Abstract
Peroxisomal matrix proteins are synthesized on cytosolic ribosomes and transported to the organelle by shuttling receptors. Matrix proteins containing a type 1 signal are carried to the peroxisome by PEX5, whereas those harboring a type 2 signal are transported by a PEX5-PEX7 complex. The pathway followed by PEX5 during the protein transport cycle has been characterized in detail. In contrast, not much is known regarding PEX7. In this work, we show that PEX7 is targeted to the peroxisome in a PEX5- and cargo-dependent manner, where it becomes resistant to exogenously added proteases. Entry of PEX7 and its cargo into the peroxisome occurs upstream of the first cytosolic ATP-dependent step of the PEX5-mediated import pathway, i.e., before monoubiquitination of PEX5. PEX7 passing through the peroxisome becomes partially, if not completely, exposed to the peroxisome matrix milieu, suggesting that cargo release occurs at the trans side of the peroxisomal membrane. Finally, we found that export of peroxisomal PEX7 back into the cytosol requires export of PEX5 but, strikingly, the two export events are not strictly coupled, indicating that the two proteins leave the peroxisome separately.
INTRODUCTION
Peroxisomal matrix proteins are synthesized on cytosolic ribosomes and posttranslationally targeted to the organelle via one of two peroxisomal targeting sequences (PTSs): (i) the PTS type 1 (PTS1), a small peptide frequently ending with the sequence SKL located at the C terminus of the vast majority of matrix proteins (1, 2), and (ii) the PTS2, a degenerated nonapeptide present at the amino terminus of a few matrix proteins (3–5). In contrast to the PTS1, the PTS2 is generally cleaved when the protein reaches the organelle matrix (5–7). In mammals and many other organisms, both PTS1 and PTS2 proteins are transported to the organelle by PEX5, the peroxisomal shuttling receptor (8–11). The interaction of PEX5 with PTS1 proteins is direct (12–16), whereas the interaction between PEX5 and PTS2 proteins requires the adaptor protein PEX7 (17–19). Interestingly, not all PEX5 proteins in a mammalian cell are capable of binding PEX7. This is due to alternative splicing of the PEX5 transcript, which yields two major isoforms of the receptor, PEX5S and PEX5L. In contrast to PEX5L, PEX5S is not able to bind PEX7 because it lacks an internal 37-amino-acid domain (8, 10). The situation in yeasts is different. While these organisms also use PEX5 to target PTS1 proteins to the peroxisome, import of PTS2 proteins is promoted by PEX7 and a species-specific member of the so-called PEX20 family (19–23), a group of proteins that have no mammalian counterpart but that display functional similarities with the N-terminal half of PEX5L (17, 19, 24).
The pathway followed by PEX5 during the protein transport process is reasonably known (25–28). After binding a cargo protein in the cytosol, PEX5 interacts with the peroxisomal docking/translocation machinery (DTM) (29), a peroxisomal membrane protein complex comprising PEX13, PEX14, and the RING peroxins PEX2, PEX10, and PEX12 (30–32). Following this docking event, PEX5 gets inserted into the DTM, acquiring a transmembrane topology (33, 34), a step that results in the translocation of the cargo protein across the organelle membrane and its release into the peroxisomal lumen (35, 36). Interestingly, none of these steps require cytosolic ATP (35–37). PEX5 is then extracted from the DTM through a two-step mechanism. First, PEX5 is monoubiquitinated at a conserved cysteine (Cys 11 in human PEX5) (38, 39); this monoubiquitinated PEX5 species is subsequently dislocated from the DTM in an ATP-dependent manner by the receptor export module (REM), a protein complex comprising the two mechanoenzymes PEX1 and PEX6 (37, 40–42). Finally, ubiquitin is removed from PEX5 probably by a combination of enzymatic and nonenzymatic mechanisms (43–45).
In contrast to all the data available for PEX5, our knowledge on the pathway followed by PEX7 during the PTS2 protein import is still incomplete. Actually, for mammalian PEX7, besides a recent report showing that the protein associates with peroxisomes and acquires a protease-protected status in a cytosolic ATP-independent manner (46), not much else is presently known. Data on PEX7 from yeasts are somewhat more abundant (reviewed in reference 4). For instance, it has been suggested that yeast PEX7 interacts first with the PTS2 cargo protein and subsequently with a member of the PEX20 family; this cytosolic trimeric complex then interacts with the DTM, leading to the translocation of the cargo protein into the matrix of the organelle (47). Such pathway would suggest that PEX7 reaches the peroxisome in a cargo-dependent manner, as is in fact the case for mammalian PEX5 working in the PTS1 protein import pathway (29). Intriguingly, however, PEX7 can also be found in peroxisomes in strains lacking PEX20 and that, therefore, do not import PTS2 proteins (48).
