Skip to main content
The Journal of Biological Chemistry logoLink to The Journal of Biological Chemistry
. 2014 Jan 31;289(12):8240–8251. doi: 10.1074/jbc.M113.544965

Structure of the Chicken CD3ϵδ/γ Heterodimer and Its Assembly with the αβT Cell Receptor*

Richard Berry ‡,1,2, Stephen J Headey §,1, Melissa J Call ¶,‖,1,3, James McCluskey **, Clive A Tregaskes ‡‡, Jim Kaufman ‡‡, Ruide Koh ‡, Martin J Scanlon §, Matthew E Call ¶,‖,4,5, Jamie Rossjohn ‡,§§,4,6
PMCID: PMC3961652  PMID: 24488493

Background: Chickens possess a CD3δ/γ chain that assembles with T cell receptor to mediate immune signaling.

Results: Chicken CD3ϵδ/γ has an atypical heterodimer interface and surface but associates with TCRαβ.

Conclusion: Chicken CD3δ/γ represents a hybrid chain possessing features in common with human CD3δ and CD3γ.

Significance: Understanding the ancestral TCR signaling complex provides insights into the evolution of this signaling apparatus.

Keywords: Cell Signaling, Immunology, Protein Assembly, Protein Evolution, Protein Structure

Abstract

In mammals, the αβT cell receptor (TCR) signaling complex is composed of a TCRαβ heterodimer that is noncovalently coupled to three dimeric signaling molecules, CD3ϵδ, CD3ϵγ, and CD3ζζ. The nature of the TCR signaling complex and subunit arrangement in different species remains unclear however. Here we present a structural and biochemical analysis of the more primitive ancestral form of the TCR signaling complex found in chickens. In contrast to mammals, chickens do not express separate CD3δ and CD3γ chains but instead encode a single hybrid chain, termed CD3δ/γ, that is capable of pairing with CD3ϵ. The NMR structure of the chicken CD3ϵδ/γ heterodimer revealed a unique dimer interface that results in a heterodimer with considerable deviation from the distinct side-by-side architecture found in human and murine CD3ϵδ and CD3ϵγ. The chicken CD3ϵδ/γ heterodimer also contains a unique molecular surface, with the vast majority of surface-exposed, nonconserved residues being clustered to a single face of the heterodimer. Using an in vitro biochemical assay, we demonstrate that CD3ϵδ/γ can assemble with both chicken TCRα and TCRβ via conserved polar transmembrane sites. Moreover, analogous to the human TCR signaling complex, the presence of two copies of CD3ϵδ/γ is required for ζζ assembly. These data provide insight into the evolution of this critical receptor signaling apparatus.

Introduction

The αβT cell receptor (TCR)7-CD3 complex represents an extensively studied transmembrane (TM) receptor system. In humans and other mammals, the TCR signaling complex comprises eight type-I membrane-spanning polypeptides that include the TCR αβ heterodimer, the CD3ϵγ and CD3ϵδ heterodimers, and the CD3ζζ homodimer (1), although higher order molecular assemblies are considered to exist (2, 3). The αβTCR functions to recognize peptide-, lipid-, and vitamin B precursor-based antigens that are presented by major histocompatibility complex (MHC) or MHC-like molecules (4–7). This ligand-sensing heterodimer has no intrinsic ability to transmit signals to the cell interior due to the short cytoplasmic tails of the α and β chains of the TCR. Instead, signaling is mediated by the CD3ϵγ, CD3ϵδ, and CD3ζζ subunits that associate with the TCR to produce a complex with a 1TCRαβ-1CD3ϵδ-1CD3ϵγ-1ζζ stoichiometry (1). The signaling subunits contain immunoreceptor tyrosine-based activation motifs (ITAMs) within their intracellular regions that become targets of the Src family kinase Lck upon receptor triggering; each CD3 heterodimer contributes two ITAMS to the signaling capacity of the TCR, whereas the ζζ homodimer contributes six (8–12). The precise mechanism by which signals are transmitted from the extracellular portion of TCR to the intracellular regions of CD3 is a major unresolved issue in T cell biology, with kinetic segregation, conformational change, mechanotransduction, and other models being proposed (13–18). The uncertainty surrounding TCR triggering mechanisms is in large part due to the lack of structural information on the intact TCR signaling complex.

The structures of mammalian CD3 heterodimer ectodomain fragments have been determined by x-ray crystallography and solution NMR (19–22). Analysis of their surface features, including the sites of activating monoclonal antibody binding and carbohydrate modifications, have suggested particular regions that are likely to be closely juxtaposed with the TCR ectodomains and may therefore play a role in transmission of ligand sensing from TCR to CD3 modules (17, 23–25). However, a detailed structural analysis of the extracellular interactions between TCR and CD3 subunits is complicated by the lack of any apparent affinity among these dimeric components in solution. A major energetic contribution to assembly of TCR and CD3 subunits appears to come from a network of polar interactions within the TM domains (26, 27). Both the TCRα and the TCRβ TM domains have a central lysine residue that recruits one CD3 heterodimer via a pair of acidic TM residues (28). Within the mature complex, CD3ϵδ associates exclusively via the TCRα TM domain and CD3ϵγ via the TCRβ TM domain to create an “asymmetric” hexamer. TCRα also contains an arginine residue in the upper half of the TM domain that mediates its interaction with the ζζ homodimer (28). The ζζ module will only join a preassembled CD3ϵδ-TCRαβ-CD3ϵγ hexamer, signaling the completion of assembly by masking an ER retention signal in CD3ϵδ (29) and allowing export to the cell surface.

The evolutionary basis for the inclusion of two globally similar CD3 modules in this receptor complex is unclear. There is evidence to suggest that the mammalian CD3δ and CD3γ subunits have evolved novel, nonredundant functions. Both CD3δ and CD3γ knock-out mice exhibit profound defects in the production of mature αβT cells, confirming that both CD3ϵδ and CD3ϵγ modules are absolutely required (30, 31). Furthermore, substitution of the extracellular immunoglobulin (Ig) domain of CD3γ with that of CD3δ failed to rescue surface TCR expression in CD3γ-deficient human Jurkat T cells (32), although exchange of TM and cytoplasmic domains was tolerated; thus the folded ectodomains, at least, are non-interchangeable. Nonetheless, the precise nature of their unique functional roles and the significance of their strictly asymmetric assembly with TCR remain unknown.

Chickens (ch) and the amphibian Xenopus laevis also express a CD3ϵ-like protein but do not express separate CD3δ and CD3γ chains. Instead, they encode a protein that shares equal homology with both mammalian CD3δ and CD3γ and has thus been designated CD3δ/γ (33). At the amino acid sequence level, chicken and human CD3ϵ, -δ, and -γ chains have low extracellular (32–34%) and high TM (44–52%) and intracellular (49–55%) sequence identity. Analysis of the CD3 locus suggests that mammalian CD3δ and CD3γ arose from a gene duplication event that occurred 230 million years ago (34). Accordingly, it is likely that the ch-CD3 represents a primordial form that has not diversified in a manner analogous to its mammalian counterpart. To provide further insight into the relationship between the mammalian TCR signaling complex and its evolutionary precursors, we have undertaken a structural and biochemical analysis of the chicken CD3 proteins and their assembly into the chicken TCR signaling complex. The solution NMR structure of the ch-CD3ϵδ/γ ectodomain dimer reveals significant differences from the mouse and human CD3 heterodimers in both domain orientation and surface chemistry. Furthermore, the ch-TCR signaling complex assembly demonstrates that despite the lack of CD3 asymmetry in the chicken receptor system, two CD3ϵδ/γ dimers are required to form a fully assembled complex that is capped by ζζ association.

