Skip to main content
The British Journal of Radiology logoLink to The British Journal of Radiology
. 2013 Dec 20;87(1033):20130484. doi: 10.1259/bjr.20130484

Evaluation of 99mTc-peptide-ZHER2:342 Affibody® molecule for in vivo molecular imaging

J-M Zhang 1, X-M Zhao 1, S-J Wang 2,✉, X-C Ren 1, N Wang 1, J-Y Han 1, L-Z Jia 1
PMCID: PMC3898972  PMID: 24273251

Abstract

Objective:

The aim of this study was to develop an improved method for labelling ZHER2:342 with Technetium-99m (99mTc) using Gly-(d) Ala-Gly-Gly as a chelator and to evaluate the feasibility of its use for visualization of HER2 expression in vivo.

Methods:

The Affibody® molecule ZHER2:342 was synthesized by Fmoc/tBu solid phase synthesis. The chelator, Gly-(d) Ala-Gly-Gly, was introduced by manual synthesis as the N-terminal extensions of ZHER2:342. ZHER2:342 was labelled with 99mTc. The labelling efficiency, radiochemical purity and in vitro stability of the labelled molecular probe were analysed by reversed-phase high performance liquid chromatography. Biodistribution and molecular imaging using 99mTc-peptide-ZHER2:342 were performed.

Results:

The molecular probe was successfully synthesized and labelled with 99mTc with the labelling efficiency of 98.10 ± 1.73% (n = 5). The radiolabelled molecular probe remained highly stable in vitro. The molecular imaging showed high uptake in HER2-expressing SKOV-3 xenografts, whereas the MDA-MB-231 xenografts with low HER2 expression were not clearly imaged at any time after the injection of 99mTc-peptide-ZHER2:342. The predominant clearance pathway for 99mTc-peptide-ZHER2:342 was through the kidneys.

Conculsion:

99mTc-peptide-ZHER2:342 using Gly-(d) Ala-Gly-Gly as a chelator is a promising tracer agent with favourable biodistribution and imaging properties that may be developed as a radiopharmaceutical for the detection of HER2-positive malignant tumours.

Advances in knowledge:

The 99mTc-peptide-ZHER2:342 molecular probe is a promising tracer agent, and the results in this study provide a foundation for future development of protocols for earlier visual detection of cancer in the clinical setting.


The human epidermal growth factor receptor Type 2 (ErbB2), also known as HER2 or p185, is a transmembrane tyrosine kinase receptor. HER2 overexpression has been detected in a number of malignant tumours, such as carcinomas of the breast, ovary and prostate.1 Blocking of HER2 signalling using the monoclonal antibody trastuzumab (Herceptin) can improve the survival of patients with HER2-positive cancer.2 As not all tumours express HER2, an accurate method for detection of this marker is required to select patients who can benefit from trastuzumab therapy.

Currently, the most widely used methods for evaluating receptor expression on tumours and metastases are immunohistochemical staining and fluorescent in situ hybridization of biopsy samples.3 However, the deficiencies in using biopsies are false-negative findings due to sampling errors and discordance in HER2 expression between the primary tumour and metastases. Moreover, it is not possible to biopsy tumours at all sites. Targeted radionuclide imaging may help to avoid such issues by visualizing HER2 expression in both primary tumours and metastases. Meanwhile, compared with traditional imaging techniques, such as MRI, CT and ultrasound imaging, radionuclide imaging is attractive because it specifically detects expression of tumour markers such as HER2 rather than gross anatomical changes.

Monoclonal antibodies have often been used to target HER2 for radionuclide imaging, but slow uptake in tumours and slow blood clearance are well-recognized problems of these agents.4–6 Reduction of tracer molecular size is considered a promising way to improve imaging contrast by increasing the rates of tumour localization and clearance from blood and healthy tissues.7 The Affibody® molecule ZHER2:342 is a 58-amino acid 3-helix bundle protein that originates from the B-domain of the staphylococcal protein with a low molecular weight of about 7 kDa. ZHER2:342 has been reported to bind to the extracellular domain of HER2 with an affinity of 22 pM.8 ZHER2:342, labelled with 125I and 111In, can target HER2-expressing xenografts with high specificity.9,10 The labelling of this protein with 68Ga has also provided high-quality imaging of HER2-expressing tumours in patients.11 In addition, radionuclides such as 18F, 186Re, 177Lu and Technetium-99m (99mTc) have been used to label Affibody molecules.12–14 Of note, HER2-binding Affibody molecules have been successfully developed and studied in conjunction with various radiolabels for diagnostic imaging applications. However, an optimal radiotracer is still not available.

