Skip to main content
Acta Pharmacologica Sinica logoLink to Acta Pharmacologica Sinica
. 2009 Jun 5;30(6):828–841. doi: 10.1038/aps.2009.78

Nicotinic acetylcholine receptor α7 subunits with a C2 cytoplasmic loop yellow fluorescent protein insertion form functional receptors

Teresa A Murray 1,2, Qiang Liu 1,*, Paul Whiteaker 1, Jie Wu 1, Ronald J Lukas 1
PMCID: PMC4002364  PMID: 19498423

Abstract

Aim:

Several nicotinic acetylcholine receptor (nAChR) subunits have been engineered as fluorescent protein (FP) fusions and exploited to illuminate features of nAChRs. The aim of this work was to create a FP fusion in the nAChR α7 subunit without compromising formation of functional receptors.

Methods:

A gene construct was generated to introduce yellow fluorescent protein (YFP), in frame, into the otherwise unaltered, large, second cytoplamsic loop between the third and fourth transmembrane domains of the mouse nAChR α7 subunit (α7Y). SH-EP1 cells were transfected with mouse nAChR wild type α7 subunits (α7) or with α7Y subunits, alone or with the chaperone protein, hRIC-3. Receptor function was assessed using whole-cell current recording. Receptor expression was measured with 125I-labeled α-bungarotoxin (I-Bgt) binding, laser scanning confocal microscopy, and total internal reflectance fluorescence (TIRF) microscopy.

Results:

Whole-cell currents revealed that α7Y nAChRs and α7 nAChRs were functional with comparable EC50 values for the α7 nAChR-selective agonist, choline, and IC50 values for the α7 nAChR-selective antagonist, methyllycaconitine. I-Bgt binding was detected only after co-expression with hRIC-3. Confocal microscopy revealed that α7Y had primarily intracellular rather than surface expression. TIRF microscopy confirmed that little α7Y localized to the plasma membrane, typical of α7 nAChRs.

Conclusion:

nAChRs composed as homooligomers of α7Y subunits containing cytoplasmic loop YFP have functional, ligand binding, and trafficking characteristics similar to those of α7 nAChRs. α7Y nAChRs may be used to elucidate properties of α7 nAChRs and to identify and develop novel probes for these receptors, perhaps in high-throughput fashion.

Keywords: nicotinic receptor, fluorescent protein, confocal microscopy, protein engineering, protein expression, receptor trafficking; RIC-3, electrophysiology, dose-response relationship, radiotoxin binding

Introduction

Green fluorescent protein, its homologs and paralogs, and its artificial, spectrally-shifted mutants (collectively termed FPs), when genetically fused to proteins of interest, allow new and powerful means for examining protein expression and interactions1. Fluorescently tagged protein expression levels, localization and trafficking can be monitored spatially and temporally. Properties such as subunit assembly and chaperone/accessory protein interactions can be assessed using proteins labeled with different FPs and techniques such as fluorescence resonance energy transfer and colocalization2, 3. However, whether it be an epitope tag or a FP, insertion of an extra sequence into a protein can affect target protein properties and function2, 4, 5. FPs are ∼27-kDa proteins comprised of ∼239 amino acids in a β-barrel conformation2, 6. Optimal placement of the bulky, FP fusion tag is critical to minimize impairment of the native function of the protein. Potential effects range from incorrect folding, trafficking, and endocytosis of transmembrane membrane proteins to disruption of ligand binding and protein-protein interaction sites2, 7, 8.

To date, several types of nicotinic acetylcholine receptor (nAChR) subunits have been constructed with fluorescent protein fusions. These subunit-FP fusions have revealed much about nicotinic receptors, such as their subunit stoichiometry, changes in expression levels and location of subtypes in the brain9, 10. Whereas tagging the extracellular region with an FP provides an accessible tag for FP-targeted antibody staining and for trafficking studies11, 12, it has been reported to interfere with endocytosis8 and to modify receptor function4. Alternatively, placing the FP in an intracellular domain might obviate these concerns; however, inserting it in this location presents other challenges including interruption of trafficking domains and phosphorylation sites, which could disrupt function7. Fortunately, several fluorescently tagged Cys-loop receptor subunits have been made with the FP inserted into the second, large intracellular loop (C2) between the third (M3) and fourth (M4) transmembrane domains; and these assembled receptors appear fully functional by several criteria9, 10, 13, 14, 15. However this suite does not yet include a nAChR α7 subunit with a C2 FP fusion.

α7 nAChRs, composed as homooligomers of α7 subunits, are expressed in the autonomic nervous system, and they are among the most abundant nAChR subtypes in the brain16, 17. α7 nAChRs appear to be involved in a wide range of normal functions, including attention, cognitive processing, learning and memory, and neuroprotection18, 19. Additionally, their involvement has been implicated in nicotine dependence and in several neuropsychiatric pathologies, including schizophrenia and Alzheimer's disease20, 21. Nevertheless, the understanding remains incomplete about α7 nAChRs and all of their roles in health and disease.

We chose to introduce FPs into the otherwise intact and unmodified C2 domain of the mouse nAChR α7 subunit, where we postulated that the insert would have minimal, if any, impact on ligand binding and functional features of α7 nAChRs. We selected an approach involving heterologous expression of these fusion proteins composed of α7 subunits to provide proof of principle and to allow assessment of the impact of FP introduction. We demonstrated that levels of expression and functional properties of nAChR composed of wild-type α7 subunits or of yellow FP-tagged (α7Y) subunits are comparable, we exploited α7Y nAChR fluorescence to track receptor subcellular distribution, and we showed that both α7 nAChR and α7Y nAChR levels increased when co-expressed with the chaperone protein, hRIC-3. This fluorescent receptor was designed for and appears fit for uses that should provide greater insights into the structure, function and cell biology of α7 nAChRs relevant to their roles in nervous system function and disease.

Materials and methods

Cloning of mouse nAChR α7subunit cDNA Total RNA from mouse brain (Applied Biosystems/Ambion, Austin, TX) was used to synthesize first-strand cDNA using the SuperScript III First-Strand Synthesis System for RT-PCR (Invitrogen Corp, Carlsbad, CA) according to the manufacturer's instructions. Briefly, 5 μL of a stock solution of 1 μg/μL of total RNA from mouse brain, 1 μL of 50 μmol/L oligo(dT), 1 μL of 10 μmol/L dNTP mix and 3 μL of DEPC-treated water were mixed, incubated at 65 °C for 5 min, and then chilled on ice for 1 minute. A cDNA synthesis mix was added, and it contained 2 μL of 10×reverse transcriptase (RT) buffer, 4 μL of 25 mmol/L MgCl2, 2 μL of 0.1 mol/L DTT, 1 μL of RNaseOUTTM (40 U/μL), and 1 μL of SuperScriptTM III (200 U/μL). The solution was incubated at 50 °C for 50 min, and then the reaction was terminated by heat inactivation at 85 °C for 5 min followed by chilling on ice. After cooling, 1 μL of E coli RNase H (2 U/μL) was added, and the solution was incubated at 37 °C for 20 min then chilled on ice. Aliquots of cDNA stock solution (0.1 μg/μL) were prepared and stored at -20 °C.

Primers for polymerase chain reaction (PCR) were designed to specifically amplify cDNA corresponding to the α7 gene, including parts of 5′- and 3′-, non-coding regions, and to insert flanking restriction enzyme (RE) sites with 4-base leader sequences to facilitate hybridization at the RE sites. The forward and reverse strand primer sequences were 5′-A TAT GGA TCC GGG ACA CGG CGG CTG CTC-3′ and 5′-G CGC TCT AGA CTA AGA TCT ACC CTG TAG G-3′, respectively. Primers were synthesized by Operon (Huntsville, AL). The RE sites underlined are for BamHI and XbaI. The PCR reaction consisted of 22 μL of PCR SuperMix High Fidelity polymerase mixture (Invitrogen Corp), 3 μL (0.1 μg/μL) of nAChR α7 subunit cDNA, and 3 μL of each primer (100 μmol/L). Thirty-five cycles of PCR, 1 min at 95 °C, 1 min 30 s at 55 °C and 2 min 30 s at 72 °C, followed by a 4 min extension at 72 °C, were performed using a Stratagene Robocycler (Stratagene, La Jolla, CA). A sample of the reaction was run on 0.8% agarose gel with ethidium bromide, allowing identification of a single product of the expected size of 2200 base-pairs. The remaining reaction was cleaned using a Wizard SV Gel and PCR Purification System (Promega, Madison, WI) according to the manufacturer's instructions.

