Correction: PP2A/B55 and Fcp1 Regulate Greatwall and Ensa Dephosphorylation during Mitotic Exit

. 2014 Feb 27;10(2):e1004259. doi: 10.1371/journal.pgen.1004259

The PLOS Genetics Staff

PMCID: PMC3937266

There is a mistake in the alignment of the Drosophila Greatwall sequence in Figure 2A.

The correct Drosophila sequence is: fglskidmrrdleisdlincspnlnartpgqllsltshlsfgsekklndfgsvssgqnngmg

This sequence does not contain a conserved TTP Cdk consensus site at the residues equivalent to the human Threonine 193 and 194.

Note that there is a TP in this sequence, which could be a relevant Cdk phosphorylation site.

This requires further experimental evidence.

Reference

1. Hégarat N, Vesely C, Vinod PK, Ocasio C, Peter N, et al. (2014) PP2A/B55 and Fcp1 Regulate Greatwall and Ensa Dephosphorylation during Mitotic Exit. PLoS Genet 10(1): e1004004 doi:10.1371/journal.pgen.1004004 [DOI] [PMC free article] [PubMed] [Google Scholar]