There are also some data on the intraperoxisomal pathway followed by yeast PEX7. According to Nair and coworkers, this protein is completely translocated across the peroxisomal membrane during its normal protein transport cycle (49). However, as stated above, these organisms use a member of the PEX20 family, and not PEX5, to transport PEX7-PTS2 cargo protein complexes to the peroxisome. This fact, together with the idea that PEX20 itself may accompany PEX7 during its journey through the peroxisome matrix (48, 50), raises doubts on whether or not the yeast data can be extrapolated to the mammalian system (see also Discussion).
In this work, we have optimized a previously established peroxisomal in vitro import system to study the pathway followed by mammalian PEX7 during the PTS2 protein import cycle. We found that PEX7 reaches the peroxisome in a PEX5L- and PTS2-dependent manner, where it acquires a protease-protected status. Acquisition of this status occurs upstream of the first cytosolic ATP-dependent step, i.e., before ubiquitination of PEX5L. This in vitro import system also allowed us to characterize the export step of PEX7. Our results show that whenever export of PEX5L is inhibited, that of PEX7 is also blocked. This suggests that PEX7 exits the organelle through the DTM site occupied by PEX5L. Importantly, in vitro imported PEX5L and PEX7 display different export kinetics, suggesting that their export is uncoupled. Finally, we provide evidence indicating that PEX7 traveling through the peroxisome becomes partially, if not completely, exposed to the peroxisome matrix milieu.
MATERIALS AND METHODS
Plasmids.
The cDNA coding for the full-length human PEX7 (pGEM4-PEX7) was obtained by PCR amplification using the plasmid SC119985 (OriGene) as the template and the primers 5′-GCCTCTAGAGCCACCATGAGTGCGGTGTGCGGTGGA-3′ and 5′-GCGCGGTACCTCAAGCAGGAATAGTAAGAC-3′. The amplified fragment was cloned into the XbaI and the KpnI sites of pGEM4 (Promega). A plasmid encoding PEX7 possessing a tryptophan instead of a leucine at position 70 [PEX7(L70W)] was obtained with the QuikChange site-directed mutagenesis kit (Stratagene) using pGEM4-PEX7 as the template and the primers 5′-GGAATGATGGTTGGTTTGATGTGACTTGG-3′ and 5′-CCAAGTCACATCAAACCAACCATCATTCC-3′. A plasmid encoding preL4R-PEX7, a PEX7 protein possessing at its N terminus the peptide MAQRRQVVLGHLRGPADSGWMPQAAPCLSGASR, was constructed as follows. Plasmid SC119985 was used as the template in a PCR with the primers 5′-GCCTCTAGAATGAGTGCGGTGTGCGGTGGA-3′ and 5′-GCGCGGTACCTCAAGCAGGAATAGTAAGAC-3′, and the obtained DNA fragment was inserted into XbaI/KpnI-digested pGEM4 (Promega). This plasmid was then digested with SphI and XbaI and ligated to the preannealed primers 5′-CCACCATGGCGCAGAGGCGGCAGGTAGTGCTGGGCCACCTGAGGGGTCCGGCCGATTCCGGCTGGATGCCGCAGGCCGCGCCTTGCCTGAGCGGTGCCT-3′ and 5′-CTAGAGGCACCGCTCAGGCAAGGCGCGGCCTGCGGCATCCAGCCGGAATCGGCCGGACCCCTCAGGTGGCCCAGCACTACCTGCCGCCTCTGCGCCATGGTGGCATG-3′. The peptide preceding PEX7 in the preL4R-PEX7 fusion protein contains amino acid residues 2 to 30 of human prethiolase, in which leucine 4 was replaced by an arginine (numbering of full-length human prethiolase [51]). This peptide still contains the cleavage site for the matrix-processing peptidase, but the L4R mutation abolishes its PTS2 function (52). The plasmid encoding full-length human thiolase precursor (pGEM4-pre-Thiolase) was described elsewhere (35). A plasmid coding for prethiolase possessing the L4R mutation (pGEM4-preL4R-Thiolase) was obtained with the QuikChange site-directed mutagenesis kit (Stratagene), using pGEM4-pre-Thiolase as the template and the primers 5′-ATGCAGAGGCGGCAGGTAGTGCTGGG-3′ and 