells. c Co²⁺ blockage at different CAPS concentrations. Representative data are shown from independent experiments repeated at least three times. d IC₅₀ values as a function of CAPS concentrations. IC₅₀ values of Co²⁺ in the presence of 0.0625, 0.125, 0.25, 0.5, 1, 2 or 4 μM CAPS are 94.81, 57.97, 73.17, 32.6, 19.22, 22.55 and 15.62 μM, respectively

By varying the concentrations of Co²⁺ and Ca²⁺ and measuring the radioactive ⁴⁵Ca²⁺ influx, we assessed whether there was a competition between Co²⁺ and Ca²⁺. The effect of dilution on the amount of accumulated ⁴⁵Ca²⁺ did not appear at extracellular cold Ca²⁺ concentrations below 1 mM (Fig. 1a), indicating that TRPV1+ cells accumulate Ca²⁺ very effectively from the extracellular space and collect them putatively into ER or mitochondria. Increasing cold Ca²⁺ concentration decreased the inhibitory effect of Co²⁺ (IC₅₀ values in the presence of 0, 15.625, 31.25, 62.5 and 125 μM cold Ca²⁺: 7.944, 51.22, 72.69, 79.09 and 189.1 μM, respectively), showing that the effect of Co²⁺ on Ca²⁺ entry mainly depends on the competition for entry sites. These results suggest that the Co²⁺ entry through the TRPV1 channel is slower, and the Co²⁺ displacing the Ca²⁺ from the pore region of TRPV1 slows down or inhibits the Ca²⁺ uptake (Fig. 2b).

The prolonged agonist stimulation of TRPV1 has been reported to result in an increased permeability to larger cations [22] or small molecules [23], due to conformational changes in the open state of the TRPV1. Thus, we analysed the kinetics of the channel-blocking activity of Co²⁺ by employing different CAPS concentrations. An anticipated shift in the IC₅₀ of Co²⁺ would be evidence supporting the idea that Co²⁺ entry depends on the TRPV1 open stages. We indeed observed a shift in the IC₅₀ of Co²⁺, which decreased with increasing CAPS concentration (Fig. 2c). Consequently, increasing agonist concentration enhances the blocking ability of Co²⁺. To investigate this phenomenon, we plotted the IC₅₀ values as a function of CAPS concentration. Curve-fitting analysis confirmed a strong interrelationship between IC₅₀ and the CAPS dose applied (Fig. 2d), suggesting that the increased efficiency of inhibition correlates with the different open-state conformations of the TRPV1 channel.

We traced Co²⁺ upon vanilloid induction in sensory neuron cultures prepared from DRGs of rat embryos. To test Co²⁺-accumulation patterns, cells were co-incubated with 20 μM CAPS in Co²⁺-containing Ca²⁺-uptake medium, and the Co²⁺ was then localized by means of NH₄S histochemistry. These experiments revealed that Co²⁺ not only competes with Ca²⁺ but also enters into the cytosol of specific PNS sensory neurons. Functionally responsive vanilloid-sensitive neurons (i.e. TRPV1⁺) exhibited dark-brown Co²⁺ precipitates inside the rounded neuronal bodies (Fig. 3e). As expected from previous studies, TRPV1 is endogenously expressed in approximately one third of the cultured neurons [24–27]. Without CAPS, no intracellular Co²⁺ accumulation was observed (data not shown). Similar experiments were carried out on rTRPV1/HaCaT and rTRPV1/3T3 cell lines. The accumulation of Co²⁺ was blocked by RuRed, a channel blocker of heat and vanilloid pain signalling. Moreover, the dose-dependent inhibition of the cellular entry of Co²⁺ was determined by the co-application of 5 μM CapZ, a long-known competitive antagonist of pungent vanilloids. After analysis of the photographs of the cells with the ImageJ program, statistical analysis of the data further confirmed our findings: the mean gray values of CAPS-exposed, CAPS-free and CapZ-exposed cells proved to be significantly different (CAPS without Co²⁺, 72.05 ± 12.38 (S.D.), n = 146; CAPS + Co²⁺, 124.4 ± 21.51 (S.D.), n = 111; CAPS + Co²⁺ + CapZ, 76.92 ± 22.21 (S.D.), n = 100; P values of the t tests: CAPS without Co²⁺ vs. CAPS + Co²⁺, P < 0.0001; CAPS + Co²⁺ vs. CAPS + Co²⁺ + CapZ, P < 0.0001; CAPS without Co²⁺ vs. CAPS + Co²⁺ + CapZ, P = 0.0290; Fig. 3). The gray values were measured on the negatives of the images: the darker the cells, the higher the gray values. Analysis of the pictures in Fig. 4, showing TRPV1-expressing HaCaT cells, resulted in the same outcome. Following ANOVA, the groups were compared by using t tests. Each t test except that involving CAPS without Co²⁺ vs. CAPS + Co²⁺ + 100 μM CapZ indicated a significant difference between the pairs of groups (P < 0.05; Fig. 4). No substantial staining could be observed on 3T3 cells (Fig. 5a–e). Statistical analysis of the gray values of the cells indicated no significant darkening in the absence of TRPV1 in the cell membrane.