EXPERIMENTAL PROCEDURES

Cloning, Expression, Refolding, and Purification of Chicken CD3

Gene fragments encoding the extracellular domains of mature ch-CD3ϵ (residues 24–91) and CD3δ/γ (residues 18–97) excluding the cysteine-rich stalks were synthesized de novo (GenScript). To generate a single chain construct, the C terminus of ch-CD3ϵ was covalently linked to the N terminus of ch-CD3δ/γ via a 26-amino acid flexible peptide using splice-by-overlap PCR. ch-CD3ϵδ/γ was cloned into a pET28b expression vector downstream of the thrombin-cleavable histidine tag and expressed as inclusion bodies in Escherichia coli BL21(DE3) cells. Inclusion bodies were solubilized in 0.2 m Tris-HCl (pH 9.5), 6 m guanidine HCl, 0.1 m DTT, 10 mm EDTA and refolded essentially as described (35). Refolded protein was buffer-exchanged into 10 mm Tris (pH 8) containing 0.5 m NaCl using tangential flow filtration prior to loading on a HisTrap HP nickel column (GE Healthcare) and eluted with 0.5 m imidazole. Histidine tag cleavage was performed using agarose-linked thrombin beads (Sigma) according to the manufacturer's instructions. The final purification step involved gel filtration chromatography using a Superdex75 16/60 column (GE Healthcare) pre-equilibrated in 25 mm HEPES (pH 7.6) containing 50 mm NaCl and 0.5 mm EDTA.

NMR

Suitable NMR buffer conditions were identified as 0.5 mm CD3, 50 mm HEPES, pH 7.6, 125 mm arginine, 125 mm glutamate, 0.01% azide, 0.01% Roche Applied Science protease inhibitor, 0.5 mm EDTA using crystallography dialysis buttons. All NMR samples contained 10% 2H2O, and the spectra were recorded at 293 K. The following NMR spectra were recorded on a Bruker AVANCETM 600-MHz spectrometer with cryoprobe using a 13C,15N-labeled CD3 sample: HNCA, HNCO, HBHA(CO)NH, (H)CCH-TOCSY, H(C)CH-TOCSY, 15N NOESY-HSQC (τm110 ms), HD(CDCG)CB and HE(CECDCG)CB. A 2H,13C,15N-CD3 sample was used to acquire transverse relaxation optimized spectroscopy versions of an HNCACB, HN(CO)CACB, HN(CA)CO, and HN(CO)CA on an 800-MHz Bruker AVANCE fitted with a cryoprobe, and 13C NOESY-HSQC (aliphatic) and 13C NOESY-HSQC (aromatic) (τm110 ms) spectra were acquired on the same spectrometer using the 13C,15N-labeled sample. Spectra were processed using Topspin version 3.0. Backbone amide, and CA, CB, HA, and HB resonances were assigned manually using XEasy (36). Automated side-chain assignments were made using the ASCAN algorithms of UNIO and verified and supplemented by manual assignments using the HCCH-TOCSY spectra.

Structures were calculated using the AtnosCandid automated NOE peak picking and assignment algorithms with CNS torsion angle dynamics starting from an extended chain. The resulting structures were refined in CNS using simulated annealing with Cartesian dynamics. During refinement, dihedral angle restraints predicted from TALOS were incorporated along with hydrogen bond restraints in regions of canonical secondary structure where unique donor-acceptor pairs could be identified by convergence. The 10 lowest energy conformers with no NOE violations >0.3 Å, no bond violations >0.05 Å, and no improper or dihedral angle violations >5° were chosen to represent the solution structure of CD3. The ch-CD3 structures have been deposited with the Protein Data Bank (PDB code: 2MIM), and the chemical shifts have been deposited with the BMRB (code 19687).

Epitope Tags and Affinity Reagents

Epitope tags were used to facilitate immunoprecipitation of chicken TCR components. In all cases, epitope tags were installed at the C terminus of protein with a Gly-Ser linker, which was encoded by the BamHI site used for cloning. Anti-HA-agarose beads (Sigma, A2095) were used to immunoprecipitate chains carrying the hemagglutinin (HA) epitope tag (GYPYDVPDYA). Streptavidin-conjugated beads (Sigma, S1638) were used to precipitate chains carrying the streptavidin-binding peptide (SBP) tag (DEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPSSSGGSKLG). Anti-protein C (PC)-agarose beads (Roche Applied Science, 11815024001) were used to immunoprecipitate chains carrying the PC tag (EDQVDPRLIDGK).

cDNA Constructs and in Vitro Transcription

cDNA encoding CD3ϵ, CD3δ/γ, and ζ were synthesized as G-blocks (Integrated DNA Technologies) and cloned into pSP64 (modified by M. Kozak). The chicken cell line MSB1 (37) was the source of cDNA to amplify by standard PCR conditions the coding sequence for TCRα chain (primers: forward CMGTGSGASRAAATGRATTTTS and reverse GCACCCAATGCTCCAGTAAT), which was cloned into the pJET3.1 vector (CloneJet, Fermentas), and for TCRβ chain (primers: forward TTCCSTGCTGGTTTCTTACG and reverse TCCTCTTCAAGGCAAAGCAT), which was cloned into the filled BamHI site of pGEM3zf (Promega). In all cases the natural signal sequence was replaced with that of mouse H2-Kb (MVPCTLLLLLAAALAPTQTRA), ensuring robust and equal targeting of all polypeptide chains to ER microsomes (38). Sequences were cloned into pSP64 constructs modified to append an HA, PC, SBP, or no tag (Gly-Ser) to the C terminus as appropriate and a poly(A) tail to the mRNA. mRNA was transcribed in vitro using the RiboMAX large scale RNA T7 production system (Promega, P1300) according to the manufacturer's instructions. m7G Cap analog (Promega, P1712) was supplied in 5-fold excess with respect to ribo-GTP to ensure that mRNA was correctly capped. After mRNA transcription, plasmid DNA was cleaved with RQ1 DNase (Promega, M6101), and mRNA was purified with an RNeasy mini kit (Qiagen, 74104). 25-μl transcription reactions typically yielded 60 μl of mRNA at a concentration of 250 μg/ml.

In Vitro Transcription and Assembly

Each mRNA was translated alone to ensure that targeting to ER microsomes, signal peptide cleavage, and glycosylation occurred as expected (data not shown). mRNA concentration was adjusted to ensure equivalent translation of each polypeptide. Adjustment factors were determined by densitometry (see below) of deglycosylated (endoglycosidase H-treated) samples. 25-μl in vitro translation reactions contained 17.5 μl of rabbit reticulocyte lysate (Promega, L4960), 0.5 μl of amino acids without Cys or Met (Promega, L5511), 0.5 μl of SUPERase·In (Promega, N2511), 2.0 μl of EXPRE35S35S protein labeling mix (PerkinElmer, NEG072002MC) containing [35S]Met and [35S]Cys, and 2 μl of ER microsomes (prepared as described previously (28)). Total mRNA concentrations were generally kept below 250 ng/reaction but varied depending on efficiency of translation as determined by test translation experiments. mRNA was denatured at 65 °C for 3 min prior to addition to lysate mixtures. mRNA was translated for 15–30 min at 30 °C, and then oxidized glutathione was added to a final concentration of 4 mm. Assembly proceeded in oxidizing conditions for 2 h (three chain experiments) or 4 h (five chain experiments). Reactions were stopped by the addition of 900 μl of ice-cold Tris-buffered saline containing 10 mm iodoacetamide. ER microsomes were pelleted at 20,000 × g for 10 min. Pellets were washed with an additional 500 μl to Tris-buffered saline containing 10 mm iodoacetamide. After discarding the wash, ER microsome pellets were extracted in 0.5% digitonin, 200 μg/ml BSA, 10 mm iodoacetamide for 30 min at 4 °C. For experiments involving anti-PC pulldown, 2 mm CaCl2 was included in the extraction buffer. Mixing controls were performed by translating and oxidizing certain mRNAs (detailed in the figure legends) in separate, half-volume in vitro translation reactions and mixing after reactions were stopped with ice-cold buffer.