Cleaned cDNA was immediately subcloned into pGEM-T-Easy (Promega) in an overnight ligation at 14 °C, and 5 μL of the ligation product was used to transform competent, DH5α bacteria. Colonies were selected using blue/white screening per manufacturer's directions and grown overnight in CIRCLEGROW® (MP Biomedicals, Solon, OH). Purified DNA was isolated using a Quantum Prep® miniprep kit (Bio-Rad Laboratories, Hercules, CA). DNA sequencing was performed on selected clones (University of Arizona DNA Sequencing Lab, Tucson, AZ; U of A) using primers to generate overlapping segments in both the forward and reverse directions.

Construction of fluorescently-labeled, α7 subunit-YFP fusion proteins (α7Y) Overlapping PCR was used with primers designed to insert a combined hemagglutinin (HA) and enhanced YFP tag, in frame, into the C2 loop of the mouse α7 subunit. The HA immunohistochemical tag had already been placed 5′ or N-terminal to the gene for enhanced yellow YFP9. Three oligonucleotide segments were generated by separate PCR reactions, as follows: “A,” encoding the mouse nAChR α7 subunit from part of the 5′-flanking region through amino acid 412; “B,” encoding the HA-YFP insert; and “C,” encoding the α7 subunit from amino acid 413 through part of the 3'-flanking region. Segments A and C were created using the previously-generated, pGEM-T-Easy-α7 plasmid as a template. A construct for the mouse nAChR α4 subunit gene containing the HA-YFP fusion protein, a kind gift from Dr Henry Lester9, served as the template DNA for B. For segment A, the forward primer was 5′-TAA TAC GAC TCA CTA TAG GG-3′ which hybridized to the T7 promoter region of the pGEM-T-Easy-α7 vector; the reverse primer, 5′-TGG GAC GTC ATA AGG ATA GCA GGC CAA ACG ACC ACA-3′ added an 18-base overlapping sequence for B to nucleotides corresponding to the 3′ region of A. Similarly, for segment B, the forward primer, 5′-TGT GGT CGT TTG GCC TGC TAT CCT TAT GAC GTC CCA-3′ added an 18-base sequence overlapping segment A. In the same manner, the reverse primer, 5′-CTC ATC ATG TGT TGG GGA CTT GTA CAG CTC GTC CAT-3′ added a 3′ sequence of 18 bases overlapping C. Likewise, the segment C forward primer, 5′-ATG GAC GAG CTG TAC AAG TCC CCA ACA CAT GAT GAG-3′ contained an 18-base overlapping sequence for B; the reverse primer sequence was 5′-GAT TTA GGT GAC ACT ATA G-3′ which hybridized to the SP6 region of the pGEM-T-Easy-α7 vector. Thirty-five cycles of PCR, 1 min at 95 °C, 1 min 30 s at 55 °C and 1 min 30 s at 72 °C, followed by a 4 min extension at 72 °C generated the three segments. Each segment was gel purified using the Wizard SV system described previously.

Overlapping PCR was used to join B and C with a 1:10 molar ratio of B:C. To create a BC template, 5 cycles of 1 min at 95 °C, 1 min 30 s at 55 °C and 2 min at 72 °C, were run with of 100 μL of SuperMix High Fidelity, 20 ng of B and 200 ng of C. After the 5th cycle, the forward primer for B and the reverse primer for C were added (3 μL each, 10 μmol/L) and 30 additional cycles were run, followed by a 4 min extension at 72 °C. In like manner, A was joined to (BC) using the previous procedure, with an A:(BC) mass ratio of 1:10. The extension time was lengthened to 3 min; 50 μLof SuperMix and 1 μL each of the A forward and C reverse primers were used. Gel purification, as previously described, was performed after each overlapping PCR step. The final PCR product was subcloned into pGEM-T-Easy and sequenced, (U of A).

Subcloning genes into mammalian expression vectors After sequence verification, both the wild type nAChR α7 subunit gene and the α7Y gene construct were released from the cloning vector by digestion with BamHI and XbaI and subcloned into a mammalian expression vector, pcDNA3.1+ with a hygromycin resistance gene (Invitrogen Corp). Proper insertion was confirmed using restriction digests.

Cell culture SH-EP1 cells were used to stably and heterologously express α7Y. SH-EP1 cells are an epithelial-like cell line subcloned from the SK-H-SK neuroblastoma line22, 23; they are native nAChR-null and have served as a heterologous expression system for nicotinic receptors24. Cells were maintained in 100-mm diameter, tissue culture-treated, polystyrene dishes at 37 °C in a humidified atmosphere supplemented with 5% CO2. Culture medium was completed DMEM (C-DMEM) consisting of Dulbecco's modified Eagle's medium (DMEM) with high glucose and buffered with bicarbonate supplemented with fetal bovine serum (FBS; 5%), inactivated horse serum (10%), sodium pyruvate (1 mmol/L), L-glutamine (8 mmol/L), streptomycin (100 μg/mL) and penicillin (100 U/mL).

Creation of stably transfected cell line expressing α7Y Transfections to create the stably transfected cell line were done using 1 μg of α7Y cDNA construct, linearized with SspI, and Effectene transfection reagent (Qiagen, Valencia, CA). Reagent components and DNA were mixed according to the manufacturer's instructions and incubated at room temperature for 5 min. Cells between 70%−90% of confluence were released from the culture dish using Cell Stripper (Mediatech Corp, Manassas, VA) and resuspended in 10 mL of C-DMEM; the transfection solution was added, and the culture dish was incubated overnight under the conditions described above before culture medium was exchanged for fresh C-DMEM. Forty-eight hours post transfection, cells were trypsinized, resuspended in 2 mL of cell culture medium and seeded at low densities, from 1:100 to 1:1500 (v/v), in C-DMEM containing hygromycin B (130 mg/mL; Calbiochem, San Diego, CA). After 1-2 weeks, colonies were picked using cloning disks soaked in trypsin (0.5%)-EDTA (0.2%) solution; disks were transferred to individual chambers in 24-well plates. Epifluorescence microscopy was employed 1–2 weeks later to screen surviving colonies for fluorescence. Cells that contained regions of bright, saturating fluorescence tended to rapidly loose expression of α7Y after a few passages. Several clones were maintained for 6 or more passages; those that maintained a consistent level of fluorescence, without containing large regions of bright, saturating fluorescence, were selected for further propagation and cryopreservation. For cryopreservation, a confluent dish of cells was trypsinized and resuspended in 2 mL of C-DMEM. One mL aliquots were transferred to cryopreservation vials then prepared for freezing by adding 10% dimethyl sulfoxide and 10% additional FBS. Vials were placed in an isopropanol freezing container stored overnight at -80 °C to control the rate of freezing before vials were transferred to liquid nitrogen storage or -80 °C storage.

Transient transfections Transient transfections were performed with either LipofectamineTM 2000 (Invitrogen Corp; used for cells subjected to patch-clamp recording) or ExpressFectTM (Denville Scientific Inc, Metuchen, NJ; used for cells subjected to radioligand binding assays or to confocal or TIRF microscopy) according to the producers' instructions, with one exception. For ExpressFectTM, it was determined that a 3-h incubation time with the transfection reagent was sufficient for optimal transfection efficiency and improved cell viability. Additionally, media without antibiotics were used after transfection reagent solutions were removed. Transfection solutions were prepared in batches, and aliquots were used to ensure consistent application of reagents across samples. Sham transfections were performed for both TE671/RD and untransfected SH-EP1 cell types; no disruption of cell growth or cell death was apparent. Human pcDNA3-neo-human ric-3 (hric-3) was a kind gift of Dr Millet Treinin (Hebrew University)25 through Dr William Green (University of Chicago). Hosts for transient transfections were either wild-type SH-EP1 cells (exposed to 105 ng of nAChR α7 subunit cDNA alone or along with 63 ng of hric-3 cDNA per well per well in 24-well trays) or SH-EP1 cells already stably expressing α7Y (exposed to vehicle alone or to 63 ng of hric-3 cDNA per well.

For confocal and TIRF experiments, selected dishes of cells were also transiently transfected with pCS2-mCherry (300 ng per 35-mm dish), to express a red fluorescent protein (pmCherry FP), which is targeted to the plasma membrane. The construct contains two copies of a myristoylation signal sequence subcloned from the Lyn Kinase gene. The signal sequence is immediately upstream of the FP gene and targets the FP to the plasma membrane. It was a kind gift of Dr Sean Megason (California Institute of Technology)26. Cells requiring transient transfections were seeded a day prior to transfection and used for experiments within 16 to 48 h of transfection.

Culture dishes for electrophysiology and microscopy For confocal and TIRF microscopy, cells were seeded onto 35-mm diameter culture dishes with a No 1.5 cover slip glass bottom coated with poly-D-lysine (MatTek Corp, Ashland, MA). Cells imaged with epifluorescence microscopy were typically seeded in 24-well plates or in 100-mm tissue culture treated polystyrene dishes. For whole-cell patch clamp experiments, cells were seeded onto 35-mm tissue culture treated polystyrene dishes.