Fig. 3.

Co²⁺ histochemistry on the 3T3 cell line expressing TRPV1 ectopically. Cells were incubated for 10 min in buffer A containing a 20 μM CAPS + 5 mM Co²⁺; b 20 μM CAPS + 5 mM Co²⁺ + 5 μM CapZ; c 5 mM Co²⁺ without CAPS. The dark CoS precipitate indicates the presence of intracellular Co²⁺ that is blockable with CapZ, a competitive antagonist of pungent vanilloids. d Gray values of the 3T3 cell line expressing TRPV1 measured by means of ImageJ software. e Co²⁺ histochemistry in CAPS-sensitive rat DRG neurons. Scale bar = 0.05 mm. These results confirm that Co²⁺ not only acts as a blocker but also enters the cell with Ca²⁺ through the TRPV1 channel

Fig. 4.

Co²⁺ histochemistry on the HaCaT cell line expressing TRPV1 ectopically. Cells were incubated for 10 min in buffer A containing a 20 μM CAPS + 5 mM Co²⁺; b 5 mM Co²⁺ without CAPS; c 20 μM CAPS + 5 mM Co²⁺ + 300 nM CapZ; d 20 μM CAPS + 5 mM Co²⁺ + 5 μM CapZ; e 20 μM CAPS + 5 mM Co²⁺ + 100 μM CapZ; f 20 μM CAPS + 5 mM Co²⁺ + 500 nM RuRed; g 20 μM CAPS + 5 mM Co²⁺ + 7 μM RuRed; h 20 μM CAPS + 5 mM Co²⁺ + 100 μM RuRed. The dark precipitates indicate the presence of intracellular CoS that is blockable with RuRed, a channel blocker of heat and vanilloid pain signalling. Co-application of CapZ, a competitive antagonist of pungent vanilloids, also inhibited the cellular entry of Co²⁺ in a dose-dependent manner: this is a well-characterized evidence-based method of localization of intracellular Co²⁺. I: Gray values of the HaCaT cell line expressing TRPV1 measured by means of ImageJ software

Fig. 5.

Co²⁺ histochemistry on the 3 T3 cell line. Cells were incubated for 10 min in buffer A containing: a 20 μM CAPS + 5 mM Co²⁺; b 20 μM CAPS + 5 mM Co²⁺ + 5 μM CapZ; c 5 mM Co²⁺ without CAPS. d 20 μM CAPS without Co²⁺. No CoS precipitate could be observed in the absence of TRPV1 protein in the cell membrane. e Gray values of the 3T3 cell line measured by means of ImageJ software. Cells were incubated for 10 min in: f buffer A containing 5 mM Co²⁺; g buffer A without Co²⁺; h modified buffer A containing 50 mM KCl + 2.5 mM NaCl + 5 mM Co²⁺; i modified buffer A containing 50 mM KCl + 12.5 mM NaCl without Co²⁺. j Gray values of the 3T3 cell line measured by means of ImageJ software. These results confirm that Co²⁺ does not enter the 3T3 cells through VGCCs