Immunoprecipitation and Analysis

Digitonin extracts were passed through Spin-X filters (Corning, 8160) to remove insoluble material, and 10–15 μl of the appropriate affinity bead slurry was added to immunoprecipitate polypeptides of interest. Immunoprecipitations were incubated between 2 and 24 h before being washed. For nondenaturing elution, SBP pulldowns were eluted with 100 μm biotin in 0.5% digitonin containing 200 μg/ml BSA in Tris-buffered saline before being transferred to anti-HA-agarose for sequential immunoprecipitation. When nondenaturing elution was not required, samples were eluted by heating at 95 °C for 3 min in 10 μl of 0.5% SDS in 50 mm citrate, pH 5.6. Eluted complexes were incubated at 37 °C after the addition of 0.5 μl of endoglycosidase H (New England Biolabs, P0702) to remove sugar moieties. Deglycosylated chains were separated by 12% NuPAGE (Invitrogen, NP0341 or NP0343) in MES buffer (Invitrogen, NP0002) and blotted onto PVDF (Millipore, ISQ00010). To measure incorporated [35S]methionine and [35S]cysteine, PVDF membranes were placed on storage phosphor screens (BAS IP TR2040) and scanned by a Typhoon (GE Healthcare, FLA-9410). The gel files were converted to tiff format, and densitometry was performed using Image Gauge V4 software (Fujifilm). Data were plotted using Prism V5 (GraphPad Software Inc.).

RESULTS

For NMR structural studies we expressed, refolded, and purified a single-chain construct comprising the extracellular Ig domains of ch-CD3ϵ and ch-CD3δ/γ joined via a 26-amino acid flexible linker. Of the 178 residues present, backbone amide assignments could be made for all CD3ϵ residues with the exception of Gly13, and all CD3δ/γ residues except Ser27–Asn33 and His75–His77 (excluding the linker sequence). Approximately 85% of other nonlabile side-chain resonances were assigned (Table 1). A second set of resonances could be observed for CD3ϵ residues Ile11, Ser12, Thr17, Ile18, Thr19, Ser22, Trp29, Ile42, Asn43, His46, Asp47, Ser49, Ser54, Cys55, and His62, suggesting the presence of two conformations of CD3ϵ in slow exchange on the NMR timescale. Only the resonances of the major conformer (which represented 71% of total protein) were used for structure determination.

TABLE 1.

NMR and refinement statistics for the 10 Ch-CD3ϵδ/γ model structures

Nonredundant NOE distance restraints
    Total 1784
    Intra (i = j) 315
    Sequential (|i − j| = 1) 547
    Short (1 < |i − j| ≤ 5) 291
    Long (|i − j| > 5) 631
Dihedral angle restraints 158
Hydrogen bond restraints (2 per bond) 68
Deviations from experimental data
    NOEs (Å) 0.016 ± 0.001
    Dihedrals (°) 0.692 ± 0.071
Deviations from ideal geometry
    Bonds (Å) 0.0016 ± 0.0001
    Angles (°) 0.327 ± 0.006
    Impropers (°) 0.211 ± 0.012
Pairwise root mean standard deviation (Å) (residues 9–73,108–123,132–174)
    Backbone atoms 0.69 ± 0.10
    Heavy atoms 1.29 ± 0.10
Ramachandran statistics
    Residues in most favored regions 68.7%
    Residues in additional allowed regions 25.4%
    Residues in generously allowed regions 5.0%
    Residues in disallowed regions 0.9%

Chicken CD3 Domain Structure

The ch-CD3ϵ monomer forms an Ig domain comprising seven β-strands making up two antiparallel β-sheets (sheet 1, ABED, and sheet 2, CFG) that pack via a hydrophobic core and are bridged by a disulfide bond originating from two conserved cysteine residues (Cys20 and Cys55) (Fig. 1, A and B). Accordingly, ch-CD3ϵ belongs to the C1-set Ig fold but is atypical in that, like the CH1 antibody domains, it lacks the short C′ strand in sheet 2 (39). This is in contrast to both mouse and human CD3ϵ, which contain seven and eight β-strands and fall into the C2 and I-set Ig folds, respectively (20, 21).

FIGURE 1.

FIGURE 1.

Overview of the ch-CD3 NMR structure. A, ensemble of 10 final NMR structures of ch-CD3. Regions with secondary structure (as defined by STRIDE (54)) are colored red. B, ribbon diagram of ch-CD3 with the secondary structure of CD3ϵ shown in pink, and CD3δ/γ is shown in cyan. The cysteine residues that form intra-domain disulfide bonds are represented as red sticks. The single predicted N-linked glycosylation site in CD3δ/γ (Asn71) is shown as an orange sphere. The structures shown span from Glu-6ϵ to Val70ϵ and from Leu9δ/γ to Met79δ/γ and exclude the 26-amino acid linker. C, secondary structure-matched superimposition of human and chicken CD3ϵ chains (I). In II and III, the structure of ch-CD3δ/γ was aligned to that of human CD3δ and CD3γ, respectively. Human CD3 structures are colored gray, and ch-CD3 structures are in pink (CD3ϵ) or cyan (CD3δ/γ). Only residues that were assigned in the ch-CD3 structure and the corresponding residues in human CD3 are shown. Dashed lines highlight regions of significant structural deviation. D, amino acid sequence alignment of the immunoglobulin domains of human, mouse, and chicken CD3ϵ, δ, and γ chains. The secondary structure for human and chicken variants is displayed above and below the sequences, respectively. Potential N-linked glycosylation sites are highlighted in bold. * indicates absolutely conserved residues.

The ch-CD3ϵ Ig domain has low sequence identity with human (22%) and mouse (24%) CD3ϵ, but overall is structurally very similar with an r.m.s.d. of 1.65–1.75Å over the entire domain (61 Cα atoms). The primary deviations from the structure of human CD3ϵ are related to the configuration of the Ig domain and the length and conformation of loops connecting certain β-strands (Fig. 1CI). Two loop regions in ch-CD3ϵ are significantly different from the human CD3ϵ structure: the C-D loop, which in ch-CD3ϵ adopts a compact 310 helical turn, and the FG loop present at the membrane distal face, which forms a tight hairpin loop. Due to these differences, ch-CD3ϵ has a considerably diminished accessible surface area (4430 Å2) relative to the human CD3ϵ (5640 Å2).

ch-CD3δ/γ comprises two antiparallel β-sheets (sheet 1, ABE, and sheet 2, CC′FG) linked by a single disulfide bond between Cys24 and Cys64 and supported by a hydrophobic core comprising residues Leu22, Trp36, Leu51, Pro58, Tyr62, and Leu74 (Fig. 1, A and B). Accordingly, ch-CD3δ/γ adopts a C2-set Ig fold. The single N-linked glycosylation site at Asn71 is present within the FG loop (Fig. 1B) in a location that would likely protrude away from the cell membrane.