Epifluorescence microscopy An Olympus IX70 epifluorescence microscope with a 20×0.70 NA UPlanApo objective, a MicroFire digital camera (Olympus America, Inc, Center Valley, PA) and an enhanced YFP filter cube (Leeds Precision Instruments Inc, Minneapolis, MN) were used to screen clones for expression and to compare the degree of expression of α7Y nAChR between clonal colonies. Images were captured using Magnafire 2.1 software (Media Cybernetics, Carlsbad, CA).

Laser scanning confocal microscopy (LSCM) A Nikon C1 laser scanning confocal microscope (Nikon Instruments Inc, Melville, NY) with a spectral imaging system and a Nikon PlanApo 60×/1.40 NA oil objective was used to image cells containing fluorescently-tagged proteins. YFP was excited using the 514.5-nm line of an argon laser; and Cherry FP was excited using a 561-nm solid state laser. Emission spectra, or λ stacks, were acquired at 5 nm resolution between 520−600 nm, except for images of Cherry FP which were observed using a range of 525−675 nm. All images were acquired using the settings, as follows: 512×512 pixels, 6.72 μs pixel dwell time, 12-bit intensity resolution, 60 μm pinhole diameter, 200 spectral gain, 5 nm spectral imaging bandwidth, and an average of 4 scans per image.

Each pixel in the spectral image contained the fluorescence intensity over the entire range. The linear unmixing algorithm of the Nikon EZ-C1 Viewer (Nikon Instruments Inc) was used, offline, to separate the overlapping spectra of YFP and Cherry FP, as well as to remove autofluorescence. Singly transfected SH-EP1 cells were used to acquire reference spectra.

Total internal reflection fluorescence microscopy Cellular autofluorescence was minimized by imaging in extracellular imaging solution consisting of 10 mmol/L HEPES, 4 mmol/L KCl, 150 mmol/L NaCl, 2 mmol/L CaCl2, 2 mmol/L MgCl2, and 10 mmol/L glucose. Transiently transfected cells were imaged 18−48 h after transfection; stably transfected cells were imaged ∼24 h after seeding. An Olympus IX71 inverted microscope with a PlanApo 100×/1.45 NA oil objective (Olympus America, Inc) and an Olympus TIRF illuminator were used for imaging. An Andor Laser Combiner (ALC; Andor, Belfast, Ireland) equipped with an acoustic-optical tunable filter was used to control the excitation laser excitation wavelength and intensity. Its 25 mW diode pumped solid state 561-nm laser was used to excite pmCherry, a red FP. An external Melles-Griot Ar ion laser (Melles-Griot, Carlsbad, CA) was coupled to the ALC via a fiber optic cable. Its 488-nm laser line was used to excite YFP. The Optosplit Emission GFP/RFP filter set (GFP: 525/30, DM 555, RFP: 598/40) and the microscope filter cube with dichroic (FF505/606-Di01-25×36) were from Semrock (Semrock, Rochester, NY). A Photometrics Cascade 650 charge-coupled device camera with 16-bit resolution (Princeton Instruments, Trenton, NJ) and an Andor IQ image capture and analysis software program (Andor Technology PLC, Belfast, Ireland) were used to capture images using a 300 ms integration time10, 15. Colocalization of pmCherry and YFP images was visualized using Image J software with the colocalization finder plug-in52.

Patch-clamp whole-cell current recordings Conventional whole-cell current recording, coupled with computer-controlled two-barrel fast application and removal of agonists was used in this study, as previously described27. Briefly, cells plated on 35-mm tissue culture treated polystyrene dishes were placed on the stage of an Olympus IX70 inverted microscope (Olympus America, Inc) and continuously superfused with standard external solution (2 mL/min). The standard external solution contained (in mmol/L) 120 NaCl, 3 KCl, 2 MgCl2, 2 CaCl2, 25 D-glucose, and 10 HEPES, and was adjusted to pH 7.4 with Tris-base. Tris+ electrodes were filled with solution containing (in mmol/L) 110 Tris phosphate dibasic, 28 Tris-base, 11 EGTA, 2 MgCl2, 0.1 CaCl2, and 4 Mg-ATP; pH 7.3. Glass microelectrodes, with 3-5 MΩ resistance between the pipette and extracellular solutions were used to form tight seals (>1 GΩ) on the cell surface, continued suction was applied to convert to conventional whole-cell recording. The cells were voltage-clamped at holding potentials of -60 mV, and ion currents in response to application of ligands were measured with an Axon 200B amplifier (Axon Instruments, Foster City, CA). Whole-cell access resistance was less than 20 MΩ before series resistance compensation. Both pipette and whole-cell current capacitances were minimized, and series resistance was routinely compensated to 80%.

Data were acquired at 10 kHz, filtered at 2 kHz, displayed and digitized online with a Digidata 1322 series A/D board (Axon Instruments) and stored to a hard drive. Data acquisition of whole-cell currents was done using Clampex 9.2 (Axon Instruments), and the results were plotted using Prism 3.0 (GraphPad Software, San Diego, CA). nAChR acute desensitization (the decline in inward current amplitude over the course of agonist application) was analyzed for decay half-time (t=0.693/k for decay rate constant k), peak current (Ip), and steady-state current (Is), using fits to the mono (or double) exponential expression I=([IpIs] e-kt)+Is (or I=([IpIi] e-K1t)+([IiIs] e-k2t)+Is), where Ii is the intermediate level of current and k1 and k2 are rate constants for the 2 separate decay processes. Curve fitting was performed using data between 10% and 90% of the difference between peak and steady-state currents. Concentration response profiles were fit to the Hill equation and analyzed using Origin 5.0. Comparisons of treatments were analyzed for statistical significance using t-tests. Prism 3.0 was used for graphic presentation of the experimental data for EC50 and IC50, presented as mean log molar±standard error of the mean (SEM), and in the narrative as mean molar values, including 95% confidence intervals. All experiments were performed at room temperature (22±1 oC).

Radiotoxin binding assays of nAChR surface expression Cells were seeded in 24-well tissue culture plates to approximately 80% of confluence two days prior to measurement. Any transfections were performed 24 h prior to binding assays as described above when cells were up to 100% confluent (105 cells/well). Human TE671/RD cells, which express muscle-type nAChRs28, served as a positive control for toxin binding assays, while untransfected SH-EP1 cells served as a negative control. Cells expressing human α7 (hα7) nAChRs were used as a positive control for hRIC-3 expression studies conducted using cells also transfected with hric-3 cDNA.

Total or non-specific I-Bgt binding to surface receptors was measured in triplicate for each condition per in situ assay; two assays were performed on different days. Culture medium was aspirated and replaced with 0.5 mL per well of Dulbecco's phosphate buffered saline (DPBS)+BSA (0.1% w/v) containing 2 nmol/L [125I] α-Bgt (2000 Ci mmol-1; Perkin Elmer Life Sciences), either alone (to define total binding) or in the presence of 1 μmol/L α-cobratoxin (to define non-specific binding). Reactions were incubated for 4 hours at room temperature followed by four 5-min washes with room temperature DPBS of successively increasing volume (0.2, 0.3, 0.4, and 0.5 mL per well). After washing, the cells were solubilized with 0.5 mL per well of 0.01 mol/L NaOH+0.1% SDS. The well contents were aspirated into individual liquid scintillation tubes, mixed with 10 mL of UniverSol scintillation fluid (MP Biomedicals, Irvine, CA), and incubated overnight at room temperature. Retained [125I] was counted using a Packard TriCarb liquid scintillation analyzer (60% counter efficiency; Packard Instrument Co, Meriden, CT). For each transfection condition, mean non-specific binding (in the presence of unlabeled cobratoxin) was subtracted from the respective total binding values, giving specific cell-surface labeling. Data were converted to molecules of specifically bound I-Bgt per cell to allow comparison of surface expression levels across conditions.

Data analysis Summary data are reported as the mean ±standard deviation (SD), or as noted, the mean±(SEM). Pairwise t-tests were used to compare means using the assumption of normality and equal variance; significance was established where P<0.05.

Results

α7Y construct design and creation Sequences encoding a YFP epitope tagged-FP were inserted, in frame, into a cDNA construct encoding the mouse nAChR α7 subunit. The fusion protein was designed to include an HA-YFP polypeptide in the C2 domain of the α7 subunit (Figure 1A), between the third (M3) and fourth (M4) transmembrane domains, without removing any of the native α7 subunit amino acids in this region (Figure 1B). DNA sequencing confirmed the proper orientation and sequence of the mouse gene and HA-YFP fusion. When assembled, the α7Y receptor will have five fluorescently-labeled subunits.