The aim of the study was to develop an improved method for labelling ZHER2:342 with 99mTc using Gly-(d) Ala-Gly-Gly as a chelator and to evaluate the feasibility of its use in the visualizing of HER2 expression in vivo.

METHODS AND MATERIALS

Peptide synthesis and characterization

The Affibody molecule ZHER2:342 (VENKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK) was synthesized by Shanghai Science Peptide Biological Technology Co., Ltd, Shanghai, China. Fmoc/tBu solid phase synthesis was used on a peptide synthesizer with a substitution of 0.67% mmol g−1. 10 molar equivalents of Fmoc-protected amino acids, 1-hydroxybenzotriazole (HOBt) and 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate, were used to activate equal molar equivalents of Fmoc-protected amino acid, and acetic anhydride was used to terminate peptides where acylation was incomplete. The Tc-chelating moieties were introduced to the N-terminal extensions of ZHER2:342 by manual synthesis. The N-terminal Fmoc protecting group was removed by incubation with 20% piperidine-N-methylpyrrolidone for 20 min. Peptides were released from solid support and deprotected by a 2-h incubation in trifluoroacetic acid (TFA):ethanedithiol:H2O:triisopropylsilane (94.0:2.5:2.5:1.0) followed by extraction with tert-butyl methyl ether:H2O (50:50) three times before filtration and lyophilization. At the N-terminus of the ZHER2:342 sequence, four amino acids (Gly-(d) Ala-Gly-Gly), forming an N4 configuration were used as a linker for coupling ZHER2:342 and 99mTc.15 In addition, one γ-aminobutyric acid (γ-Aba) was introduced as a barrier to prevent steric hindrance, and then ZHER2:342 was labelled with 99mTc by the ligand exchange method as shown in Figure 1. To verify the identity of the peptide, reversed-phase high performance liquid chromatography (RP-HPLC) was performed. In addition, mass spectrometric analysis was carried out on a mass spectrometer (LCMS-2011; Shimadzu Corp., Kyoto, Japan) with an electrospray ionization source to confirm the protein mass.

Figure 1.

Figure 1.

Radiolabelling of peptide-ZHER2:342 with Technetium-99m (99mTc).

Radiolabelling with 99mTc

To obtain 99mTc-pertechnetate, the 99Mo-99Tc generator (Beijing Atom HighTech Co., Ltd., Beijing, China) was eluted with sterile 0.9% sodium chloride. Before labelling, freeze-dried ZHER2:342 was dissolved in distilled water and stored at −20 °C. For labelling, 20 µl of ZHER2:342 (1 mg ml−1) was mixed with 20 µl of 0.15 M NaOH to obtain the final pH of about 11. Thereafter, 35 µl of a solution of SnCl2·2H2O in 0.01 M HCl (1 mg ml−1) was added, followed by 600 µL (370 MBq) of fresh 99mTc-pertechnetate solution. The mixture was lightly vortexed and incubated for 60 min at room temperature. The labelling efficiency and radiochemical purity of the labelled conjugate were analysed using RP-HPLC (Alltech 305, Deerfield, IL) using a 4.6 × 250 mm C18 column with a particle size of 5 µm, a 30-min gradient of 5–70% A (A: 0.1% TFA-CH3CN; B: 0.1% TFA-H2O) and a flow rate of 1 ml min−1.

In vitro stability analysis

To assess the stability of the radiotracer in vitro, 99mTc-peptide-ZHER2:342 was incubated in saline or fresh human serum at 37 °C, and the stability of the radiotracer in vitro was evaluated at 1, 2, 4, 6 and 24 h by RP-HPLC using the same conditions as those for testing labelling efficiency above.

Cell culture

The HER2-expressing ovarian carcinoma cell line, SKOV-3 (displaying approximately 1.2 × 106 HER2 receptors per cell),16 and human breast carcinoma cell line, MDA-MB-231 with low HER2 expression (4 × 104 HER2 receptors per cell),17 were purchased from the Institute of Cell Biology of the Chinese Academy of Sciences (Shanghai, China). All cells were cultivated in Roswell Park Memorial Institute 1640 (RPMI 1640) medium supplemented with 10% foetal bovine serum (Invitrogen, Carlsbad, CA) under standard conditions (37 °C, humidified atmosphere containing 5% CO2). Cell growth was monitored under an inverted microscope with phase contrast. When the cell density reached 90%, SKOV-3 and MDA-MB-231 cells were harvested using trypsin-ethylenediaminetetraacetic acid (trypsin-EDTA; 0.25% trypsin, 0.02% EDTA; Invitrogen).