In order to rule out the possibility that Co²⁺ can enter the cells through VGCCs, 3T3 cells were challenged with 50 mM extracellular KCl. These cells did not show any VGCC activity: the high extracellular KCl concentration-induced depolarization that opens the VGCC channels did not cause ⁴⁵Ca²⁺ accumulation in the ⁴⁵Ca²⁺ -uptake assay.

Moreover, the VGCC blocker nisoldipine did not decrease the CAPS-induced TRPV1-mediated ⁴⁵Ca²⁺ accumulation (data not shown). No Co²⁺ staining was observed in the presence of 50 mM extracellular KCl (Fig. 5f–j). ANOVA indicated no significant differences among the groups (P = 0.9150). These results confirm that the CAPS-induced Ca²⁺ and Co²⁺ influx in TRPV1/3T3 cells is due exclusively to the TRPV1 channel activity.

Besides the in vitro demonstration of Co²⁺ antagonism, we further validated this Co²⁺ inhibition phenomenon in tests of eye wiping in response to pungent vanilloids [28]. Co²⁺ again decreased the frequency of vanilloid-evoked defending movements. Inhibition experiments with CapZ cross-validated and confirmed our earlier findings (Fig. 6a).

Fig. 6.

Eye wipe test performed on CD1 mice and cobalt uptake experiments on TRPV1 point mutants. a Eye wipe responses to the corneal application of CAPS alone or together with Co²⁺ or CapZ. Statistical significance of inhibition was assessed by means of the paired t test (P < 0.05). Data are means ± SD of the results of eight independent experiments (n = 8). b Schematic localizations of the mutants used in the study. c, d IC₅₀ of RuRed and Co²⁺ determined on TRPV1 point mutants and wild type (WT). Data are means ± SD of the results of three independent experiments. TRPV1 point mutants revealed that the binding regions of Co²⁺ and RuRed are different

To validate that Co²⁺ inhibition is a consequence of competition with Ca²⁺ for M²⁺-chelating sites in the pore loop domain, we prepared several point mutants in this region of TRPV1, and determined the channel kinetics through ⁴⁵Ca²⁺-uptake experiments in 3T3 cells expressing the mutant channels. Some of these mutants had been partially characterized earlier in the context of spider venom channel inhibitors [17], and these residues proved to have an important role in the binding of various previously tested channel blockers (RuRed, etc.). Mutated sites are illustrated schematically in Fig. 6b. The EC₅₀ and EC₁₀₀ values of mutant channels for CAPS were different from those of the wild type (D646N EC₅₀ = 270 nM, E651W EC₅₀ = 540 nM, N628W EC₅₀ = 720 nM and Y627W EC₅₀ = 820 nM), and the blocking effects of Co²⁺ and RuRed on TRPV1 mutants were therefore analysed with 4 μM CAPS. The neutralization of D646 reduced the sensitivity of TRPV1 to RuRed inhibition [11]. Our ⁴⁵Ca²⁺-influx studies on TRPV1 point mutants revealed the following IC₅₀ data for RuRed: IC₅₀ (D646N) = 12.8 μM > IC₅₀ (N628W) = 1.33 μM > IC₅₀ (E651W) = 0.94 μM > IC₅₀ (wild type) = 0.87 μM > IC₅₀ (Y627W) = 0.26 μM (Fig. 6c), which findings correspond with published results [17]. Likewise, Co²⁺ inhibited the 4 μM CAPS-evoked ⁴⁵Ca²⁺ influx in the D646N and E651W point mutants similarly as determined in the wild type. The neutralization of D646 caused no or only a minimal change in IC₅₀. As compared with the wild type in this representative experiment, Co²⁺ sensitivity was slightly reduced in the D646N mutant (IC₅₀ = 18.3 vs. 25.7 μM). The Y627W, N628W and E651W mutants displayed little or no difference relative to the wild type (IC₅₀ = 18.6, 16.4 and 15.3 μM, respectively vs. 18.3 μM; Fig. 6d). Based on these findings, inhibition seems to be a consequence of competition with Ca²⁺ for M²⁺-chelating sites in the pore loop domain.