Figure 1.

Figure 1

Design of mouse α7 nAChR subunit with HA-YFP insertion (α7Y). Schematic illustration of the design of the fluorescently tagged mouse α7 nAChR subunit involving insertion of the gene for enhanced yellow fluorescent protein (YFP) immediately downstream of the hemagglutinin (HA) epitope tag. HA-YFP was genetically inserted between C412 and S413 in the second, large cytoplasmic loop (C2) between the third (M3) and fourth (M4) transmembrane domains of the α7 subunit. Functional motifs in the α7 subunit C2 loop are noted in the amino acid sequence printed beneath the diagram. Underlined resides are the dendritic targeting signal 349-GEDKVRPACQHKPRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGM-39511. Also indicated are predicted phosphorylation sites for serine (light blue) 361-PRRCSLASV-369, 364-CSLASVELS-372, 368-SVELSAGAG-376, 409-RLACSPTHD-417, 423-GTHPSDGDP-341; threonine (bright green), 396-HCAPTPDSG-404; and tyrosine (pink), 438-EEVRYIANR-44630; a putative ER retention signal(black box) 446-RFR-44829; and a putative amphipathic helix, D432-C449 (orange box), including L433 shown to interact with hRIC-329. The asterisk denotes the location of the HA-YFP gene insertion.

Insertion of YFP into the mouse α7 subunit between C412 and S413 avoided the putative ER retention site R446, F447, R44829, avoided all but one of the predicted tyrosine, serine and threonine phosphorylation sites30, preserved all of the negatively charged residues, which may be important for avoiding outward conductance of intracellular anions, left residues near the transmembrane region intact7, and as well as a dendritic localization site between residues G349-M39511. It also left a 20-residue buffer between the FP and the most proximal residue involved in hRIC-3 interaction, L433, which is in the α7 putative amphipathic helix, D432 through C449, near M429.

Whole-cell patch clamp shows α7Y nAChRs have function Initial whole-cell recording using 10 mmol/L choline as an agonist produced similar currents in cells stably expressing α7Y (Figure 2A) as those transiently transfected with wild type α7 (Figure 2B). For both constructs, activation and desensitization of inward currents were extremely rapid, as is characteristic for α7 nAChR functional responses31. Cells expressing α7 had a mean (±SEM) peak current of 193±28 pA, and cells expressing α7Y had a mean peak response of 180±21 pA (n=6 cells each; P=0.70). Even though means for transfection were different for these cells, peak current levels were similar. Transient co-transfection of SH-EP1 cells with α7 and hric-3 cDNA yielded cells exhibiting an over two-fold increase in current (514±59 pA; Figure 2C) relative to cells expressing α7 alone (P<0.001). Likewise, for cells expressing α7Y (Figure 2D), the mean current doubled to 554±40 pA when hRIC-3 was also expressed (P< 0.001).

Figure 2.

Figure 2

Functional responses to a nicotinic agonist in cells expressing α7 nAChRs or α7Y nAChRs. Representative patch clamp whole-cell current response traces during application of 10 mmol/L choline to cells transfected with α7 (A) or α7Y (B) or co-transfected with α7 and hRIC-3 (C) or α7Y and hRIC-3 (D). Mean (±SEM) peak currents for α7 nAChRs or α7Y nAChRs were 193±28 pA or 180±21 pA, respectively. Cells transfected with α7 or α7Y, each co-expressed with hRIC-3, produced mean (±SEM) peak currents of 514±59 and 554±40 pA, respectively, which were more than double (n=6 each; P<0.001) peak current amplitudes elicited in cells without hRIC-3.

Concentration dependencies for peak whole-cell currents responses to the α7 nAChR-selective agonist, choline, acting at cells expressing α7Y or wild-type α7 subunits were comparable, as the two curves nearly overlay (Figure 3A). The effective concentration to elicit a 50% response, EC50, was nearly identical for both, being 2.61 (1.05–6.50) mmol/L for α7 cells and 3.00 (1.82–4.92) mmol/L for α7Y cells (mean molar (95% confidence interval); n=6 cells each). Hill coefficients for one-site fits to the logistic equation were 1.31±0.35 and 1.38±0.12 for α7 and α7Y, respectively. Additionally, concentration profiles for the inhibition of the response to 10 mmol/L choline (a concentration that elicits 90% of the peak current) after a 2-min incubation in the presence of the α7 nAChR-selective antagonist, methyllycaconitine (MLA), were virtually identical for both cell types (Figure 3B). The IC50 for MLA was 0.75 (0.32–1.78) and 0.79 (0.36–1.73) nmol/L for cells expressing α7 and α7Y, respectively (mean molar (95% confidence interval) n=6 cells for each). Hill coefficients were -0.99±0.32 for α7 nAChRs and -1.06±0.32 for α7Y nAChRs. Thus, both agonist and antagonist responses for α7Y nAChRs strongly resembled those obtained for α7 nAChRs.

Figure 3.

Figure 3

Concentration-response curves for choline and MLA. Normalized whole-cell peak currents (y-axis, pA) were determined at the indicated drug concentrations (x-axis, log molar) for SH-EP1 cells expressing α7 or α7Y, each co-transfected with hRIC-3. (A) Choline concentration-response curves were nearly identical (P>0.05), yielding EC50 values (mean±SEM) for α7 nAChRs of -2.58±0.14 and for α7Y nAChRs of -2.52±0.08 (n=6 cells for each.). (B) MLA concentration-response curves were obtained after a 2-min preincubation with MLA and continuing exposure to the antagonist in the presence of 10 mmol/L choline. Again, both response curves were virtually identical (P>0.05), yielding IC50 values (±SEM) for α7 nAChRs of -9.13±0.12 and for α7Y nAChRs of -9.10±0.11 (n=6 cells for each).

Radioligand binding confirms α7Y surface expression In situ radioligand binding assays using I-Bgt were performed to determine if α7Y nAChRs can bind Bgt, which is known to bind wild type α7 nAChRs, to assess levels of receptor expression on the cell surface, and to ascertain effects of co-expression of hRIC-3. Additional studies were done using an established cell line51 stably and abundantly expressing non-fluorescent hα7 nAChRs as a positive control. In the absence of hRIC-3, cells transiently expressing α7 or stably expressing α7Y did not show cell surface binding for I-Bgt above non-specific binding levels (data not shown, but P>0.05). However, transient transfection with hric-3 cDNA increased specific I-Bgt binding well above non-specific levels in two separate experiments for both cell types (3279±243 and 317±46 sites per α7Y cell; 2532±304 and 4538±473 for sites per α7 cell; compared to 14653±2618 and 6693±1324 sites per cell for the control, the stably expressed, hα7 cell line; Figure 4).

Figure 4.

Figure 4

I-Bgt binding to cell surface receptors. I-Bgt, a radiolabeled neurotoxin with high affinity for α7 nAChR, was incubated (2 nmol/L final concentration) with cells expressing α7, α7Y alone (data not shown) or along with co-transfected hRIC-3, with a control cell line stably expressing human α7 nAChRs, or with untransfected SH-EP1 cells. Non-specific binding was assessed in the presence of a 500-fold excess of unlabeled cobratoxin, and specific binding levels [y-axis, mean (± SD) number of binding sites per cell (triplicate determinations each in two separate experiments, 1 – gray bars; 2 – checkered bars)] were determined. Untransfected SH-EP1 cells are native nAChR-null and showed a statistically insignificant level of specific I-Bgt binding, as did cells expressing only α7 or α7Y (not shown). However, specific binding was seen for cells expressing α7 nAChRs, α7Y nAChRs, or for the positive control cell line along with hRIC-3.

α7Y protein and/or α7Y nAChR are predominately found in intracellular pools SH-EP1 cells stably expressing α7Y were transiently transfected with pmCherry, a red fluorescent protein that inserts into and conveniently identifies the plasma membrane (Figure 5A). Another set of cells was transfected to express both pmCherry and hRIC-3 (Figure 5C). Cells were visualized using LSCM z-stacks (a set of optical slices at progressively higher z positions through a cell) to localize pmCherry (red) and α7Y (green) signals. Each of the representative images is from a set of confocal optical slices. pmCherry-derived fluorescence was excluded from intracellular regions as well as nuclei, but it was evident in well-defined borders around cells and also intensely labeled filopodia. Conversely, α7Y-derived fluorescence filled much of the intracellular space in a lattice-like pattern and was excluded from cell nuclei (large dark areas in each image). Furthermore, it had some localization in or near plasma membrane regions as identified by pmCherry FP.

Figure 5.