Establishment of xenograft tumours in nude mice

All animal studies were approved by the Animal Care and Use Committee of Hebei Medical University. BALB/c nude mice (females; weight, 20 ± 4 g; 4–6 weeks old) bearing HER2-expressing SKOV-3 cells or MDA-MB-231 cells with low HER2 expression were used in the targeting experiments. The animals were purchased from the Department of Laboratory Animal Science of Peking University Health Science Centre, Beijing, China, and acclimated for 7 days in the Department of Laboratory Animal Science (the Fourth Hospital of Hebei Medical University, Hebei, China) before tumour implantation. A total of 5 × 106 SKOV-3 or MDA-MB-231 cells in 200 µl of RPMI 1640 medium without phosphate buffered saline were injected subcutaneously in the right upper limbs of each mouse. The tumours were allowed to grow to a diameter of 1–1.5 cm for about 4–6 weeks.

Biodistribution studies

20 SKOV-3 bearing BALB/c nude mice were randomly divided into 4 groups with 5 mice in each group. Labelled conjugates (1110 kBq) were injected into each mouse via the tail vein. At 1, 4, 6 and 8 h after injection, the mice were sacrificed by cervical dislocation. The organ or tissue samples of interest (blood, heart, liver, spleen, kidney, lung, stomach, small intestine, brain, bone, muscle and tumour) were harvested by dissection and weighed. A gamma well counter (CAPRAC®; Capintec Inc., Ramsey, NJ) was used to measure radioactivity uptake in organs or tissues, which was calculated as the percentage of injected dose per gram of tissue (%ID/g). Meanwhile, ratios of radioactivity in the tumour to that in blood, liver and muscle were also calculated to evaluate tumour uptake in this study. In addition, the low HER2-expressing MDA-MB-231 cell line was used as a “negative control” to evaluate the specificity of 99mTc-peptide-ZHER2:342 uptake in tumours. 20 BALB/c mice bearing low HER2-expressing MDA-MB-231 xenografts were used in the biodistribution studies, with 5 mice in each group. These animals were injected with the same dose of 99mTc-peptide-ZHER2:342, sacrificed at the same time points and processed in the same manner as described above for the SKOV-3 xenograft model. To further analyse the binding specificity of 99mTc-peptide-ZHER2:342 to HER2-expressing cells, 5 mice were intravenously injected with 500 µg of unlabelled ZHER2:342 1 h before the labelled conjugates were injected to saturate HER2 receptors. At 4 h after injection of the labelled molecular probe, all five mice were sacrificed, and organs and tissue of interest were collected, weighed and analysed for radioactivity.

In vivo imaging of nude mice with xenografts

Mice were anaesthetized using 0.5% pentobarbital (i.p. 50 mg kg−1), administered 99mTc-peptide-ZHER2:342 (37 MBq, 100 μl; pH, 7.0) and then placed in a supine position in the centre of the field of view of a Siemens e.camduet single photon emission CT (SPECT) scanner equipped with a pinhole collimator for imaging. Acquisition of static images (300 000 counts) of the animals in the anteposition was performed with zoom 1.78 and energy window 140 KeV, 15%, and data were digitally stored in a 128 × 128 matrix. To determine an optimal time point for HER2 imaging, the five mice bearing SKOV-3 xenografts were imaged at 0.5, 1, 2, 4, 6, 12 and 24 h after injection. The ratio of radioactive counts in the tumour to that in the contralateral equivalent region (T/NT) was calculated by drawing regions of interest at each time point. In addition, five mice bearing MDA-MB-231 xenografts were imaged at the same time as SKOV-3 bearing mice as negative controls after the administration of 99mTc-peptide-ZHER2:342. Meanwhile, to evaluate the specificity of binding of the 99mTc-peptide-ZHER2:342 with HER2 receptors in vivo, 5 animals were pre-injected with 500 µg of non-labelled ZHER2:342, to saturate the HER2 receptors of tumours, and imaged 4 h after the injection of the 99mTc-peptide-ZHER2:342 molecular probe via the tail vein.

Statistical analysis

Variables were expressed as mean value plus standard deviation (x±sd). Analysis of variance (ANOVA) or a non-parametric test on rank transformed data was used to analyse the variation of tumour uptake in the biodistribution experiment and ratios of T/NT between different time points in the same group. Variables between the SKOV-3 and MDA-MB-231 groups at the same time point were analysed using the Student's t test. A p-value < 0.05 was considered significant.

RESULTS

Peptide synthesis and characterization

ZHER2:342 was successfully synthesized using Fmoc solid phase peptide synthesis, and the chelator Gly-(d)-Ala-Gly-Gly was introduced at the N-terminus of ZHER2:342. Results from RP-HPLC analysis of the synthesized compound Gly-(d) Ala-Gly-Gly-ZHER2:342 are shown in Figure 2a. The molecular weight of the synthesized compound as determined by mass spectrometry was 7.047 kDa, which correlated well with the theoretical mass.