5′-CCCAGCACTACCTGCCGCCTCTGCAT-3′. The plasmid pGEM4-PEX5L, encoding the large isoform of human PEX5, was described before (34). The plasmid encoding amino acid residues 1 to 324 of PEX5L possessing an alanine at position 11 [ΔC1PEX5L(C11A)] was obtained with the QuikChange site-directed mutagenesis kit (Stratagene), using pET28-ΔC1PEX5L as the template (53) and primers described elsewhere (44). The cDNA coding for histidine-tagged PEX7 was obtained by PCR amplification using the plasmid SC119985 (OriGene) as the template and the primers 5′-GTATGAGCCATATGAGTGCGGTGTGCGGTGGAG-3′ and 5′-GGCCGCGGAATTCTCAAGCAGGAATAGTAAGAC-3′. The amplified fragment was cloned into the NdeI and the EcoRI sites of pET-28a (Novagen). The cDNA encoding the mature form phytanoyl-coenzyme A (CoA) hydroxylase (m-PHYH) was obtained by PCR amplification of the plasmid described in reference 54 using the primers 5′-GGCGCGGTACCATCAGGGACTATTTCCTCTGCC-3′ and 5′-GGCGCAAGCTTTCAAAGATTGGTTCTTTCTCC-3′ and cloned into the KpnI and HindIII sites of pQE31 (Qiagen).
Recombinant proteins.
The recombinant large isoform of human PEX5 (PEX5L) (55), PEX5L containing the missense mutation N526K [PEX5L(N526K)] (56), proteins comprising amino acid residues 1 to 324 or 315 to 639 of PEX5L (ΔC1PEX5L protein and TPRs, respectively), ΔC1PEX5L protein containing the missense mutation C11A [ΔC1PEX5L(C11A) protein] (53, 57), a protein comprising the first 287 amino acid residues of the small isoform of human PEX5 (ΔC1PEX5S protein) (35), the glutathion S-transferase (GST)–ubiquitin (Ub) fusion protein (38), the precursor of human phytanoyl-CoA hydroxylase (p-PHYH) and its mature form (m-PHYH) (54), human PEX19 (58), and a protein comprising the first 80 amino acid residues of human PEX14 (NDPEX14) (57) were obtained as described previously. Histidine-tagged PEX7 was expressed in the BL21(DE3) strain of Escherichia coli and obtained as inclusion bodies. The fusion protein was purified by HIS-select nickel affinity gel (Sigma) under denaturing conditions (6 M guanidine hydrochloride) and concentrated by trichloroacetic acid precipitation.
In vitro import/export reactions.
Liver postnuclear supernatants (PNS) from rat or PEX7-knockout mice were prepared as described before (34). In a typical import reaction (100 μl final volume), 35S-labeled proteins (1 to 2 μl of the rabbit reticulocyte lysates; see below) were diluted to 10 μl with import buffer [20 mM morpholinepropanesulfonic acid (MOPS)-KOH, pH 7.4, 0.25 M sucrose, 50 mM KCl, 3 mM MgCl2, 20 μM methionine, 2 μg/ml N-(trans-epoxysuccinyl)-l-leucine 4-guanidinobutylamide, 2 mM reduced glutathione, final concentrations] and added to 500 μg of liver PNS that had been primed for import (5 min of incubation at 37°C in import buffer containing 0.3 mM ATP; see references 35 and 37 for details). Reaction mixtures were incubated for 30 min at 37°C, unless otherwise stated. ATP or AMP-PNP were used at a 3 mM final concentration. NTP depletion from both PNS and reticulocyte lysates using apyrase (grade VII; Sigma) was done exactly as described previously (36). Where indicated, import reaction mixtures were supplemented with recombinant PEX5 proteins [PEX5L, PEX5L(N526K), ΔC1PEX5L, ΔC1PEX5L(C11A), or ΔC1PEX5S; 30 nM final concentrations], GST-Ub or bovine ubiquitin (10 μM), and recombinant p-PHYH or m-PHYH (140 nM final concentration). After import, reaction mixtures were treated with pronase (500 μg/ml final concentration) for 45 min on ice and processed for SDS-PAGE/autoradiography exactly as described before (35). In some experiments, organelles were resuspended in import buffer and subjected to pronase digestion in the presence or absence of 1% (wt/vol) Triton X-100.