Figure 5

Confocal optical slices of cells expressing α7Y. Intracellular localization of α7Y stably expressed in SH-EP1 cells was visualized using confocal microscopy at progressively higher z-positions producing a set of optical slices through the cell. (A) Enlarged and cropped image of representative optical slice of cell expressing α7Y (green) and transiently expressing pmCherry (red) to identify the plasma membrane. (B) Enlarged view of filopodia (boxed area in A) with red fluorescence derived from pmCherry and YFP fluorescence from α7Y (arrows). (C) Representative optical slice of cells stably expressing α7Y and transiently expressing pmCherry and the α7 chaperone, hRIC-3 (not fluorescently labeled). (D) Enlarged view of filopodia labeled with pmCherry FP that reveals plasma membrane localization of α7Y (arrows). The scale bars are 5 μm (A, C) and 2 μm (B,D). Images were acquired using spectral imaging from 525−680 nm emission and a 60×objective.

Intracellular compartments, such as the endoplasmic reticulum (ER), can be located close to the plasma membrane. Furthermore, confocal microscopy images of the plasma membrane may contain underlying intracellular regions which can include the ER. Considering this, we decided to use filopodia, excluding the region proximal to the cell body, as unambiguous regions of plasma membrane since they do not contain ER32. All cells in which filopodia were visible (n=10 cells) had α7Y-derived fluorescence in some of these processes (Figure 5B, 5D), demonstrating that α7Y was expressed in the plasma membrane.

TIRF microscopy detects surface expression of α7Y Total internal reflectance fluorescence (TIRF) microscopy was used to image cellular regions within 100 nm above the cover slip to determine if α7Y was trafficked to the plasma membrane. Cells stably expressing α7Y were transiently transfected with pmCherry to allow identification of the plasma membrane. Fluorescence derived from α7Y and pmCherry was observed in the membrane region around the cell body and also in micropodia12, which are fine filopodial processes extending from the cell body. Whereas micropodia were brightly fluorescent for pmCherry, only about 15% of the cells imaged had α7Y in these regions (n=71 cells) with no difference between cells expressing hRIC-3 (15.4%) and those not expressing the chaperone (15.7%). A representative TIRF image shows a cell with micropodia that contain both pmCherry FP (Figure 6A) and α7Y (Figure 6B). Several of the dual-labeled micropodia are denoted by arrows. Both images were combined to illustrate colocalization (white areas in Figure 6C).

Figure 6.

Figure 6

TIRF microscopy images confirm α7Y localization in the plasma membrane. Total internal reflectance fluorescence (TIRF) microscopy was used to assess plasma membrane expression of α7Y in stably transfected SH-EP1 cells that were transiently expressing pmCherry to identify the plasma membrane. Micropodia were used to unambiguously identify regions of plasma membrane. (A) Red FP channel shows pmCherry labeling the cell body and micropodia. (B) YFP channel confirms expression of α7Y in the cell body region and in micropodia. Arrows identify several micropodia that are evident in both channels, implying localization of α7Y in the plasma membrane. (C) Merged image of YFP channel (green) and pmCherry channel (red) shows colocalization (white) in the plasma membrane. Scale bar denotes 5 μm.

Spectral imaging acquires the full emission spectrum so that signals beyond the typical filter cut-off range are not attenuated, which maximizes the signal from fluorescent proteins. Linear unmixing, a linear regression fit to the YFP spectrum, removes autofluorescence and overlapping spectra from other fluorophores9. Optical slices of SH-EP1 cells stably expressing α7Y were acquired with the spectral imaging system of a LSCM. A raw spectral image (Figure 7A) provides evidence that the cell was expressing the fluorescent α7Y receptor, but the image reveals relatively little detail regarding its cellular distribution. After linear unmixing, the lattice-like pattern of intracellular YFP distribution becomes apparent (Figure 7B). This pattern was typically observed and resembles the cellular location, size and pattern seen in images of fluorescently-tagged proteins localized to the endoplasmic reticulum (ER)32. Likewise, the TIRF images showing YFP distribution also have a similar pattern in the cell body region (Figure 7C). A yellow oval is overlaid onto the unmixed confocal image (B) and the TIRF image (C) to illustrate the similarity. SH-EP1 cells exhibit some autofluorescence, especially at higher laser power levels (Figure 7D), thus linear unmixing was useful in removing this noise in the YFP emission range (Figure 7E).

Figure 7.

Figure 7

Intracellular localization of α7Y. (A) LSCM optical slice acquired using spectral imaging through the upper half of a cell stably expressing α7Y. The dark oval is the nucleus. (B) YFP image of the same cell after autofluorescence was removed using the Nikon C1 linear unmixing algorithm. α7Y appears in a lattice-like pattern throughout most of the cell, excluding the nucleus. 100× objective 2× zoom. (C) TIRF image of different cell expressing α7Y, cropped to show ∼2× zoom of the cell body up to 100 nm above the cover slip. A pattern of expression in the cell body region similar to that seen in the confocal image is observed (encircled areas in B-C illustrate the similar pattern). (D) LSCM spectral image of wild type SH-EP1 cells. Laser excitation power was increased three-fold to obtain an image of autofluorescence. (E) Same cell as in D after linear unmixing. The image is black since the autofluorescence is removed by unmixing. Scales bars represent 5 μm (A–B, D–E) and 2 μm (C).

Discussion

Rationale for placement of YFP in the nAChR α7 subunit C2 loop Three envisioned uses for a fluorescently-tagged α7 subunit are to (1) help define α7 spatial and temporal interactions with fluorescently-labeled chaperone and accessory proteins29, 33, (2) investigate heteromeric assembly with other fluorescently-labeled nicotinic receptor subunits, including determination of subunit stoichiometry3, 10, and (3) examine interactions with other FP-tagged receptors3. All three involve interaction between proteins. Thus, detection of Förster (or fluorescence) resonance energy transfer (FRET) can be used to show assembly, or interaction between the proteins when both are fluorescently-labeled and the fluorophores are within 10 nm of each other9. An excellent position for a FP to meet the proposed uses is in the intracellular domain of the α7 subunit.

Another projected use of an α7 subunit-FP fusion protein is as a target, or 'bait,' for screening large combinatorial libraries of small biomolecules34, 35, 36 to select those molecules with high affinity and specificity toward the subunit's extracellular region. These individual molecules when linked could be used to create small, bivalent probes37 with further enhanced affinity for the target and could be superior options to the typically low affinity and low specificity antibodies employed in nAChR research38. An additional, contemplated use for a bivalent probe is for targeted drug delivery40. Screening of large libraries of compounds likely requires a substantial amount of target39, as could be provided via a heterologous expression system, such as stably transfected SH-EP1-α7Y cells. Ideally, the probe for α7 would bind to the extracellular domain in its native conformation to facilitate live cell and tissue imaging and drug delivery. This is another reason for placing the FP in the intracellular loop, where it would not disrupt the extracellular region.

Design of the α7 subunit-FP fusion protein One strategy to insert a fluorescent protein into the C2, large cytoplasmic loop of the nAChR α7 subunit is to delete a portion of the loop and replace it with the FP. This could potentially avoid some of the problems caused by introducing a sizeable 27-kDa protein into a region two-thirds of that size. In a study of the role of residues in the C2, large cytoplasmic loop, Valor and colleagues7 systematically deleted portions of the C2 loop of the rat α7 subunit and found residues critical for expression and function. Moreover, they discovered that a large region between residues 339–432 could be deleted without changing surface expression or function. Conversely, some deletions abolished or severely reduced expression and function, such as removing residues near the transmembrane domains, while others dramatically increased function, such as deleting residues 326–432 and replacing them with a 7-residue sequence for a restriction enzyme. This latter deletion and substitution resulted in a nearly 400% increase in function. However, when Valor et al replaced the deleted segment with GFP, the fluorescent receptor had roughly 70% fewer surface binding sites for Ι-Bgt than the wild type receptor and an even greater reduction in functional responsiveness.

Alternatively, Nashmi and colleagues9 successfully inserted a FP into the C2 loop of either the α4 and β2 nAChR subunits without removing any of the residues, thus preserving trafficking sites and only disrupting one of several phosphorylation sites in the α4 subunit. Other fusions of FP into C2 loops of nAChR α6 or β3 subunits10 or muscle-type nAChR ɛ or γ subunits41 confirm that by avoiding phosphorylation and trafficking sites, fusion proteins produce receptors with distribution and/or function similar to wild type receptors. The current studies demonstrate that similar insertion of YFP into the α7 subunit C2 domain (Figure 1) produces α7Y nAChRs with properties like those of receptors made from wild-type subunits.