Figure 2.

Figure 2.

The synthesized compound, Gly-(d) Ala-Gly-Gly-ZHER2:342 was analysed by reversed-phase high performance liquid chromatography (RP-HPLC) (a). RP-HPLC analysis of Technetium-99m (99mTc)-peptide-ZHER2:342 (b) and free 99mTc (c) was also performed.

Radiolabelling of ZHER2:342

The labelling efficiency was 98.10 ± 1.73% (n = 5), and a high radioactive purity of the labelled conjugates with 95.57 ± 0.54% (n = 5) was obtained, which was sufficient to use for imaging without further purification. RP-HPLC analysis showed that the retention time of 99mTc-peptide-ZHER2:342 was about 18.7 min (Figure 2b), whereas that of the free 99mTc was about 5 min (Figure 2c).

In vitro stability analysis

Retention of stability is an important characteristic for radiolabelled molecular probes. The initial radiochemical purity of the labelled conjugates was determined to be 98.10 ± 1.73% (n = 5), and it remained at a high level over a 6 h period. Even at 24 h, the radiochemical purity was 85% ± 0.53% (n = 5), indicating that the radiolabelled conjugate had no significant degradation and off-labelling over time. Moreover, the RP-HPLC analysis showed that the radiolabelled molecular probe remained highly stable both in saline and in fresh human serum over time (Figure 3). When the 99mTc-labelled molecular probe was incubated in saline or fresh human serum at 37 °C, no significant difference in radiochemical purity was observed. The results showed that 99mTc-peptide-ZHER2:342 was stable against degradation by blood plasma proteases and was tolerant in human serum at 37 °C, which mimicked conditions in vivo.

Figure 3.

Figure 3.

In vitro stability of Technetium-99m (99mTc)-peptide-ZHER2:342.

Biodistribution of 99mTc-peptide-ZHER2:342

Biodistribution patterns of 99mTc-peptide-ZHER2:342 in mice bearing SKOV-3 xenografts are summarized in Figure 4a. Other than at tumour sites, radioactive accumulation of labelled conjugates was found primarily in the kidneys. The radioactive accumulation in SKOV-3 xenografts was higher than that for organs other than the kidneys. The tumour uptake was 4.611 ± 1.330, 7.717 ± 0.925, 8.218 ± 1.410 and 7.883 ± 1.034% ID/g at 1, 4, 6 and 8 h, respectively. Tumour uptake of SKOV-3 xenografts at 4, 6 and 8 h was higher than that at 1 h (p < 0.05); while there was no significant difference between the 4-, 6- and 8-h time points (p > 0.05). The radioactivity levels measured in blood, heart, bone, lung and muscle were very low, showing that the radiochemical was rapidly cleared in non-targeted organs. Together, the high tumour uptake in SKOV-3 xenografts and rapid clearance from blood and non-specific compartments provided high tumour-to-organ ratios (Table 1). Pre-injection with an excess of non-labelled conjugates decreased tumour uptake from 8.218 ± 1.410 to 0.97 ± 0.215 %ID/g (p < 0.05) 4 h after injection of the labelled conjugates, indicating that the radioactive uptake in tumour was HER2 receptor-specific and that 99mTc-peptide-ZHER2:342 had good tumour-targeting properties (Figure 5). The biodistribution of labelled conjugates in mice bearing MDA-MB-231 xenografts is shown in Figure 4b. Tumour uptake in SKOV-3 xenografts was higher than that of MDA-MB-231 xenografts at 1, 4, 6 and 8 h (p < 0.05), demonstrating good specificity and sensitivity of 99mTc-peptide-ZHER2:342 in the detection of HER2 receptors.

Figure 4.

Figure 4.

Biodistribution (%ID/g) of Technetium-99m (99mTc)-peptide-ZHER2:342 in BALB/c nude mice bearing SKOV-3 xenografts (a) and MDA-MB-231 xenografts (b). %ID/g is the percentage of injected dose per gram of tissue.

Table 1.

Tumour-to-organ ratios of 99mTc-peptide-ZHER2:342 in BALB/c nude mice bearing SKOV-3 xenografts and MDA-MB-231 xenografts

Tumor-to-organ ratio 1 h 4 h 6 h 8 h
T/blood        
 SKOV3 4.101 ± 0.592 9.932 ± 1.594 13.283 ± 4.273 13.390 ± 2.513
 MDA-MB-231 0.122 ± 0.058 0.203 ± 0.118 0.574 ± 0.069 0.232 ± 0.250
T/liver        
 SKOV3 2.501 ± 0.587 3.721 ± 0.819 4.116 ± 0.513 4.298 ± 0.566
> MDA-MB-231 0.122 ± 0.058 0.099 ± 0.041 0.281 ± 0.130 1.393 ± 1.924
T/muscle        
 SKOV3 11.786 ± 2.235 12.778 ± 2.597 15.427 ± 3.378 15.552 ± 1.900
 MDA-MB-231 1.005 ± 0.242 1.852 ± 1.685 1.918 ± 0.931 0.058 ± 0.077

Figure 5.