In the in vitro export assays, radiolabeled proteins were first subjected to an import assay for 15 min. Further import was then stopped either by adding recombinant NDPEX14 to the reaction (30 μM final concentration) or by isolating the organelles by centrifugation and resuspending them in import buffer. In earlier experiments, cytosolic proteins derived from 500 μg of liver PNS were also added. The organelle suspensions were then incubated at 37°C in the presence of either 5 mM ATP or AMP-PNP.
For the PTS2-only in vitro import/export experiments, PNS were preincubated with 1 μM recombinant TPRs for 10 min on ice, before starting the import assays. This recombinant protein, corresponding to the C-terminal half of PEX5, comprises its PTS1-binding domain and is used here to sequester endogenous PTS1-containing proteins (13, 29, 56). Also, the reticulocyte lysates containing 35S-PEX7 and 35S-PEX5L (2 μl each) were preincubated with recombinant p-PHYH (20 min at 23°C in 10 μl of import buffer) to favor formation of the trimeric PEX5L-PEX7-PTS2 complex. The export incubation was carried out as described above, but in the presence of 1 μM TPRs and 10 μM NDPEX14.
Subcellular fractionation.
Pronase-treated organelles from an import reaction or rat liver purified peroxisomes were resuspended in 20 mM MOPS-KOH, pH 7.4, 0.25 M sucrose, 1 mM EDTA, 2 mM dithiothreitol (DTT), 0.1 mg/ml phenylmethanesulfonylfluoride, and 1:500 (vol/vol) mammalian protease inhibitor mixture (Sigma) and disrupted by sonication using a SONOPULS HD2200-BANDELIN equipped with an MS 73 microtip. The sonication conditions used (40% duty cycle, 10% output power for just 25 s) were established as the mildest ones resulting in a quantitative extraction of catalase from peroxisomes. Membrane and matrix components were separated by centrifugation at 100,000 × g for 60 min.
Miscellaneous.
All 35S-labeled proteins were synthesized using the TNT T7 quick coupled transcription/translation kit (Promega) in the presence of [35S]methionine (specific activity of >1,000 Ci/mmol; PerkinElmer Life Sciences). Although no attempts were made to quantify the amounts of radiolabeled proteins in our reactions, note that, according to the manufacturer, 1 μl of reticulocyte lysate typically produces 2 to 6 ng of radiolabeled protein. For 35S-PEX7, this corresponds to a final concentration of 0.6 to 3.4 nM in the import assays. An antibody directed to human PEX7 was produced in rabbits using recombinant histidine-tagged PEX7. The antibody directed to PEX13 was described elsewhere (59), and the one against catalase was purchased from Research Diagnostics, Inc. (catalogue number RDI-CATALASEabr). All antibodies were detected using goat alkaline phosphatase-conjugated anti-rabbit antibodies (A9919; Sigma).
Densitometric analyses of autoradiography films were performed using the ImageJ software (W. S. Rasband, U.S. National Institutes of Health, Bethesda, MD; http://imagej.nih.gov/ij).
RESULTS
PEX7 reaches the peroxisome in a PEX5L- and PTS2-dependent manner.
We have previously described an improved in vitro system to characterize the peroxisomal import mechanism of prethiolase, a PTS2-containing protein (35). The system relies on a rat liver postnuclear supernatant as a source of peroxisomes and cytosolic components, supplemented with either recombinant ΔC1PEX5L protein (amino acid residues 1 to 324 of PEX5L) or PEX5L(N526K) protein (PEX5L possessing a lysine at position 526 instead of an asparagine) (56, 60). These two PEX5 proteins contain an intact PEX7-binding domain as well as all the other elements required for a productive interaction with the peroxisomal protein import machinery, and thus they are still competent in the PTS2-mediated import pathway. However, they do not efficiently bind PTS1 proteins (8, 60, 61), an advantage when studying the PTS2-mediated import pathway (see below). In this work, we used this improved system to analyze PEX7.