Electrophysiological studies show that α7Y nAChRs and α7 nAChRs have comparable function nAChRs composed of either wild type α7 or α7Y have similar and relatively low peak whole-cell current responses to choline, a full agonist of α7 nAChR. Responses to choline increased two-fold for both the wild type and fluorescent α7 nAChR when co-expressed with hRIC-3. These were remarkably similar results, considering that cells were stably transfected with α7Y or transiently transfected with α7.

Prior work has demonstrated that hRIC-3 promotes α7 nAChR expression29, 42; thus, the increase in current after transfection was not surprising. Notably, since responses to choline increased by the same factor for both types of receptors, the results imply that interaction with hRIC-3 was not abolished by insertion of YFP downstream of the putative hRIC-3 binding site in the α7 subunit C2 loop29. Additionally, both receptors had similar EC50 values for functional activation by choline and IC50 values for functional inhibition by MLA, further demonstrating that α7Y nAChRs and α7 nAChRs have comparable functional features. In summary, the electrophysiological data suggest that the YFP fusion did not adversely affect receptor function or interaction with hRIC-3.

Although the simplest explanation of the very similar levels of cell surface radiotoxin binding and the nearly identical levels of function in cells expressing α7Y or α7 proteins and receptors is that they were expressed at comparable levels, this conclusion is tentative because of the different techniques of transfection used and because comparisons are complicated between transiently or stably transfected cells. Thus, it is possible that FP insertion did affect polypeptide folding, assembly, trafficking and function. For example, it is possible that the 20-residue distance between the FP fusion and the putative hRIC-3 binding site was too short to avoid some reduction in the efficiency of hRIC-3-enhanced trafficking and function. However, whether hRIC-3 was co-expressed with α7Y or with α7, whole cell current response amplitudes doubled. Although FP insertion could have differentially affected surface expression of one or the other subunit construct but with a compensating alteration in function, we favor the interpretation that that there is similar expression, function and interaction with hRIC-3 for α7 and for α7Y.

Radioligand binding assays confirm that α7Y nAChRs can bind I-Bgt Although studies done in the absence of the putative chaperone were negative, additional studies in which cells also expressed hRIC-3, confirmed that α7Y nAChRs, as well as α7 nAChRs, are able to specifically bind I-Bgt. Both electrophysiological and TIRF microscopy results revealed surface expression of α7 nAChRs and α7Y nAChRs in the absence of additional hRIC-3, and electrophysiology revealed an increase in expression in cells co-transfected with hric-3 cDNA. Thus, the sensitivity of I-Bgt binding assays simply may be too low to detect surface receptors unless they already are expressed abundantly or unless their levels were increased upon co-expression with hRIC-3.

Confocal microscopy shows intracellular expression of α7Y Optical slices of α7Y cells captured using LSCM revealed an extensive lattice-like pattern of YFP fluorescence throughout most of the cell (Figures 4 and 6). This large area inside the cell likely corresponds to subunits being synthesized and assembled in the ER, because the intracellular distribution and pattern of YFP intensity matches the lattice-like pattern observed when cells are stained for ER membrane proteins10, 32. In contrast, confocal images confirmed that the pmCherry was almost completely localized to the plasma membrane, and it was not observed intracellularly. Relying solely on confocal images, it was difficult to ascertain the relative amount of α7Y in the plasma membrane as identified by localization with pmCherry. However, cells had some regions in which both appeared co-localized, most often in the filopodia extending outward from the cell body (Figure 4B and 4D). Qualitatively, co-transfection with hRIC-3 did not appear to increase the amount of α7Y at the membrane based simply on confocal microscopic examination. The question of whether or not hRIC-3 increased the amount of α7Y in internal pools was not systematically addressed in this study due to the variability in intensity of YFP fluorescence between individual SH-EP1-α7Y cells. Nevertheless, whether or not in the presence of hRIC-3, there was extensive intracellular distribution of α7Y, excluding the nucleus. This is consistent with observations in other studies of heterologously expressed nicotinic receptor subunits and assemblies (α3β412, a6*, and b3*10, α4β243, and α78) that reveal a predominantly intracellular localization. Perhaps this also occurs naturally, and it might not be a surprise given the large mass ratio of intracellular membrane pool mass to plasma membrane mass.

TIRF microscopy reveals surface expression of α7Y Whereas LSCM was able to confirm expression of α7Y and that a large portion was localized to intracellular compartments, it was not able to adequately resolve distribution at the plasma membrane partly due to the natural, curved contour of the cells and due to limitations on the minimal thickness of optical slices. Hence, it is likely that features inside the cell can be imaged in the same optical slice as the membrane44. Fortunately, SH-EP1 cells come into some contact with the coverslip, especially through micropodia, which do not contain ER32. TIRF microscopy was used to visualize micropodia in a region within about 100 nm of the cover slip. Micropodia have served in prior studies as regions of plasma membrane localization10, 12. This ability in concert with the membrane marker, pmCherry, provided an opportunity to unambiguously identify some regions of the plasma membrane. Additionally, TIRF microscopy allowed for detection of lower levels of fluorescence than can be detected in confocal microscope images. TIRF microscopy also dramatically reduced out-of-focus light45, enabling better discrimination of fine features, such as the distribution of small amounts of α7 subunit-fused YFP detected in micropodia. In fact there were a number of cells that had α7Y in micropodia and in distal regions of filopodia, indicating that a small proportion of α7Y (presumably in closed, pentameric assemblies as α7Y nAChRs) is, indeed, expressed at the cell surface (Figure 6B).

Using stably transfected cells, all expressed some level of α7Y, although YFP fluorescence intensity varied from cell to cell. However, only about 15% of the cells inspected had apparent micropodial and distal filopodial localization. This apparent absence of membrane-localized YFP in the majority of cells was an unexpected result. One possible reason for the low detection level was that a shorter, sub-optimal wavelength was used to excite YFP to avoid directly exciting the pmCherry FP. Another is that filopodia growing over edges of neighboring cells would not be visible using TIRF microscopy. Certainly, α7 has very low levels of surface expression, with as little as 0.3% being expressed at the surface8; thus, very low levels of expression may have gone undetected. As for receptors on the cell body, the TIRF method was not able to discriminate between the YFP signal from presumably low levels of surface-expressed α7Y and the relatively bright YFP signal emanating from α7Y subunits in intracellular compartments located near the plasma membrane (Figure 7C).

Utility of fluorescent α7 subunits Fluorescently tagged nAChR subunits have some attractive properties. They can overcome problems associated with other probes, such as antibodies, which often do not discriminate well between subunits with high homology38, 46. Antibodies also are not always useful for live cell and tissue imaging, especially in neural synapses47. Moreover, a fluorescent protein tag obviates the need for labeling procedures that can damage the protein and/or the cells or tissues being studied. Additionally, transgenes containing tagged subunits may be incorporated into viral vectors and used in subunit knockout animals to selectively reintroduce tagged subunits into a region of interest, thereby allowing a broad range of techniques to be applied to define subunit and receptor localization and function48. Potential drawbacks to fluorescent protein fusion do exist and have been enumerated by others4, 5, 41. Briefly, they include alterations in coassembly, trafficking and function.

In testing nAChRs composed of the fluorescently tagged α7 subunit, α7Y, for expression and function, it was shown that they had nearly identical agonist and antagonist responses to choline and MLA, respectively, when compared to wild type mouse α7 nAChRs. It was also found that α7Y protein and perhaps also nAChRs exist primarily in intracellular pools and have relatively low surface expression, which is consistent with published reports for α7 and other nAChRs8, 10, 12, 43. Additionally, I-Bgt binding assays demonstrated that Bgt binds α7Y nAChRs as well as α7 nAChRs. Taken together, all the lines of evidence show that the YFP fusion in the large intracellular loop, between M3-M4, preserves the ability of α7Y to assemble into receptors that function in the same manner as wild type α7 nAChR. Accordingly, α7Y is likely to prove extremely useful in further studies of α7 nAChR trafficking, associations with fluorescently tagged accessory and chaperone proteins, visualizing localization in live neurons and the effects of drugs on upregulation or downregulation of the receptor. Expanding on the last point, α7Y cell lines could be used to signal changes in α7 nAChR expression levels in cell-based high throughput screening assays. It may also find use as a 'bait' for screening combinatorial libraries of potential ligands. α7Y may even help settle the questions about heteromeric assembly with other nAChR subunits and their stoichiometry9, 10, 49, 50. Therefore, α7Y should be a useful addition to the existing set of fluorescently tagged mouse nAChR subunits.

Author contribution

Teresa A MURRAY designed the research, cloned the mouse α7 gene, created the α7Y fusion protein, performed microscopy and radioligand binding experiments, and wrote the paper, with assistance as noted. Qiang LIU performed and summarized all electrophysiological experiments, and Jie WU provided guidance and edited the manuscript with respect to electrophysiology experiments. Paul WHITEAKER co-designed and co-performed radioligand binding assays and provided guidance for presenting data. Ronald LUKAS and Paul WHITEAKER assisted in writing the paper.