The ch-CD3δ/γ fold is similar to that observed for human CD3γ (20) but differs from the C1-set Ig fold found in human CD3δ due to a translocation of the D strand from the ABED face to the CFG face, where it becomes a C′ strand (Fig. 1, CII/III and D). Despite this difference, the remainder of the ch-CD3δ/γ domain is reasonably structurally conserved when compared with human CD3δ, with 47 Cα atoms having an r.m.s.d of 2.15 Å. However, ch-CD3δ/γ aligns relatively poorly to human CD3γ (r.m.s.d 2.5 Å over 50 Cα atoms) primarily due to a number of structural alterations distributed throughout the molecule. Apart from the DE loop (C′-E loop in human CD3γ), the major structural difference lies in the FG loop, which adopts a flattened conformation in ch-CD3δ/γ. In both human CD3γ and sheep CD3δ (this loop is not visible in the human CD3δ structure), the F-G loop extends away from the core of the CD3 module (20, 22).

The Chicken CD3 Heterodimer

The ch-CD3 subunits associate in a side-by-side manner, resulting in a buried surface area of 1,470 Å2. The heterodimer interface is dominated by interactions between the parallel G-strands, each of which contains a continuous string of residues (Asp59–Tyr65 in CD3ϵ and Asn71–His75 in CD3δ/γ) that come together to form an interlocking ladder (Fig. 2A). The CD3ϵδ/γ interface is further supported by contacts between the F-strand of CD3ϵ and a triplet of residues (Met11–Val13) at the base of the CD3δ/γ A-strand that make extensive van der Waals interactions with Thr52 and Tyr65 of CD3ϵ.

FIGURE 2.

FIGURE 2.

The ch-CD3 heterodimer. A, interactions at the ch-CD3ϵ-δ/γ interface. The interlocking ladder running along the parallel G-strands comprises residues Asp59ϵ–Tyr65ϵ (pink) and Asn71δγ–His75δ/γ (cyan). The interface is supported by contacts between the F-strand of CD3ϵ (residues Thr52ϵ and Ser54ϵ) and the A-strand of CD3δ/γ (Met11δ/γ–Val13δ/γ). B, the ch-CD3 heterodimer is shown in ribbon representation with the FG loop and G-strand of human CD3ϵ overlaid in red. The bulkier human CD3ϵ loop would clash extensively with the ch-CD3δ/γ subunit. C, surface representation showing side view (top) and top view (bottom) of ch-CD3. For comparison the structures of human CD3ϵδ (1XIW) and CD3ϵγ (1SY6) are shown. All structures were aligned via the CD3ϵ chain (pink). The black line connects the center of mass of the CD3 subunits. Center of mass calculations included only those residues for which NMR spectra were assigned (for ch-CD3) and the corresponding residues in the human CD3 variants. Subunits are colored as in Fig. 1.

Despite playing a central role at the heart of the ϵ-δ/γ interface, the conformation of the ch-CD3ϵ G-strand is considerably different from that found in human and murine CD3s (Fig. 2B). Due to a tight turn in the FG loop, the ch-CD3ϵ G-strand, which is extended at its base, packs tightly against the C-terminal portion of the F-strand, presenting an unusual surface to ch-CD3δ/γ (Fig. 2B). Accordingly, the nature of the CD3ϵ-CD3δ/γ interactions are distinct from those observed in human CD3s. For example, of the 8 CD3ϵ residues whose side chains contribute to the dimer interface, only Gln4 and Tyr65 are present in human CD3ϵ; and of the 10 interacting residues in CD3δ/γ, 3 are conserved with human CD3ϵγ and 4 are conserved with CD3ϵδ, most of which (Leu74, His77, Tyr78, and Arg79) lie at the base of the G-strand.

The unusual conformation adopted by the base of the CD3ϵ G-strand has a considerable impact on the overall domain organization, giving the ch-CD3 molecule an unusual appearance relative to all mammalian CD3 structures studied to date. Although human and mouse CD3 heterodimers have a distinctive upright arrangement, the ch-CD3 heterodimer has a more skewed/asymmetric configuration, as evidenced by the center of mass of the δ/γ subunit that is rotated by up to 45° when viewed from side-on and 35° viewed from the top relative to human CD3ϵδ (Fig. 2C). As a consequence, the overall structural similarity between ch-CD3ϵδ/γ and human CD3ϵδ is low, with an r.m.s.d of 3.6 Å over 106 Cα atoms.

Comparison of Molecular Surfaces in Chicken and Mammalian CD3

Human CD3ϵ and to a lesser extent mouse CD3ϵ contain a prominent negatively charged surface derived from the C′-D (37DEDD40) and D-E loops (46DED48) (20, 21) (Fig. 3A). In ch-CD3ϵ the bulky C′-D loop is notably absent, and in its place is a more compact and neutral 310 helix derived from Pro33–Leu35 (Fig. 1, CI and D). This, coupled with a change in the nature of the D-E loop, which contains a single basic residue (Lys40), contributes to the relatively flat, featureless appearance of ch-CD3ϵ (Fig. 3A). Although many of the amino acid residues conserved between chicken and human CD3 lie within the core and maintain the Ig fold, several conserved residues are surface-exposed. When mapped onto the structure of ch-CD3, these residues appear to cluster to a single face (the ϵ-ABE, δ/γ- C′CFG) and are particularly prominent in the membrane-proximal region adjacent to where the cysteine-rich stalks (not present in our construct) would protrude (Fig. 3B). In contrast, the opposing face (ϵ-CFG, δ/γ-ABE) is almost devoid of any conserved, surface-exposed residues.

FIGURE 3.

FIGURE 3.

The ch-CD3 molecular surface. A, positive and negative electrostatic surface potentials (blue and red, respectively) of chicken (left) and human (right) CD3ϵ. The view shown is focused on the B, D, and E strands. Although human CD3ϵ possesses a highly electronegative surface, ch-CD3ϵ is relatively neutral (white) in this region. B, surface-exposed conserved residues in human and chicken CD3. The ch-CD3 heterodimer is displayed as a surface representation in two orientations (left, ϵ-ABE, δ/γ-C′CFG; right, ϵ-CFG, δ/γ-ABE) with the CD3 chains colored as in Fig. 1. Residues conserved in human CD3 are colored as follows: CD3ϵ (orange), CD3δ and CD3γ (orange), CD3δ (red), and CD3γ (yellow). Amino acid residues shown are as in Fig. 1.

Incorporation of Chicken CD3ϵδ/γ into a Complete Chicken TCR Signaling Complex

To relate our structural insights on the isolated CD3 heterodimer to the broader picture of subunit organization within the complex, we performed a series of biochemical experiments interrogating the basis of chicken TCR complex assembly. Analysis of the TM domains of chicken TCRα and TCRβ chains reveals that basic residues are present at all the same positions as those in mammalian sequences (Fig. 4), and each CD3 chain contains the conserved acidic and hydroxyl-bearing TM residues that are crucial for human TCR signaling complex assembly. Interestingly, the first basic residue in the TCRα chain is a lysine rather than the typical arginine found in other vertebrates (including fish). We mutated each TCR TM lysine to alanine and assessed each mutant's ability to assemble with ch-CD3ϵδ/γ heterodimers in isolated ER microsomes using an established in vitro translation-based assay (28). To facilitate immunoprecipitation (IP) and SDS-PAGE analyses, HA and SBP tags were installed at the C termini of TCR and CD3ϵ polypeptides, respectively. Incorporation of 35S isotope-labeled methionine and cysteine during translation provided a quantitative method to measure the relative levels of each subunit recovered from digitonin extracts of the ER microsomes. Mutation of each central lysine residue in TCRα and TCRβ resulted in loss of CD3ϵδ/γ association with the individual TCR chains, whereas the lysine in the upper half of the TCRα TM had no effect (Fig. 5). Interestingly, the ability of TCRβ to support CD3ϵδ/γ assembly was ∼50% when compared with TCRα. This property is similar when human TCRβ is compared with TCRα for its ability to associate with CD3 heterodimers; TCRα-CD3ϵδ assembly is severalfold more efficient that TCRβ-CD3ϵγ assembly.