Figure 5.

Specificity of Technetium-99m (99mTc)-peptide-ZHER2:342 uptake in BALB/c nude mice bearing SKOV-3 xenografts 4 h post-injection. Data are presented as %ID/g. For HER2 receptor saturation, animals in the blocked group were intravenously injected with 500 µg of unlabelled ZHER2:342 1 h before the injection of labelled conjugates. %ID/g is the percentage of injected dose per gram of tissue.

In vivo imaging of nude mice with xenografts

Tumours of SKOV-3 bearing mice were visualized as early as 30 min and were shown most clearly at 6 h after the administration of 99mTc-peptide-ZHER2:342. The image contrast improved over time up to 6 h, and the tumour was still clearly imaged even after 24 h (Figure 6a). A high accumulation also was observed in the kidneys, which corresponded well with the biodistribution data. Radioactivity accumulation was not detected in the thyroid, which is generally known to take up free 99mTc-pertechnetate. Moreover, ratios of radioactive counts in tumours to those in the contralateral equivalent non-tumour regions (T/NT ratios) were 2.93 ± 0.75, 4.50 ± 0.43, 5.72 ± 1.40, 7.88 ± 1.78 and 8.26 ± 1.56 at 30 min, 1, 2, 4 and 6 h, respectively. The ratio of T/NT was highest at 6 h, but there was no significant difference between 4 and 6 h. However, there was no obvious uptake in low HER2-expressing MDA-MB-231 xenografts on SPECT images at any time after the injection of 99mTc-peptide-ZHER2:342 (Figure 6b). The T/NT ratios were 1.25 ± 0.31, 1.58 ± 0.39, 1.99 ± 0.43, 2.56 ± 1.46, and 2.58 ± 0.50 at 30 min, 1, 2, 4 and 6 h, respectively. The high HER2-expressing SKOV-3 xenografts accumulated significantly more radioactivity than did the low HER2-expressing MDA-MB-231 xenografts, with significantly different T/NT ratios between the two types of xenografts at all time points (p < 0.05). The radioactive uptake in tumours was further confirmed to be HER2 receptor-specific, as the imaging could be blocked effectively by pre-saturation of receptors with unlabelled ZHER2:342 (Figure 6c).

Figure 6.

Figure 6.

Single photon emission CT planar imaging with Technetium-99m (99mTc)-peptide-ZHER2:342 in BALB/c nude mice bearing HER2-expressing SKOV-3 xenografts (a) showing the uptake of the tumour (arrow) and low HER2-expressing MDA-MB-231 xenografts (b) at 30 min and 1, 2, 4, 6, 12 and 24 h after the administration of 99mTc-peptide-ZHER2:342. Tumours of SKOV-3 bearing mice were blocked with a pre-injection of excess unlabelled ZHER2:342 to saturate HER2 receptors (c).

DISCUSSION

The HER2 receptor, which is targeted by ZHER2:342, is overexpressed in a proportion of carcinomas, including those of the breast, ovary and urinary bladder. Various studies have detected HER2 expression in the range of 1.8–76% of ovarian carcinomas,1 but not in normal ovaries or benign ovarian tumours.18 HER2 expression is associated with the malignant tumour phenotype, which is more likely to recur and metastasize.19 Targeting of HER2-expressing tumours by the humanized monoclonal antibody trastuzumab prolongs patient survival,2 thus the efficient detection of HER2 can provide important diagnostic information and greatly influence patient management.

Radionuclide molecular imaging enables the detection of HER2 in vivo by a non-invasive procedure in both primary tumours and metastases. Application of this technique can avoid the disadvantages of biopsy sampling errors, especially when discordance in HER2 status exists between the primary tumour and metastatic tissues. The Affibody molecule is a 58-amino acid and cysteine-free three-helix bundle protein and it is a new class of small targeting proteins. The major advantage of the Affibody molecule as a targeting agent is the rapid tumour penetration and blood clearance from non-specific compartments. Another advantage is that the tracer can be produced completely by chemical synthesis instead of recombinant technology, which enables the site-specific introduction of the chelator and reduces production costs by approximately one-half.