Acknowledgments

We wish to thank Dr Henry LESTER, California Institute of Technology, for the generous use of his facilities for performing confocal and TIRF studies. We also thank Dr Rigo PANTOJA and Dr Rahul SRINIVASAN for instruction and assistance using the TIRF and confocal microscope systems in Dr Lester's lab. We also gratefully acknowledge Dr Sean MEGASON, California Institute of Technology for the kind gift of the pCS2-mCherry construct; Dr Henry LESTER and Dr Raad NASHMI (formerly of the Lester lab and now at the University of Vancouver) for their gift of the α4-HA-YFP nAChR construct; and Dr Millet TREININ of Hebrew University for the gift of the hRIC-3 construct through Dr William GREEN of the University of Chicago.

This work was supported by a National Institutes of Health Grant DA015389, the Barrow Neurological Foundation, and the Biodesign Institute at Arizona State University. TA MURRAY was supported by a National Science Foundation Graduate Research Fellowship and a Catholic Healthcare West SEED grant.

References

  1. Chalfie M, Tu Y, Euskirchen G, Ward WW, Prasher DC. Green fluorescent protein as a marker for gene expression. Science. 1994;263:802–5. doi: 10.1126/science.8303295. [DOI] [PubMed] [Google Scholar]
  2. Tsien RY. The green fluorescent protein. Ann Rev Bioch. 1998;67:509–44. doi: 10.1146/annurev.biochem.67.1.509. [DOI] [PubMed] [Google Scholar]
  3. Khakh BS, Fisher JA, Nashmi R, Bowser DN, Lester HA. An angstrom scale interaction between plasma membrane ATP-gated P2X2 and α4β2 nicotinic channels measured with fluorescence resonance energy transfer and total internal reflection fluorescence microscopy. J Neurosci. 2005;25:6911–20. doi: 10.1523/JNEUROSCI.0561-05.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  4. Fucile S, Palma E, Martínez-Torres A, Miledi R, Eusebi F. The single-channel properties of human acetylcholine α7 receptors are altered by fusing α7 to the green fluorescent protein. Proc Natl Acad Sci USA. 2002;99:3956–61. doi: 10.1073/pnas.052699599. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Palma E, Mileo AM, Martínez-Torres A, Eusebi F, Miledi R. Some properties of human neuronal α7 nicotinic acetylcholine receptors fused to the green fluorescent protein. Proc Natl Acad Sci USA. 2002;99:3950–5. doi: 10.1073/pnas.052699299. [DOI] [PMC free article] [PubMed] [Google Scholar]
  6. Prasher DC, Eckenrode VK, Ward WW, Prendergast FG, Cormier MJ. Primary structure of the Aequorea victoria green-fluorescent protein. Gene. 1992;111:229–33. doi: 10.1016/0378-1119(92)90691-h. [DOI] [PubMed] [Google Scholar]
  7. Valor LM, Mulet J, Sala F, Sala S, Ballesta JJ, Criado M . Role of the large cytoplasmic loop of the alpha 7 neuronal nicotinic acetylcholine receptor subunit in receptor expression and function. Biochem. 2002. pp. 417931–8. [DOI] [PubMed]
  8. Toulmé E, Soto F, Garret M, Boué-Grabot E. Functional properties of internalization-deficient P2X4 receptors reveal a novel mechanism of ligand-gated channel facilitation by ivermectin. Mol Pharmacol. 2005;69:576–87. doi: 10.1124/mol.105.018812. [DOI] [PubMed] [Google Scholar]
  9. Nashmi R, Dickinson ME, McKinney S, Jareb M, Labarca C, Fraser SE, et al. Assembly of α4β2 nicotinic acetylcholine receptors assessed with functional fluorescently labeled subunits: effects of localization, trafficking, and nicotine-induced upregulation in clonal mammalian cells and in cultured midbrain neurons. J Neurosci. 2003;23:11554–67. doi: 10.1523/JNEUROSCI.23-37-11554.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Drenan M, Nashmi R, Imoukhuede P, Just H, McKinney S, Lester HA. Subcellular trafficking, pentameric assembly, and subunit stoichiometry of neuronal nicotinic acetylcholine receptors containing fluorescently labeled α6 and α3 subunits. Mol Pharmacol. 2008;73:27–41. doi: 10.1124/mol.107.039180. [DOI] [PubMed] [Google Scholar]
  11. Xu J, Zhu Y, Heinemann SF. Identification of sequence motifs that target neuronal nicotinic receptors to dendrites and axons. J Neurosci. 2006;26:978–93. doi: 10.1523/JNEUROSCI.0840-06.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  12. Graihle R, de Carvalho LP, Pass Y, Le Poupon C, Soudant M, Bregestovski P, et al. Distinct subcellular targeting of fluorescent nicotinic α4β3 and serotoninergic 5-HT3A receptors in hippocampal neurons. Eur J Neurosci. 2004;19:855–62. doi: 10.1111/j.1460-9568.2004.03153.x. [DOI] [PubMed] [Google Scholar]
  13. Slimko EM, Lester HA. Codon optimization of Caenorhabditis elegans GluCl ion channel genes for mammalian cells dramatically improves expression levels. J Neurosci Methods. 2003;124:75–81. doi: 10.1016/s0165-0270(02)00362-x. [DOI] [PubMed] [Google Scholar]
  14. Ilegems E, Pick HM, Deluz C, Kellenberger S, Vogel H. Noninvasive imaging of 5-HT3 receptor trafficking in live cells: from biosynthesis to endocytosis. J Biol Chem. 2004;279:53346–52. doi: 10.1074/jbc.M407467200. [DOI] [PubMed] [Google Scholar]
  15. Pantoja R, Rodriguez EA, Dibas MI, Dougherty DA, Lester HA. Single-molecule imaging of a fluorescent unnatural amino acid incorporated into nicotinic receptors. Biophysical J. 2009;96:226–37. doi: 10.1016/j.bpj.2008.09.034. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. Harkness PC, Millar NS. Changes in conformation and subcellular distribution of α4β2 nicotinic acetylcholine receptors revealed by chronic nicotine treatment and expression of subunit chimeras. J Neurosci. 2002;22:10172–81. doi: 10.1523/JNEUROSCI.22-23-10172.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  17. Zhang J, Berg DK. Reversible inhibition of GABAA receptors by α7-containing nicotinic receptors on the vertebrate postsynaptic neurons. J Physiol. 2007;579:753–63. doi: 10.1113/jphysiol.2006.124578. [DOI] [PMC free article] [PubMed] [Google Scholar]
  18. Dajas-Bailador FA, Soliakov L, Wonnacott S. Nicotine activates the extracellular signal-regulated kinase 1/2 via the alpha7 nicotinic acetylcholine receptor and protein kinase A, in SH-SY5Y cells and hippocampal neurones. J Neurochem. 2002;80:520–30. doi: 10.1046/j.0022-3042.2001.00725.x. [DOI] [PubMed] [Google Scholar]
  19. Song C, Murray TA, Kimura R, Wakui M, Ellsworth K, Javedan SP, et al. Role of alpha7-nicotinic acetylcholine receptors in tetanic stimulation-induced gamma oscillations in rat hippocampal slices. Neuropharm. 2005;48:869–80. doi: 10.1016/j.neuropharm.2005.01.003. [DOI] [PubMed] [Google Scholar]
  20. Picciotto MR, Caldarone BJ, King SL, Zachariou V. Nicotinic receptors in the brain: links between molecular biology and behavior. Neuropsychopharmacology. 2000;22:451–65. doi: 10.1016/S0893-133X(99)00146-3. [DOI] [PubMed] [Google Scholar]
  21. Lukas RJ, Bencherif M.Recent developments in nicotinic acetylcholine receptor biology. In: Biological and biophysical aspects of ligand-gated ion channel receptor superfamilies. Arias H, editor. Kerala, India: Research Signpost; 2006p27–59.
  22. Ross RA, Spengler BA, Biedler JL . Coordinate morphological and biochemical interconversion of human neuroblastoma cells. J Natl Cancer Inst. 1983;71:741–7. [PubMed] [Google Scholar]
  23. Walton JD, Kattan DR, Thomas SK, Spengler BA, Guo H, Biedler JL, et al. Characteristics of stem cells from human neuroblastoma cell lines and in tumors. Neoplasia. 2004;6:838–45. doi: 10.1593/neo.04310. [DOI] [PMC free article] [PubMed] [Google Scholar]