Discussion

Testing the effects of various metal cations on the vanilloid-induced activity of the TRPV1 channel, we demonstrated that Mg²⁺, Mn²⁺ or La³⁺ caused little or no decrease in channel activity, whereas Zn²⁺ proved to be a weak and only partial inhibitor of the 2 μM CAPS-induced ⁴⁵Ca²⁺ uptake. The other cations effectively blocked the vanilloid-induced Ca²⁺ entry into TRPV1/HaCaT cells, with the following sequence of potency: Co²⁺ > Cd²⁺ > Ni²⁺ > Cu²⁺.

It was reported by Nilius et al. [29] that Co²⁺ reduced the inward Ca²⁺ current through ECaC1 (TRPV5), a close relative of TRPV1, sharing around 30 % homology with it. Fast and reversible recovery of the current upon washout of the inhibitor was detected during their experiments. Furthermore, they identified other M²⁺-s as effective inhibitors of the Ca²⁺ influx. Their results indicated the following overall blocking sequence: Pb²⁺ = Cu²⁺ = Gd³⁺ > Cd²⁺ > Zn²⁺ > La³⁺ > Co²⁺ > Fe²⁺ > > Fe³⁺. Zeng et al. found Cu²⁺ to be a potent inhibitor of the whole-cell current evoked by intracellular ADP-ribose through TRPM2, another member of the TRP group. The inhibitory effect of Cu²⁺ was irreversible, and occurred only if Cu²⁺ was administered in outside-out patches, suggesting that the action site is located extracellularly. The TRPM2 current was also blocked by Hg²⁺, Pb²⁺, Fe²⁺ and Se²⁺ [30].

In accord with the above-mentioned findings, we also observed ion influx-inhibitory effects of M²⁺-s on TRP channel. Depending on the TRP channel type, differences of the orders of blocking potency could be detected. Furthermore, the blocking effects of the individual cations could be reversible or irreversible, depending on the channel type. The three channels are close relatives and share high degree of sequence and structural homology with one another, which explains the similar responses to M²⁺-s. Having diverged from a common ancestor, TRP channels operate on uniform principles. However, during evolution TRP superfamily has evolved for various specialized functions. TRPV1 and TRPV5, for example, belong to different subgroups of the TRPV family; TRPV1–4 are non-ion-selective, whilst TRPV5–6 are highly Ca²⁺-selective. Hence, this functional adaptation may cause the differences in the M²⁺-evoked responses.