The Affibody molecule ZHER2:342, which binds to HER2 with an apparent affinity of 22 pM, has demonstrated a clear advantage in tumour targeting when labelled by radioiodine.8,9 Other radioisotopes, such as 111In, 68Ga, 186Re, 177Lu and 18F, also have been used to label Affibody molecules and for the imaging of HER2 expression in metastatic breast cancer.10–14 However, 99mTc is likely the most suitable nuclide for SPECT as a label, with many advantages over other isotopes, such as having appropriate gamma energy (140 KeV) for SPECT imaging, easy preparation and a good safety profile for use in basic and clinical fields. Chelators, such as mercaptoacetyltriglycyl (maGGG),16 mercaptoacetyl-triseryl (maSSS),20 mercaptoacetyl-glutamyl-seryl-glutamyl (maESE),21 and mercaptoacetyl-Glu-Glu-Glu (maEEE)22 have been used for labelling ZHER2:342 with 99mTc in earlier studies. However, they all have advantages and disadvantages, an optimal chelator is still not available. Recently, the chelator Gly-(d) Ala-Gly-Gly was successfully used in the labelling of antisense peptide nucleic acids,23 but it has not been used in the labelling of Affibody molecules. In this study, 99mTc-peptide-ZHER2:342 was synthesized using Gly-(d) Ala-Gly-Gly as a chelator, and the biophysical characterization showed successful synthesis and labelling of ZHER2:342 by 99mTc. The high labelling efficiency of >98% and radiochemical purity of >95% indicated that this labelling method is superior to other methods by its simple protocol and lack of requirement for further purification.16,20–22 The experiments in this study demonstrated that the introduction of chelator sequence, Gly-(d) Ala-Gly-Gly, into the N-terminus of ZHER2:342 did not have a negative effect on the HER2-specific binding capacity, which was in agreement with previous reports.16,20–22 Incubation of 99mTc-peptide-ZHER2:342 with fresh human serum also did not significantly decrease its activity compared with incubation in saline, showing that the labelled conjugates were stable against degradation by blood plasma proteases.

The biodistribution studies indicated an adequate in vivo stability of the labelled conjugates. By imaging, there was no obvious uptake in salivary gland, thyroid and stomach, which are generally known to accumulate pertechnetate; these results indicated that free pertechnetate was not released in vivo. The favourable biodistribution pattern of 99mTc-peptide-ZHER2:342 provided high-contrast images in SKOV-3 xenografts. The molecular imaging showed an obvious tumour uptake of 99mTc-peptide-ZHER2:342 in HER2-expressing SKOV-3 xenografts, which was significantly higher than that in MDA-MB-231 xenografts with low HER2 expression.

Specific targeting is an important consideration for the development of a radiolabelled conjugate for clinical use. In this study, pre-saturation by excess unlabelled conjugates caused a significant decrease in tumour uptake in the in vivo biodistribution and imaging experiments, indicating that the uptake in tumour was HER2 receptor specific. Different excretion pathways and uptake in organs are also an important issue in the design of targeting conjugates. However, the shortage of knowledge concerning the factors that control the biodistribution of the molecular probe is a challenge to all of us. The use of maGGG as a chelator provides labelled conjugates with good tumour-targeting properties, but a high amount of these molecules are eliminated via hepatobiliary excretion.16 The hepatobiliary excretion creates problems with imaging targets in the abdomen because of an elevated background. Renal excretion is preferred over hepatobiliary excretion, as the well-defined shape of the kidneys in combination with SPECT/CT can reduce the incidence of image misinterpretation. Substitution of maGGG with maSSS in 99mTc-ZHER2:342 has been reported to cause a shift from hepatobiliary to renal clearance.20 Use of the chelator maESE in the 99mTc-labelled ZHER2:342 has decreased both liver and renal accumulation, resulting in improved targeting and imaging in the abdominal area.22

In this study, the predominent clearance mechanism for the 99mTc-peptide-ZHER2:342 molecular probe, using Gly-(d) Ala-Gly-Gly as a chelator, was via renal excretion, while its elimination from other non-targeted organs (i.e. intestine) was a minor pathway. However, the renal excretion mechanisms are not clear and should be studied further in future experiments. Relative to 125I labelled ZHER2:342, 99mTc-peptide-ZHER2:342 is a superior probe owing to a higher tumour uptake and reduced renal retention of the radioactivity.16 Compared with other chelators reported in the previous study, such as maSSS, maESE, maEEE or mercaptoacetyl-seryl-lysyl-seryl (maSKS), for labelling ZHER2:342 with 99mTc, the distribution of 99mTc-Gly-(d) Ala-Gly-Gly-ZHER2:342 is favourable not only because of its markedly decreased retention in the kidneys and intestine but also because there is no negative effect on tumour uptake.20–22,24 Therefore, this molecular probe is a promising agent for the detection of HER2 expression in vivo with good tumour-targeting properties and favourable distribution.