FIGURE 4.

FIGURE 4.

Alignments of human and chicken TCR and CD3 stalk, transmembrane, and intracellular juxtamembrane sequences. Residues that are identical between human (hu) and chicken sequences are marked with asterisks. In the comparison of chicken CD3δ/γ with human CD3δ and CD3γ, residues identical to human CD3δ are marked above the alignment, and those identical to human CD3γ are marked below the alignment. The predicted membrane-spanning regions based on analysis of TMHMM 2.0 scores (55) are shaded with gray rectangles. The polar TM residues that are known to be essential for assembly of the human TCR and CD3 subunits and the corresponding positions in the chicken sequences are marked in blue (basic), red (acidic), and orange (hydroxyl-bearing).

FIGURE 5.

FIGURE 5.

Both TCRα and TCRβ can bind CD3ϵδ/γ and the interaction is dependent on the central TM lysines. HA-tagged TCR chains were translated with CD3ϵ and CD3δ/γ in in vitro translation and immunoprecipitated with anti-HA-agarose. Shown is a representative gel of the species bound to the beads in each immunoprecipitation and a gel showing 5% of the input before immunoprecipitation. The data presented on the graph represent three repeats of the same experiment. Two-tailed t tests indicated that TCRα could pull down more CD3ϵδ/γ than TCRβ, but that the amount pulled down by TCRβ was still more than the mixing control where TCRβ and the CD3 mRNAs were translated in separate in vitro translation reactions and mixed prior to IP. ** indicates 0.001 < p ≤ 0.01, * indicates 0.01 < p ≤ 0.05, ns indicates p > 0.05.

We next tested the ability of ch-CD3ϵδ/γ to associate with a chicken TCRαβ heterodimer and ζζ homodimer in in vitro assembly reactions. To facilitate isolation of TCRαβ heterodimers for analysis, we installed an SBP tag on the TCRα chain and an HA tag on the TCRβ chain. This allowed the products of a first-step capture with streptavidin-coupled agarose beads to be gently eluted with biotin and reprobed with anti-HA-agarose beads to specifically isolate folded TCRαβ heterodimers. Densitometry measurements were used to determine the ratios of different CD3 subunits that co-precipitated with TCR. For these experiments, a PC epitope tag was installed at the C terminus of the CD3ϵ chain to improve electrophoretic separation from CD3δ/γ. Again, mutation of each central lysine residue of TCRα and TCRβ resulted in reduced CD3 association, but only when both chains lacked the central lysine residue was CD3ϵδ/γ recruitment to the complex completely abolished (Fig. 6). Surprisingly, mutation of a single lysine residue did not result in a 50% drop in CD3 association, implying that in the context of the whole receptor system, additional contacts may be made that partially compensate for loss of each lysine.

FIGURE 6.

FIGURE 6.

The central TM lysines of both TCRα and TCRβ are important for CD3ϵδ/γ recruitment in full assembly of the TCR signaling complex. SBP-tagged TCRα and HA-tagged TCRβ were translated with CD3ϵ, CD3δ/γ, and ζ, and a sequential immunoprecipitation for TCRα followed by TCRβ was used to select TCRαβ heterodimers. In the mixing control, TCRα and TCRβ were translated in a separate reaction from the CD3 and ζ components and mixed after stopping the assembly reaction. A 5% sample before immunoprecipitation was taken to ensure that input was similar. Densitometry of TCRαβ heterodimers and CD3 chains was performed, and the results were calculated as a ratio of CD3 heterodimer/TCR heterodimer. The contribution of individual TCRα and TCRβ chains to the CD3 signal was included in the ratio calculations. ** indicates 0.001 < p < 0.01, * indicates 0.01 < p < 0.05, and ns indicates p > 0.05.

In contrast to previous results in the human system (28), a clear product at the expected molecular weight of disulfide-linked chicken ζζ homodimer was not evident in the full assembly reactions. Because chicken ζζ migrates very close to free TCR chains when separated by SDS-PAGE, we used a ζ-chain IP strategy (via C-terminal PC tag) to determine what percentage of ζζ interacted with TCRαβ. We co-translated quantities of mRNA that produced TCRα, TCRβ, CD3ϵ, CD3δ/γ, and ζ proteins at a molar ratio of 5:5:10:10:1 and probed the digitonin extracts with anti-PC-coupled agarose beads. CD3ϵ was again tagged with SBP to facilitate separation from CD3δ/γ by SDS-PAGE. Anti-PC IP yielded substantial amounts of ζζ homodimer and monomeric ζ chain (both signal peptide-cleaved and uncleaved) in addition to TCRαβ, CD3ϵ, and CD3δ/γ chains, but only when all lysines in the TCR TM domains were present (Fig. 7). Densitometric ratios in the all-wild-type assembly reaction (lane 1) indicated that only ∼25% of ζζ was associated with TCRαβ, explaining why a prominent ζζ homodimer was not seen when TCRαβ was the IP target. Despite the lack of effect on CD3 heterodimer recruitment, mutation of the lysine in the upper half of the TCRα TM reduced TCRαβ recovery in the ζζ IP to near background levels. Mutation of the central lysines of TCRα and TCRβ also interrupted ζζ assembly. These results are consistent with the observation that in human TCR, ζζ is the final species to join the complex and prevention of CD3 association at either the TCRα or the TCRβ TM domain is sufficient to prevent ζζ recruitment (28).

FIGURE 7.

FIGURE 7.

ζ incorporation requires the upper TM lysine of TCRα and all CD3 chains. TCRα and TCRβ were translated with CD3ϵ-SBP, CD3δ/γ and ζ-PC with ζ at 10-fold lower concentration than CD3 chains and 5-fold lower than TCR chains. ζ was targeted for immunoprecipitation and the amount of co-precipitated TCR heterodimer was measured by densitometry. In mixing controls, TCRα and TCRβ mRNA were translated separately from CD3 and ζ chains and processed as described in the legend for Fig. 6. A 5% sample of the digitonin extraction was loaded on a gel as an input control. The ratio of TCR heterodimer to ζζ homodimer is graphed. * indicates 0.01 < p < 0.05.

DISCUSSION

All jawed vertebrates have an adaptive immune system that includes the genes to make antibodies, MHC and TCR (40). Furthermore, all mature TCR genes cloned to date (excluding pre-Tα (41, 42)) encode proteins with very short cytoplasmic domains that are unlikely to contain signaling motifs and are therefore thought to depend on CD3 or CD3-like signaling modules to transmit information to the intracellular signaling machinery (43). Analysis of CD3 loci across jawed vertebrate species suggests that the three genes present in mammals arose from two separate gene duplication events, the latter of which facilitated the divergence of CD3γ and CD3δ genes to produce two distinct CD3ϵγ and CD3ϵδ signaling modules. However, in non-mammalian species, the CD3 locus encodes only CD3ϵ and a second protein that has features similar to both CD3δ and CD3γ (34) and is likely to be their evolutionary precursor. Avian and mammalian CD3 proteins have diverged significantly enough that chicken and human TCR and CD3 are unable to form hybrid complexes (44), although the more highly conserved chicken ζ chain can replace its mouse counterpart in ζ-deficient T cells (45). In an effort to gain further insights into the evolutionary relationship among mammalian and non-mammalian CD3 components, we have determined the structure of the chicken CD3ϵδ/γ heterodimer extracellular domains and examined the biochemical requirements for incorporation of the CD3ϵδ/γ module into a complete chicken TCR signaling complex.