As concerns our own results, Co²⁺ reduced not only CAPS-induced but also heat-induced ⁴⁵Ca²⁺ influx. When increasing concentrations of both Co²⁺ and CAPS were applied, the Co²⁺ inhibition patterns indicated channel-blocking kinetics. Our dose–response and Co²⁺ accumulation experiments revealed a competition for binding sites and a co-entry mechanism. We presume that Co²⁺ inhibits TRPV1 through its ability to bind to the ion selectivity filter of the channel: it passes through the ion channel much more slowly than Ca²⁺. Ca²⁺ entry is also slowed down by the binding of Co²⁺, which occupies the appropriate amino acid residues of the ion selectivity filter. This hypothesis seems to be further supported by the findings of Sajadi [31], who determined the stability constants of the 1:1 complexes formed between M²⁺ and l-tryptophan and other amino acids. The sequence obtained in the case of tryptophan was Ca²⁺ < Mg²⁺ < Mn²⁺ < Co²⁺ < Ni²⁺ < Cu²⁺ > Zn²⁺, which follows the Irving-Williams sequence [32]. The order of the stability constants was similar in the cases of methionine, alanine, leucine, valine and glycine. The amino acid sequence of the putative pore region is STSHRWRGPACRPPDSSYNSLYSTCLELFKFTIGMGD (Q8NER1, UniProt), containing all the tested amino acids but valine. The stability constants formed between M²⁺ and tryptophan were Ca²⁺, 2.55 ± 0.08; Mg²⁺, 2.84 ± 0.08; Mn²⁺, 3.34 ± 0.05; Co²⁺, 4.34 ± 0.07; Ni²⁺, 5.31 ± 0.06; Cu²⁺, 8.05 ± 0.05 and Zn²⁺, 5.00 ± 0.08. The stability constants for Mg²⁺ and Mn²⁺ are close to that of Ca²⁺, so these ions can probably readily pass through the open channel of TRPV1. Co²⁺, Ni²⁺ and Cu²⁺ can be characterized by much higher complex-forming strength, elucidating the elevated TRPV1 blocking potency. Interestingly, for these three M²⁺-s, an unexpected relationship can be observed between the stability constant and the TRPV1 blocking potency. The stronger the bond, the weaker the TRPV1 inhibition potency is. The ionic radii (in picometres) of these cations are Ca²⁺, 100; Mg²⁺, 72; Mn²⁺, 67; Co²⁺, 65; Ni²⁺, 69; Cu²⁺, 73 and Zn²⁺, 74 [33]. Ca²⁺ is likely to have the ideal ionic radius and stability constant in its reactions with amino acids in order to be effectively passed along the carbonyl groups of the peptide backbone in the ion selectivity filter and the pore loop. Co²⁺ has a medium stability constant and the smallest ionic radius, which is probably not adequate for efficient transport. These two parameters seem to be equally involved in the proper ion influx. The stronger the M²⁺-amino acid complex and the smaller the ionic radius is, the more probable it is that M²⁺ will block the Ca²⁺ influx through the TRPV1 channel. As another interesting finding, in our experiments, Zn²⁺seemed to be only weak and partial inhibitor of the ion current. Its stability constant is almost as high as that of Co²⁺, suggesting a strong TRPV1-blocking ability, whereas its ionic radius is much larger than that of Co²⁺. Interestingly, the IC₅₀ of Zn²⁺ is the second lowest exceeding only that of Co²⁺, but Zn²⁺ can achieve a decrease of merely 30 % of the maximal ion influx.

The TRPV1 channel is a non-selective cation channel, and still shows preference for Ca²⁺. The sequence of permeability is Ca²⁺ > Mg²⁺ > Na⁺ = K⁺ = Cs⁺ [3]. In addition to all these, TRPV1 also conducts protons [34]. Following prolonged exposure to agonists, TRPV1 becomes permeable even to larger organic cations, including dyes such as YO-PRO1 and FM1-43 [22] and a lidocaine derivative QX-314 [23]. Increasing agonist concentration enhances the blocking ability of Co²⁺, suggesting a correlation between the increased efficacy of inhibition and the different open-state conformations of the TRPV1 channel. Further experiments (involving patch-clamp recordings) would be needed to clarify the inhibitory effect of Co²⁺ on the fluxes of the other cations or molecules mentioned above. However, no channel blocker or antagonist of TRPV1 has been reported that is able to block the flux of only one specific ion, and antagonists seem to block all these influxes. For example, CapZ blocks the influxes of both Ca²⁺ and Na⁺ [35]. Overall, we presume that Co²⁺ can also block the ion currents mentioned above.