Several limitations of this study may be addressed in future experiments. For instance, a direct comparison should be made to validate the superiority of this new radiotracer to other radiotracers reported previously. While the images obtained in this study with SPECT were sufficient to interpret the biodistribution of 99mTc-peptide-ZHER2:342, a SPECT/CT scan should be performed to acquire clearer images. Given differences between human and rodent physiology, clinical studies ultimately would be needed to clarify the distribution and specificity of 99mTc-peptide-ZHER2:342 for HER2-expressing tumours in patients.

CONCLUSION

The 99mTc-peptide-ZHER2:342 molecular probe is a promising tracer agent that may be used for molecular imaging of HER2-expressing malignant tumours. The results in this study provide a foundation for the future development of protocols for earlier visual detection of cancer in the clinical setting.

FUNDING

This work was supported by the National Natural Science Foundation of China (NSFC) project (81071186)

ACKNOWLEDGMENTS

The authors would like to acknowledge the assistance of all the coworkers involved in the study.

REFERENCES

  • 1.Ramieri MT, Murari R, Botti C, Pica E, Zotti G, Alo PL. Detection of HER2 amplification using the SISH technique in breast, colon, prostate, lung and ovarian carcinoma. Anticancer Res 2010; 30: 1287-92. [PubMed] [Google Scholar]
  • 2.Di Lauro V, Torrisi E, Bidoli E, Quitadamo D, Cecco S, Veronesi A. trastuzumab and gemcitabine in pretreated HER2 overexpressing metastatic breast cancer patients: retrospective analysis of our series. J Oncol 2012; 2012: 198412. 10.1155/2012/198412 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Moelans CB, de Weger RA, Van der Wall E, van Diest PJ. Current technologies for HER2 testing in breast cancer. Crit Rev Oncol Hematol 2011; 80: 380-92. 10.1016/j.critrevonc.2010.12.005 [DOI] [PubMed] [Google Scholar]
  • 4.Boswell CA, Brechbiel MW. Development of radioimmunotherapeutic and diagnostic antibodies: an inside-out view. Nucl Med Biol 2007; 34: 757-78. 10.1016/j.nucmedbio.2007.04.001 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Huhalov A, Chester KA. Engineered single chain antibody fragments for radioimmunotherapy. Q J Nucl Med Mol Imaging 2004; 48: 279-88. [PubMed] [Google Scholar]
  • 6.Cortez-Retamozo V, Lauwereys M, Hassanzadeh Gh G, Gobert M, Conrath K, Muyldermans S, et al. Efficient tumor targeting by single-domain antibody fragments of camels. Int J Cancer 2002; 98: 456-62. [DOI] [PubMed] [Google Scholar]
  • 7.Behr TM, Gotthardt M, Barth A, Béhé M. Imaging tumors with peptide-based radioligands. Q J Nucl Med 2001; 45: 189-200. [PubMed] [Google Scholar]
  • 8.Orlova A, Magnusson M, Eriksson TL, Nilsson M, Larsson B, Höidén-Guthenberg I, et al. Tumor imaging using a picomolar affinity HER2 binding affibody molecule. Cancer Res 2006; 66: 4339-48. 10.1158/0008-5472.CAN-05-3521 [DOI] [PubMed] [Google Scholar]
  • 9.Steffen AC, Orlova A, Wikman M, Nilsson FY, Ståhl S, Adams GP, et al. Affibody-mediated tumour targeting of HER-2 expressing xenografts in mice. Eur J Nucl Med Mol Imaging 2006; 33: 631-8. 10.1007/s00259-005-0012-3 [DOI] [PubMed] [Google Scholar]
  • 10.Tolmachev V, Nilsson FY, Widström C, Andersson K, Rosik D, Gedda L, et al. 111In-benzyl-DTPA-ZHER2:342, an affibody-based conjugate for in vivo imaging of HER2 expression in malignant tumors. J Nucl Med 2006; 47: 846-53. [PubMed] [Google Scholar]
  • 11.Tolmachev V, Velikyan I, Sandström M, Orlova A. A HER2-binding Affibody molecule labelled with 68Ga for PET imaging: direct in vivo comparison with the 111In-labelled analogue. Eur J Nucl Med Mol Imaging 2010; 37: 1356-67. 10.1007/s00259-009-1367-7 [DOI] [PubMed] [Google Scholar]