Figure 1A shows the results of in vitro import assays performed with both 35S-labeled PEX7 and prethiolase. In the absence of ΔC1PEX5L protein, or in the presence of ΔC1PEX5S protein (a protein almost identical to ΔC1PEX5L protein that lacks the PEX7-binding domain; see the introduction), only a small fraction of protease-protected (imported) thiolase was observed in organelle pellets, as expected (35), and the same is true for 35S-PEX7 (lanes 1 and 3). A 5-fold increase in the amounts of both radiolabeled proteins was observed when the import assays were supplemented with either recombinant ΔC1PEX5L or PEX5L(N526K) protein (lanes 2 and 5). Recombinant PEX5L also improves the import efficiencies of both prethiolase and PEX7 but only by a factor of ≈2.5 (compare lanes 1 and 4). The weaker stimulatory effect obtained with PEX5L is probably due to the fact that this protein also interacts with endogenous PTS1-containing proteins present in the PNS, creating a competition problem at the peroxisomal DTM (see also reference 35). Importantly, the in vitro import yields of 35S-PEX7 obtained in the presence of ΔC1PEX5L protein can be further improved by a factor of 2 when a recombinant PTS2 protein, prephytanoyl-CoA 2-hydroxylase (p-PHYH), is added to the assay (Fig. 1B, compare lanes 3 and 4). The stimulatory effect of p-PHYH on PEX7 import contrasts with its inhibitory effect on prethiolase import (Fig. 1B, compare lanes 3 and 4). Recombinant phytanoyl-CoA 2-hydroxylase lacking the PTS2 (m-PHYH) has no such effects (Fig. 1C, compare lanes 2 and 3). These findings strongly indicate that the 35S-PEX7 protein used in these experiments is truly functioning in the PTS2-mediated protein import pathway. Further data corroborating this conclusion were obtained when a PNS from PEX7-knockout mice (62) was used in import assays. As shown in Fig. 1D (lane 1), an assay using PNS from these mice supplemented with ΔC1PEX5L protein (and 2 μl of a mock-translated reticulocyte lysate) failed to reveal import of prethiolase. In contrast, the addition of just 2 μl of the lysate containing 35S-PEX7 was sufficient to promote import and partial processing of prethiolase (Fig. 1D, lane 2). A nonfunctional PEX7 protein harboring a mutation previously described in a patient with rhizomelic chondrodysplasia punctata type 1 [PEX7(L70W)] (63) was not competent in this assay, as expected (Fig. 1D, lane 3). Note that PEX7 alone is readily degraded by the protease used in these assays (Fig. 1E, lane 2) and that the resistance it acquires during in vitro import vanishes in the presence Triton X-100, a mild detergent that solubilizes biological membranes (Fig. 1F, lane 2). Taken together, the experiments described above strongly indicate that in vitro synthesized PEX7 reaches the peroxisome in a PEX5L- and PTS2-dependent manner, where it acquires a protease-protected status.
FIG 1.
35S-PEX7 acquires a protease-protected and organelle-associated status in in vitro import reactions in a PEX5L- and PTS2-dependent manner. (A to C) In vitro import assays of 35S-PEX7 and 35S-prethiolase in the absence or presence of the indicated recombinant proteins. PEX5L(N526K) protein is indicated by “PEX5NK.” Lane I, 10% (A and B) or 5% (C) of the reticulocyte lysates containing 35S-PEX7 and 35S-prethiolase used in each reaction. The asterisks in panels A and B mark a radiolabeled band occasionally produced by the in vitro translation kit in an unspecific manner. (D) PEX7, but not PEX7(L70W) protein, promotes import of 35S-prethiolase to peroxisomes from PEX7-knockout mice. PNS from PEX7-knockout mouse liver was used in import assays with 35S-prethiolase in the presence of a mock-translated reticulocyte lysate (lane 1) or lysates containing 35S-PEX7 (lane 2) or 35S-PEX7(L70W) protein (lane 3). Lanes I1, I2, and I3, 5% of the reticulocyte lysates containing 35S-prethiolase, 35S-PEX7, and 35S-PEX7(L70W) protein used in the reactions, respectively. pre-Thiol and m-Thiol, precursor and mature forms of thiolase, respectively. (E) Soluble 35S-PEX7 is completely susceptible to pronase in the absence of Triton X-100. (F) Organelles from an import assay made in the presence of recombinant ΔC1PEX5L protein and p-PHYH were isolated by centrifugation, resuspended in import buffer, and subjected to pronase digestion in the absence (lane 1) or presence (lane 2) of 1% (wt/vol) Triton X-100. Lane I, 5% of the reticulocyte lysate containing 35S-PEX7. In panels A to D and F, pronase-treated organelles were analyzed by SDS-PAGE and blotted onto a nitrocellulose membrane. Autoradiographs (top panels) and the corresponding Ponceau S-stained membranes (bottom panels) are shown.
The energetics of PEX7 import.