Herein we provide evidence that ch-CD3δ/γ is a genuine hybrid chain. Based on amino acid sequence, ch-CD3δ/γ is CD3δ-like in its extracellular domain and CD3γ-like in its intracellular region (34). However, our structure reveals that the extracellular region of ch-CD3δ/γ has a fold more reminiscent of that found in human CD3γ while retaining significant structural homology to CD3δ. The most striking feature of ch-CD3 is the unexpected domain juxtapositioning, which deviates significantly from the rigid, side-by-side, almost pseudosymmetric arrangement observed in murine and human CD3 dimers (20, 21). Surprisingly, this difference appears to stem from the more conserved CD3ϵ chain rather than from the hybrid CD3δ/γ chain.

Precisely how the unusual subunit arrangement in ch-CD3 impacts on the overall TCR signaling complex structure is unclear, but based on our structure, the ch-CD3 heterodimer is likely to present a unique molecular surface to the associated TCR. For example, an acidic patch on the surface of human CD3ϵ that has previously been suggested to participate in interactions with TCRβ (20) is notably absent in the chicken structure. It is noteworthy that the appearance of separate CD3δ and CD3γ chains in mammals correlates with the appearance of a surface-exposed loop (the FG loop) in the mammalian TCRβ constant domain (46), a region that has long been implicated in CD3ϵγ association (23, 25, 47–49). Given that one face of ch-CD3 (ϵ-CFG, δ/γ-ABE) contains several unique surface-exposed residues and the opposing face (ϵ-ABE, δ/γ-C′CFG) is decorated with residues conserved in human CD3, it is tempting to speculate that the latter may be involved in CD3ϵδ-TCRα interactions that have been conserved during evolution, whereas the former has diverged to accommodate the relatively newly evolved TCRβ surface. This hypothesis is supported by the observations that many of the conserved residues in the putative CD3ϵδ-TCRα interface are located in the membrane-proximal region, adjacent to the cysteine-rich stalks that have been previously implicated in association of the TCR and CD3 subunits (48, 50, 51).

What unique functional features may have accompanied the CD3 diversification in mammals remains an open question. One possibility is that development of separate CD3δ and CD3γ proteins was concomitant with incorporation of two CD3 dimers in the TCR signaling complex where the evolutionary precursor utilized only one. However, our analysis of chicken TCR and CD3 subunit assembly demonstrates that, as suggested by the conservation of basic residues in the TM domains of chicken TCRαβ, the chicken TCR associates with two copies of the CD3ϵδ/γ heterodimer in a manner that is analogous to the incorporation of both CD3ϵδ and CD3ϵγ modules in mammals (Fig. 8). Thus the octameric arrangement of one TCR with three dimeric signaling modules is an intrinsic feature of the TCR signaling complex even in organisms without separate CD3δ and CD3γ chains. This theme is echoed in the structure of the mouse γδTCR complex, which does not incorporate the CD3ϵδ module but instead contains two copies of CD3ϵγ (30, 52). Whether this symmetric CD3 arrangement confers any unique signaling properties on the mouse γδTCR is unclear, but it does not appear to be a general feature common to mammals because primary human γδ T cells contain both CD3ϵγ and CD3ϵδ (53). Determination of a chicken αβTCR structure would allow comparison of putative CD3-interacting surfaces among all of these receptor types to reveal whether particular features have co-evolved with asymmetric versus symmetric CD3 assemblies.

FIGURE 8.

FIGURE 8.

Schematic of the chicken TCR signaling complex. The gray disc represents the plasma membrane. Residues that are important in guiding TCR assembly are color-coded: light blue, lysine; red, aspartic acid. The extracellular domains are color-coded to identify each polypeptide: light blue, TCRα; green, TCRβ; orange, CD3ϵ; red, CD3δ/γ. ITAMs in the cytoplasmic tails of each species are represented as gray rectangles. Although this schematic implies that both CD3ϵ TM domains would fall closest to ζζ in the assembled complex, this information is not known, and this uncertainty is indicated with question marks.

A notable feature is that, like human TCRβ, the chicken TCRβ is less efficient than its α chain counterpart in associating with CD3 in three-chain assembly experiments (28). This property in human TCR is expected to ensure that the requisite asymmetric arrangement of CD3 heterodimers is achieved during biosynthesis. Observation of a similar phenomenon in the chicken TCR, where no such asymmetry exists, suggests that this feature is intrinsic to the TCRα and TCRβ proteins and may reflect a fundamental requirement for cooperative assembly with the two CD3 modules. Accordingly, we consistently recovered more ch-TCRαβ heterodimer in samples where only one of the central lysine residues was mutated to alanine when compared with samples where both were mutated (Figs. 5 and 6), and poorest TCRαβ heterodimer formation was seen in control reactions where α and β chains are folded in the absence of CD3. TCRαβ formation and assembly with two CD3 modules are thus cooperatively linked. As in human TCR, joining of the ζζ homodimer appears to be the final step in chicken TCR assembly. It is unusual that the interaction between ζζ and TCR is mediated by a lysine instead of an arginine in the TM domain of TCRα because in the human TCR, mutation of this arginine to lysine results in a significant drop in affinity for ζζ (28). Indeed, the chicken TCR is comparatively poor at recruiting the ζζ homodimer based on our biochemical analysis. Whether this has functional consequences for chicken TCR signaling or is simply an artifact introduced by detergent extraction is unclear.

The unique structural features of ch-CD3 described here may reflect the distinctive demands of a symmetric CD3 assembly with the inherently asymmetric TCR; although human CD3ϵδ and CD3ϵγ each appear to have evolved unique surface features that optimize extracellular complementarity with TCRα and TCRβ, respectively, the ch-CD3ϵδ/γ surface must complement both TCR constant domains simultaneously. Due to its reduced subunit complexity when compared with the mammalian receptor, the chicken TCR signaling complex may represent a more tractable experimental system for studying ectodomain interactions between the TCR and CD3 subunits. Further structural studies on the chicken proteins may therefore provide access to some of the more conserved features of the TCR signaling complex molecular organization that will impact on our models of receptor function.

Acknowledgment

We thank Biswaranjan Mohanty for assistance with data collection.

*

This work was supported by an Australian Research Council (ARC) grant.

The atomic coordinates and structure factors (code 2MIM) have been deposited in the Protein Data Bank (http://wwpdb.org/).

The ch-CD3 chemical shifts have been submitted to the Biological Magnetic Resonance Bank (BMRB) (accession number 19687).

7
The abbreviations used are:
TCR
T cell receptor
TM
transmembrane
ITAM
immunoreceptor tyrosine-based activation motif
ER
endoplasmic reticulum
PC
protein C
ch
chicken
SBP
streptavidin-binding peptide
HSQC
heteronuclear single quantum correlation
TOCSY
total correlation nuclear spectroscopy
r.m.s.d.
root mean square deviation
IP
immunoprecipitation.