  • 12.Tolmachev V, Orlova A, Pehrson R, Galli J, Baastrup B, Andersson K, et al. Radionuclide therapy of HER2-positive microxenografts using a 177Lu-labeled HER2-specific Affibody molecule. Cancer Res 2007; 67: 2773-82. 10.1158/0008-5472.CAN-06-1630 [DOI] [PubMed] [Google Scholar]
  • 13.Orlova A, Tran TA, Ekblad T, Karlström AE, Tolmachev V. (186)Re-maSGS-Z (HER2:342), a potential Affibody conjugate for systemic therapy of HER2-expressing tumours. Eur J Nucl Med Mol Imaging 2010; 37: 260-9. 10.1007/s00259-009-1268-9 [DOI] [PubMed] [Google Scholar]
  • 14.Kramer-Marek G, Kiesewetter DO, Martiniova L, Jagoda E, Lee SB, Capala J. [18F]FBEM-Z(HER2:342)-Affibody molecule-a new molecular tracer for in vivo monitoring of HER2 expression by positron emission tomography. Eur J Nucl Med Mol Imaging 2008; 35: 1008-18. 10.1007/s00259-007-0658-0 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Pallela VR, Thakur ML, Chakder S, Rattan S. 99mTc-labeled vasoactive intestinal peptide receptor agonist: functional studies. J Nucl Med 1999; 40: 352-60. [PubMed] [Google Scholar]
  • 16.Engfeldt T, Orlova A, Tran T, Bruskin A, Widstrom C, Karlstrom AE, et al. Imaging of HER2-expressing tumours using a synthetic Affibody molecule containing the 99mTc-chelating mercaptoacetyl-glycyl-glycyl-glycyl (MAG3) sequence. Eur J Nucl Med Mol Imaging 2007; 34: 722-33. [DOI] [PubMed] [Google Scholar]
  • 17.Costantini DL, Bateman K, McLarty K, Vallis KA, Reilly RM. Trastuzumab-resistant breast cancer cells remain sensitive to the auger electron-emitting radiotherapeutic agent 111In-NLS-trastuzumab and are radiosensitized by methotrexate. J Nucl Med 2008; 49: 1498-505. [DOI] [PubMed] [Google Scholar]
  • 18.Wu Y, Soslow RA, Marshall DS, Leitao M, Chen B. Her-2/neu expression and amplification in early stage ovarian surface epithelial neoplasms. Gynecol Oncol 2004; 95: 570-5. 10.1016/j.ygyno.2004.08.043 [DOI] [PubMed] [Google Scholar]
  • 19.Serrano-Olvera A, Dueñas-González A, Gallardo-Rincón D, Candelaria M, De la Garza-Salazar J. Prognostic, predictive and therapeutic implications of HER2 in invasive epithelial ovarian cancer. Cancer Treat Rev 2006; 32: 180-90. 10.1016/j.ctrv.2006.01.001 [DOI] [PubMed] [Google Scholar]
  • 20.Engfeldt T, Tran T, Orlova A, Widström C, Feldwisch J, Abrahmsen L, et al. 99mTc-chelator engineering to improve tumour targeting properties of a HER2-specific Affibody molecule. Eur J Nucl Med Mol Imaging 2007; 34: 1843-53. 10.1007/s00259-007-0474-6 [DOI] [PubMed] [Google Scholar]
  • 21.Ekblad T, Tran T, Orlova A, Widström C, Feldwisch J, Abrahmsen L, et al. Development and preclinical characterization of 99mTc-labelled Affibody molecules with reduced renal uptake. Eur J Nucl Med Mol Imaging 2008; 35: 2245-55. 10.1007/s00259-008-0845-7 [DOI] [PubMed] [Google Scholar]
  • 22.Tran T, Engfeldt T, Orlova A, Sandström M, Feldwisch J, Abrahmsen L, et al. (99m)Tc-maEEE-Z(HER2:342), an Affibody molecule-based tracer for the detection of HER2 expression in malignant tumors. Bioconjug Chem 2007; 18: 1956-64. 10.1021/bc7002617 [DOI] [PubMed] [Google Scholar]
  • 23.Zhao X-M, Dai M, Liu Y-L, Wang J-F, Zhang J-M, Wang Y-C. Preparation of 99Tcm labeled survivin mRNA antisense PNA and gene imaging in nude mice bearing lung carcinoma A549 xenografts. Chin J Nucl Med 2011; 31: 339-43. [Google Scholar]
  • 24.Tran TA, Ekblad T, Orlova A, Sandström M, Feldwisch J, Wennborg A, et al. Effects of lysine-containing mercaptoacetyl-based chelators on the biodistribution of 99mTc-labeled anti-HER2 Affibody molecules. Bioconjug Chem 2008; 19: 2568-76. 10.1021/bc800244b [DOI] [PubMed] [Google Scholar]

Articles from The British Journal of Radiology are provided here courtesy of Oxford University Press

RESOURCES