  24. Peng JH, Lucero L, Fryer J, Herl J, Leonard SS, Lukas RJ. Inducible, heterologous expression of human alpha7-nicotinic acetylcholine receptors in a native nicotinic receptor-null human clonal line. Brain Res. 1999;825:172–9. doi: 10.1016/s0006-8993(99)01066-5. [DOI] [PubMed] [Google Scholar]
  25. Halevi S, Yassin L, Eshel M, Sala F, Sala S, Criado M, et al. Conservation within the RIC-3 gene family: effectors of mammalian nicotinic acetylcholine receptor expression. J Biol Chem. 2003;278:34411–7. doi: 10.1074/jbc.M300170200. [DOI] [PubMed] [Google Scholar]
  26. Trichas G, Begbie J, Srinivas S. Use of the viral 2A peptide for bicistronic expression in transgenic mice. BMC Biology. 2008;6:40. doi: 10.1186/1741-7007-6-40. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Wu J, Kuo YP, George AA, Xu L, Hu J, Lukas RJ. beta-Amyloid directly inhibits human alpha4beta2-nicotinic acetylcholine receptors heterologously expressed in human SH-EP1 cells. J Biol Chem. 2004;279:37842–51. doi: 10.1074/jbc.M400335200. [DOI] [PubMed] [Google Scholar]
  28. Fryer JD, Lukas RJ. Noncompetitive functional inhibition at diverse, human nicotinic acetylcholine receptor subtypes by bupropion, phencyclidine, and ibogaine. J Pharmacol Exp Ther. 1999;288:88–92. [PubMed] [Google Scholar]
  29. Castillo M, Mulet J, Gutierrez LM, Ortiz JA, Castelan F, Gerber S, et al. Dual role of the RIC-3 protein in trafficking serotonin and nicotinic receptors. J Biol Chem. 2005;280:27062–8. doi: 10.1074/jbc.M503746200. [DOI] [PubMed] [Google Scholar]
  30. Blom N, Gammeltoft S, Brunak S. Sequence- and structure-based prediction of eukaryotic protein phosphorylation sites. J Mol Biol. 1999;294:1351–62. doi: 10.1006/jmbi.1999.3310. [DOI] [PubMed] [Google Scholar]
  31. Quick MW, Lester RA. Desensitization of neuronal nicotinic receptors. J Neurobiol. 2002;53:457–78. doi: 10.1002/neu.10109. [DOI] [PubMed] [Google Scholar]
  32. Alberts B, Johnson A, Lewis J, Raff M, Roberts K, Walter P.Molecular Biology of the Cell. 4th Ed. New York: Garland Science. 2002
  33. Miwa JM, Stevens TR, King SL, Caldarone BJ, Ibanez-Tallon I, Xiao C, et al. The prototoxin lynx1 acts on nicotinic acetylcholine receptors to balance neuronal activity and survival in vivo. Neuron. 2006;5:587–600. doi: 10.1016/j.neuron.2006.07.025. [DOI] [PubMed] [Google Scholar]
  34. Tuerk C, Gold L. Systematic evolution of ligands by exponential enrichment: RNA ligands to bacteriophage T4 DNA polymerase. Science. 1990;3:505–10. doi: 10.1126/science.2200121. [DOI] [PubMed] [Google Scholar]
  35. McGuire MJ, Samli KN, Chang YC, Brown KC. Novel ligands for cancer diagnosis: Selection of peptide ligands for identification and isolation of B-cell lymphomas. Exper Hematol. 2006;34:443–52. doi: 10.1016/j.exphem.2005.12.013. [DOI] [PubMed] [Google Scholar]
  36. Wilson DS, Keefe AD, Szostak JW. The use of mRNA display to select high-affinity protein-binding peptides. Proc Natl Acad Sci USA. 2001;98:3750–5. doi: 10.1073/pnas.061028198. [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Ni F.Bivalent Bridged Polypeptides for Tumour-targeting, Imaging and Controllable Therapeutic Intervention [homepage on the Internet]Biotechnology Research Institute, Canada. [Updated 01-25-2007; cited 2-1-2009] Available at: http://www.irb-bri.cnrc-nrc.gc.ca/rd/health/nmr/2007activities_e.html#networks.
  38. Moser N, Mechawar N, Jones I, Gochberg-Sarver A, Orr-Urtreger A, Plomann M, et al. Evaluating the suitability of nicotinic acetylcholine receptor antibodies for standard immunodetection procedures. J Neurochem. 2007;102:479–92. doi: 10.1111/j.1471-4159.2007.04498.x. [DOI] [PubMed] [Google Scholar]
  39. Eisenstein M. 'Chain gang' delivers for hard labor. Nat Meth. 2006;3:753–62. [Google Scholar]
  40. George S, O'Dowd BF, Lee SP. G-protein-coupled receptor oligomerization and its potential for drug discovery. Nat Rev Drug Discov. 2002;1:808–20. doi: 10.1038/nrd913. [DOI] [PubMed] [Google Scholar]
  41. Gensler S, Sander A, Korngreen A, Traina G, Giese G, Witzemann V. Assembly and clustering of acetylcholine receptors containing GFP-tagged ɛ or γ subunits: Selective targeting to the neuromuscular junction in vivo. Eur J Biochem. 2001;268:2209–17. doi: 10.1046/j.1432-1327.2001.02093.x. [DOI] [PubMed] [Google Scholar]
  42. Williams ME, Burton B, Urrutia A, Shcherbatko A, Chavez-Noriega LE, Cohen CJ, et al. Ric-3 promotes functional expression of the nicotinic acetylcholine receptor subunit α7 in mammalian cells. J Biol Chem. 2005;280:1257–63. doi: 10.1074/jbc.M410039200. [DOI] [PubMed] [Google Scholar]
  43. Whiteaker P, Sharples CG, Wonnacott S. Agonist-induced up-regulation of alpha4beta2 nicotinic acetylcholine receptors in M10 cells: pharmacological and spatial definition. Mol Pharmacol. 1998;53:950–62. [PubMed] [Google Scholar]
  44. North AJ. Seeing is believing? A beginners' guide to practical pitfalls in image acquisition. J Cell Biol. 2006;172:9–18. doi: 10.1083/jcb.200507103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  45. George N. TIRF microscopy: the evanescent wave of the future. Amer Lab. 2004;8:26–68. [Google Scholar]
  46. Herber DL, Severance EG, Cuevas J, Morgan D, Gordon MN. Biochemical and histochemical evidence of nonspecific binding of alpha7 nAChR antibodies to mouse brain tissue. J Histochem Cytochem. 2004;52:1367–76. doi: 10.1177/002215540405201013. [DOI] [PubMed] [Google Scholar]
  47. Dahan M, Lévi S, Luccardini C, Rostaing P, Riveau B, Triller A. Diffusion dynamics of glycine receptors revealed by single-quantum dot tracking. Science. 2003;302:442–5. doi: 10.1126/science.1088525. [DOI] [PubMed] [Google Scholar]
  48. Pons S, Fattore L, Cossu G, Tolu S, Porcu E, McIntosh JM, et al. Crucial role of alpha4 and alpha6 nicotinic acetylcholine receptor subunits from ventral tegmental area in systemic nicotine self-administration. J Neurosci. 2008;28:12318–27. doi: 10.1523/JNEUROSCI.3918-08.2008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  49. Azam L, Winzer-Serhan U, Leslie FM. Co-expression of α7 and β2 nicotinic acetylcholine receptor subunit mRNAS within rat brain cholinergic neurons. Neurosci. 2003;119:965–77. doi: 10.1016/s0306-4522(03)00220-3. [DOI] [PubMed] [Google Scholar]
  50. Khiroug SS, Harkness PC, Lamb PW, Sudweeks SN, Khiroug L, Millar NS, et al. Rat nicotinic Ach receptor α7 and β2 subunits co-assemble to form functional heteromeric nicotinic receptor channels. J Physiol. 2002;540.2:425–34. doi: 10.1113/jphysiol.2001.013847. [DOI] [PMC free article] [PubMed] [Google Scholar]
  51. Peng JH, Fryer JD, Hurst RS, Schroeder KM, George AA, Morrissy S, et al. High-affinity epibatidine binding of functional, human α7-nicotinic acetylcholine receptors stably and heterologously expressed de novo in human SH-EP1 cells. J Pharm Exp Ther. 2005;313:24–35. doi: 10.1124/jpet.104.079004. [DOI] [PubMed] [Google Scholar]
  52. Laummonerie C, Mutterer J.Colocalization Finder Version 1.2 plug-in for Image J image analysis softwareAvailable online http://rsb.info.nih.gov/ij/plugins/colocalization-finder.html. 2006

Articles from Acta Pharmacologica Sinica are provided here courtesy of Nature Publishing Group

RESOURCES