REFERENCES

  • 1. Call M. E., Pyrdol J., Wucherpfennig K. W. (2004) Stoichiometry of the T-cell receptor-CD3 complex and key intermediates assembled in the endoplasmic reticulum. EMBO J. 23, 2348–2357 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2. Schamel W. W., Alarcón B. (2013) Organization of the resting TCR in nanoscale oligomers. Immunol. Rev. 251, 13–20 [DOI] [PubMed] [Google Scholar]
  • 3. Schamel W. W., Arechaga I., Risueño R. M., van Santen H. M., Cabezas P., Risco C., Valpuesta J. M., Alarcón B. (2005) Coexistence of multivalent and monovalent TCRs explains high sensitivity and wide range of response. J. Exp. Med. 202, 493–503 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4. Birkinshaw R. W., Kjer-Nielsen L., Eckle S. B. G., McCluskey J., Rossjohn J. (2014) MAITs, MR1 and vitamin B metabolites. Curr. Opin. Immunol. 26, 7–13 [DOI] [PubMed] [Google Scholar]
  • 5. Eckle S. B., Turner S. J., Rossjohn J., McCluskey J. (2013) Predisposed αβT cell antigen receptor recognition of MHC and MHC-I like molecules? Curr. Opin. Immunol. 25, 653–659 [DOI] [PubMed] [Google Scholar]
  • 6. Gras S., Burrows S. R., Turner S. J., Sewell A. K., McCluskey J., Rossjohn J. (2012) A structural voyage toward an understanding of the MHC-I-restricted immune response: lessons learned and much to be learned. Immunol. Rev. 250, 61–81 [DOI] [PubMed] [Google Scholar]
  • 7. Rossjohn J., Pellicci D. G., Patel O., Gapin L., Godfrey D. I. (2012) Recognition of CD1d-restricted antigens by natural killer T cells. Nat. Rev. Immunol. 12, 845–857 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8. Irving B. A., Weiss A. (1991) The cytoplasmic domain of the T cell receptor ζ chain is sufficient to couple to receptor-associated signal transduction pathways. Cell 64, 891–901 [DOI] [PubMed] [Google Scholar]
  • 9. Letourneur F., Klausner R. D. (1992) Activation of T cells by a tyrosine kinase activation domain in the cytoplasmic tail of CD3ϵ. Science 255, 79–82 [DOI] [PubMed] [Google Scholar]
  • 10. Romeo C., Amiot M., Seed B. (1992) Sequence requirements for induction of cytolysis by the T cell antigen/Fc receptor ζ chain. Cell 68, 889–897 [DOI] [PubMed] [Google Scholar]
  • 11. Samelson L. E., Patel M. D., Weissman A. M., Harford J. B., Klausner R. D. (1986) Antigen activation of murine T cells induces tyrosine phosphorylation of a polypeptide associated with the T cell antigen receptor. Cell 46, 1083–1090 [DOI] [PubMed] [Google Scholar]
  • 12. Samelson L. E., Phillips A. F., Luong E. T., Klausner R. D. (1990) Association of the fyn protein-tyrosine kinase with the T-cell antigen receptor. Proc. Natl. Acad. Sci. U.S.A. 87, 4358–4362 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13. Beddoe T., Chen Z., Clements C. S., Ely L. K., Bushell S. R., Vivian J. P., Kjer-Nielsen L., Pang S. S., Dunstone M. A., Liu Y. C., Macdonald W. A., Perugini M. A., Wilce M. C., Burrows S. R., Purcell A. W., Tiganis T., Bottomley S. P., McCluskey J., Rossjohn J. (2009) Antigen ligation triggers a conformational change within the constant domain of the αβT cell receptor. Immunity 30, 777–788 [DOI] [PubMed] [Google Scholar]
  • 14. Gil D., Schamel W. W., Montoya M., Sánchez-Madrid F., Alarcón B. (2002) Recruitment of Nck by CD3ϵ reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Cell 109, 901–912 [DOI] [PubMed] [Google Scholar]
  • 15. Minguet S., Swamy M., Alarcón B., Luescher I. F., Schamel W. W. (2007) Full activation of the T cell receptor requires both clustering and conformational changes at CD3. Immunity 26, 43–54 [DOI] [PubMed] [Google Scholar]
  • 16. Risueño R. M., Gil D., Fernández E., Sánchez-Madrid F., Alarcón B. (2005) Ligand-induced conformational change in the T-cell receptor associated with productive immune synapses. Blood 106, 601–608 [DOI] [PubMed] [Google Scholar]
  • 17. van der Merwe P. A., Dushek O. (2011) Mechanisms for T cell receptor triggering. Nat. Rev. Immunol. 11, 47–55 [DOI] [PubMed] [Google Scholar]
  • 18. Chen W., Zhu C. (2013) Mechanical regulation of T-cell functions. Immunol. Rev. 256, 160–176 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19. Arnett K. L., Harrison S. C., Wiley D. C. (2004) Crystal structure of a human CD3-ϵ/δ dimer in complex with a UCHT1 single-chain antibody fragment. Proc. Natl. Acad. Sci. U.S.A. 101, 16268–16273 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20. Kjer-Nielsen L., Dunstone M. A., Kostenko L., Ely L. K., Beddoe T., Mifsud N. A., Purcell A. W., Brooks A. G., McCluskey J., Rossjohn J. (2004) Crystal structure of the human T cell receptor CD3ϵγ heterodimer complexed to the therapeutic mAb OKT3. Proc. Natl. Acad. Sci. U.S.A. 101, 7675–7680 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21. Sun Z. J., Kim K. S., Wagner G., Reinherz E. L. (2001) Mechanisms contributing to T cell receptor signaling and assembly revealed by the solution structure of an ectodomain fragment of the CD3ϵγ heterodimer. Cell 105, 913–923 [DOI] [PubMed] [Google Scholar]
  • 22. Sun Z. Y., Kim S. T., Kim I. C., Fahmy A., Reinherz E. L., Wagner G. (2004) Solution structure of the CD3ϵδ ectodomain and comparison with CD3ϵγ as a basis for modeling T cell receptor topology and signaling. Proc. Natl. Acad. Sci. U.S.A. 101, 16867–16872 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23. Kuhns M. S., Davis M. M., Garcia K. C. (2006) Deconstructing the form and function of the TCR/CD3 complex. Immunity 24, 133–139 [DOI] [PubMed] [Google Scholar]
  • 24. Brenner M. B., Trowbridge I. S., Strominger J. L. (1985) Cross-linking of human T cell receptor proteins: association between the T cell idiotype β subunit and the T3 glycoprotein heavy subunit. Cell 40, 183–190 [DOI] [PubMed] [Google Scholar]
  • 25. Ghendler Y., Smolyar A., Chang H. C., Reinherz E. L. (1998) One of the CD3ϵ subunits within a T cell receptor complex lies in close proximity to the Cβ FG loop. J. Exp. Med. 187, 1529–1536 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26. Alcover A., Mariuzza R. A., Ermonval M., Acuto O. (1990) Lysine 271 in the transmembrane domain of the T-cell antigen receptor β chain is necessary for its assembly with the CD3 complex but not for α/β dimerization. J. Biol. Chem. 265, 4131–4135 [PubMed] [Google Scholar]
  • 27. Blumberg R. S., Alarcon B., Sancho J., McDermott F. V., Lopez P., Breitmeyer J., Terhorst C. (1990) Assembly and function of the T cell antigen receptor. Requirement of either the lysine or arginine residues in the transmembrane region of the α chain. J. Biol. Chem. 265, 14036–14043 [PubMed] [Google Scholar]