Before the exploration of TRPV1 protein, Co²⁺ histochemistry was a very useful tool for the identification of vanilloid-sensitive primary afferent neurons with C-and Aδ fibres after in vivo experiments. Co²⁺ uptake and the postmortem determination of Co²⁺ deposits quite accurately identified C-and Aδ afferents, the neuronal subset that can be activated by treatment with a vanilloid agonist, CAPS [36, 37]. Likewise, as previously documented in a subpopulation of pseudo-unipolar neurons [38], we have now demonstrated selective vanilloid-induced Co²⁺ accumulation in the cytosol of DRG primary cultures and TRPV1-transfected HaCaT and 3T3 cells. The accumulation of Co²⁺ could be blocked by RuRed or CapZ in a dose-dependent manner. The CAPS-induced Ca²⁺ and Co²⁺ influxes in TRPV1/3T3 cells proved to be due exclusively to the TRPV1 channel and not to VGCC activity.

Co²⁺ inhibited the pain-evoked defensive movements in eye wipe tests in response to pungent vanilloids. However, not only TRPV1 but also some other calcium channels of the sensory neurons, such as VGCCs, can be blocked by Co²⁺ [39]. VGCCs share structural homology with TRPV1 channel. The α1 subunit of voltage-gated calcium channels is organized in four homologous domains (I–IV), with six transmembrane segments (S1–S6) in each [40]. There is an additional region (H5) between S5 and S6, which forms a part of the pore region of the channel [41]. Within each H5 region, there exist conserved glutamate residues, significantly homologous to conventional EF-hand motifs [42], acting as the selectivity filter [43]. Mn²⁺, Ni²⁺ and Cd²⁺ in contrast with Co²⁺ are known to be stronger blockers of the VGCCs. Cu²⁺, Mn²⁺ and Co²⁺ blocked high-voltage activated currents conducted by Ba²⁺ with IC₅₀ of 920, 58, and 65 μM, respectively [44, 45]. All of these ions exert their effects through high-affinity docking to the cation-binding site at the IIIS5–H5 pore region of the VACCs [46, 47]. Since Co²⁺ has higher IC₅₀ for VGCCs (≈65 μM) than for TRPV1 (≈15 μM), we can conclude that decrease in the number of eye wipes might be due, at least partially, to an inhibitory effect of Co²⁺ on TRPV1.

Positively charged tricyclics, K/R-rich basic peptides and RuRed dock to the DXEXXEXXD motif at the channel orifice [13]. Although our point mutants overlap with the RuRed docking site [11, 14, 45], our point mutant studies suggest that Co²⁺ has a different binding site. Accordingly, the D646N point mutant, which is crucial for RuRed binding, does not change the kinetic parameters of Co²⁺ inhibition in cells ectopically expressing the D646N mutant TRPV1. We carried out vanilloid-induced ⁴⁵Ca²⁺-uptake experiments with channel point mutants of TRPV1 in which the agonist binding site remained intact. Interestingly, no significantly decreased efficacy of Co²⁺ inhibition was found when ⁶⁴⁶aspartate was replaced by asparagine. Based on these results, Co²⁺ is supposed to evoke its effect at a different site on the pore loop region than RuRed, or to use the same negatively charged amino acids passing through the TRPV1 channel as Ca²⁺. This line of research on functional point mutants should be continued to determine whether Co²⁺ has a specific binding site on the channel orifice or not.

Most painkiller drugs are competitive agonists and target the CAPS-binding domain [48]. As the 646DLEFTENYD acidic tetrad sequence of the TRPV1 receptor is unique among Ca²⁺-binding proteins, this permits the design of painkillers targeting the channel orifice of TRPV1 and acting as channel blockers. A better understanding of the structural background and dynamics of the competition of Ca²⁺ with other M²⁺ for entry may result in the discovery of novel channel blocker painkillers. Furthermore, our data can contribute to a better understanding of the structures and functions of all TRP superfamily members. The specific effect of the selected M²⁺-s on the given ion channel pore region can serve as a valuable constraint during in silico modelling of the pore region. By comparing the different cation action profiles of pore regions, the model can be fine-tuned. The mechanism of Co²⁺-mediated inhibition provides screening for adjuvant therapeutics with higher selectivity than that of AMI, an approved drug currently used in clinical practice, but with only limited efficacy and with serious side effects.