  • 28. Call M. E., Pyrdol J., Wiedmann M., Wucherpfennig K. W. (2002) The organizing principle in the formation of the T cell receptor-CD3 complex. Cell 111, 967–979 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29. Delgado P., Alarcón B. (2005) An orderly inactivation of intracellular retention signals controls surface expression of the T cell antigen receptor. J. Exp. Med. 201, 555–566 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30. Dave V. P., Cao Z., Browne C., Alarcon B., Fernandez-Miguel G., Lafaille J., de la Hera A., Tonegawa S., Kappes D. J. (1997) CD3δ deficiency arrests development of the αβ but not the γδ T cell lineage. EMBO J. 16, 1360–1370 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31. Haks M. C., Krimpenfort P., Borst J., Kruisbeek A. M. (1998) The CD3γ chain is essential for development of both the TCRαβ and TCRγδ lineages. EMBO J. 17, 1871–1882 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32. Wegener A. M., Hou X., Dietrich J., Geisler C. (1995) Distinct domains of the CD3-γ chain are involved in surface expression and function of the T cell antigen receptor. J. Biol. Chem. 270, 4675–4680 [DOI] [PubMed] [Google Scholar]
  • 33. Bernot A., Auffray C. (1991) Primary structure and ontogeny of an avian CD3 transcript. Proc. Natl. Acad. Sci. U.S.A. 88, 2550–2554 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34. Göbel T. W., Dangy J. P. (2000) Evidence for a stepwise evolution of the CD3 family. J. Immunol. 164, 879–883 [DOI] [PubMed] [Google Scholar]
  • 35. Dunstone M. A., Kjer-Nielsen L., Kostenko L., Purcell A. W., Brooks A. G., Rossjohn J., McCluskey J. (2004) The production and purification of the human T-cell receptors, the CD3ϵγ and CD3ϵδ heterodimers: complex formation and crystallization with OKT3, a therapeutic monoclonal antibody. Acta Crystallogr. D Biol. Crystallogr. 60, 1425–1428 [DOI] [PubMed] [Google Scholar]
  • 36. Bartels C., Xia T. H., Billeter M., Güntert P., Wüthrich K. (1995) The program XEASY for computer-supported NMR spectral analysis of biological macromolecules. J. Biomol. NMR 6, 1–10 [DOI] [PubMed] [Google Scholar]
  • 37. Akiyama Y., Kato S. (1974) Two cell lines from lymphomas of Marek's disease. Biken J. 17, 105–116 [PubMed] [Google Scholar]
  • 38. Huppa J. B., Ploegh H. L. (1997) In vitro translation and assembly of a complete T cell receptor-CD3 complex. J. Exp. Med. 186, 393–403 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39. Harpaz Y., Chothia C. (1994) Many of the immunoglobulin superfamily domains in cell adhesion molecules and surface receptors belong to a new structural set which is close to that containing variable domains. J. Mol. Biol. 238, 528–539 [DOI] [PubMed] [Google Scholar]
  • 40. Laird D. J., De Tomaso A. W., Cooper M. D., Weissman I. L. (2000) 50 million years of chordate evolution: seeking the origins of adaptive immunity. Proc. Natl. Acad. Sci. U.S.A. 97, 6924–6926 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41. Pang S. S., Berry R., Chen Z., Kjer-Nielsen L., Perugini M. A., King G. F., Wang C., Chew S. H., La Gruta N. L., Williams N. K., Beddoe T., Tiganis T., Cowieson N. P., Godfrey D. I., Purcell A. W., Wilce M. C. J., McCluskey J., Rossjohn J. (2010) The structural basis for autonomous dimerization of the pre-T-cell antigen receptor. Nature 467, 844–848 [DOI] [PubMed] [Google Scholar]
  • 42. Saint-Ruf C., Ungewiss K., Groettrup M., Bruno L., Fehling H. J., von Boehmer H. (1994) Analysis and expression of a cloned pre-T cell receptor gene. Science 266, 1208–1212 [DOI] [PubMed] [Google Scholar]
  • 43. Berry R., Chen Z., McCluskey J., Rossjohn J. (2011) Insight into the basis of autonomous immunoreceptor activation. Trends Immunol. 32, 165–170 [DOI] [PubMed] [Google Scholar]
  • 44. Gouaillard C., Huchenq-Champagne A., Arnaud J., Chen Cl C. L., Rubin B. (2001) Evolution of T cell receptor (TCR) αβ heterodimer assembly with the CD3 complex. Eur. J. Immunol. 31, 3798–3805 [DOI] [PubMed] [Google Scholar]
  • 45. Göbel T. W., Bolliger L. (1998) The chicken TCR ζ-chain restores the function of a mouse T cell hybridoma. J. Immunol. 160, 1552–1554 [PubMed] [Google Scholar]
  • 46. Kim S. T., Touma M., Takeuchi K., Sun Z. Y., Dave V. P., Kappes D. J., Wagner G., Reinherz E. L. (2010) Distinctive CD3 heterodimeric ectodomain topologies maximize antigen-triggered activation of αβT cell receptors. J. Immunol. 185, 2951–2959 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47. Kuhns M. S., Davis M. M. (2007) Disruption of extracellular interactions impairs T cell receptor-CD3 complex stability and signaling. Immunity 26, 357–369 [DOI] [PubMed] [Google Scholar]
  • 48. Touma M., Chang H. C., Sasada T., Handley M., Clayton L. K., Reinherz E. L. (2006) The TCR Cβ FG loop regulates αβT cell development. J. Immunol. 176, 6812–6823 [DOI] [PubMed] [Google Scholar]
  • 49. Tjoelker L. W., Carlson L. M., Lee K., Lahti J., McCormack W. T., Leiden J. M., Chen C. L., Cooper M. D., Thompson C. B. (1990) Evolutionary conservation of antigen recognition: the chicken T-cell receptor β chain. Proc. Natl. Acad. Sci. U.S.A. 87, 7856–7860 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50. Wang Y., Becker D., Vass T., White J., Marrack P., Kappler J. W. (2009) A conserved CXXC motif in CD3ϵ is critical for T cell development and TCR signaling. PLoS Biol. 7, e1000253. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51. Xu C., Call M. E., Wucherpfennig K. W. (2006) A membrane-proximal tetracysteine motif contributes to assembly of CD3δϵ and CD3γϵ dimers with the T cell receptor. J. Biol. Chem. 281, 36977–36984 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52. Hayes S. M., Love P. E. (2006) Stoichiometry of the murine γδ T cell receptor. J. Exp. Med. 203, 47–52 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53. Siegers G. M., Swamy M., Fernández-Malavé E., Minguet S., Rathmann S., Guardo A. C., Pérez-Flores V., Regueiro J. R., Alarcón B., Fisch P., Schamel W. W. (2007) Different composition of the human and the mouse γδ T cell receptor explains different phenotypes of CD3γ and CD3δ immunodeficiencies. J. Exp. Med. 204, 2537–2544 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54. Heinig M., Frishman D. (2004) STRIDE: a web server for secondary structure assignment from known atomic coordinates of proteins. Nucleic Acids Res. 32, W500–W502 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55. Krogh A., Larsson B., von Heijne G., Sonnhammer E. L. (2001) Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J. Mol. Biol. 305, 567–580 [DOI] [PubMed] [Google Scholar]

Articles from The Journal of Biological Chemistry are provided here courtesy of American Society for Biochemistry and Molecular Biology

RESOURCES