We have previously shown that (i) PEX5L becomes inserted into the DTM in a cytosolic ATP-independent process (37, 40, 64) and (ii) translocation of prethiolase across the DTM into the peroxisomal matrix occurs upstream of the first cytosolic ATP-dependent step, i.e., before monoubiquitination of PEX5L (35). Not surprisingly, we found that the energetic requirements of PEX7 import are identical, as was in fact also reported by others (46). As shown in Fig. 2A, neither supplementation of import reaction mixtures with AMP-PNP (a nonhydrolyzable ATP analog) (65) nor pretreatment of the 35S-PEX7 protein and PNS with apyrase (an enzyme that hydrolyzes ATP and other NTPs) (66) blocked PEX7 import (compare lane 1 with lanes 2 and 3).
FIG 2.
The energetics of PEX7 import. (A) A primed rat liver PNS fraction (see Materials and Methods) was incubated with 35S-PEX7 for 7 min in import buffer containing ΔC1PEX5L protein and p-PHYH in the presence of either ATP (lane 1) or AMP-PNP (lane 2). An identical assay but using apyrase-treated PNS and 35S-PEX7 was also performed (lane 3). Lanes I1 and I2, 5% of the reticulocyte lysates containing 35S-PEX7 used in lanes 1 and 2 and lane 3, respectively. (B) A nonmonoubiquitinatable form of PEX5 [ΔC1PEX5L(C11A)] is as efficient as ΔC1PEX5L protein in targeting PEX7 and prethiolase to the peroxisome. Import assays with 35S-PEX7 and 35S-prethiolase were made in import buffer containing ATP and GST-Ub, in the absence (lane 1) or presence (lane 2) of recombinant ΔC1PEX5L or ΔC1PEX5L(C11A) (lane 3) protein. Note that ubiquitination of ΔC1PEX5L protein with GST-Ub results in a species that is no longer export competent (38, 53). Lane I, 5% of the reticulocyte lysates containing 35S-PEX7 and 35S-prethiolase were mixed and loaded together in the same lane. Pronase-treated organelles were analyzed as described for Fig. 1. Autoradiographs (top panels) and the corresponding Ponceau S-stained membranes (bottom panels) are shown.
Interestingly, although export of peroxisomal PEX7 is ATP dependent (as it will be shown below), the levels of peroxisomal PEX7 observed under the different energetic conditions are identical. This finding suggests that export of PEX7 from the peroxisome becomes a rate-limiting step in this optimized in vitro import system.
The data in Fig. 2A showing that PEX7 import is not blocked in assays containing apyrase, a condition previously shown to block PEX5L monoubiquitination (35, 36), also suggest that import of PEX7, like import of prethiolase, occurs upstream of PEX5L monoubiquitination. Additional data supporting this conclusion are presented in Fig. 2B. Identical amounts of protease-protected 35S-PEX7 and thiolase were obtained in import reaction mixtures supplemented with either ΔC1PEX5L protein or ΔC1PEX5L(C11A) mutant protein, which possesses an alanine at position 11. The substitution of cysteine 11 by an alanine results in a PEX5 protein that can still enter the DTM but that is no longer monoubiquitinated (44).
The N terminus of peroxisomal PEX7 is exposed into the organelle matrix.
The fact that peroxisomal 35S-PEX7 is resistant to exogenously added proteases suggests that PEX7 exposes no major domains into the cytosol but provides no clues on how deep in peroxisomes it reaches. To address this issue, we adapted a strategy previously used by others to show that a portion of the polypeptide chain of peroxisomal PEX5L reaches the peroxisomal matrix (52). Specifically, we synthesized a PEX7 protein having at its N terminus a cleavable, but otherwise nonfunctional, mutant version of thiolase presequence and asked whether this PEX7 protein (here referred to as preL4R-PEX7) could be cleaved in our in vitro import assays. A control experiment with a prethiolase carrying the same mutation (L4R) confirmed that this mutant presequence is not functional in our in vitro assays (Fig. 3A). As shown in Fig. 3B, preL4R-PEX7 subjected to in vitro import assays not only acquired a protease-resistant status in a PEX5L- and PTS2-dependent manner but was also converted into a 2- to 3-kDa-shorter protein. Furthermore, preL4R-PEX7, like PEX7, is also able to restore import of prethiolase in PNS from the PEX7-knockout mice (Fig. 3C). Processing of preL4R-PEX7 requires its passage through the peroxisome because nearly no processed PEX7 could be detected when the import assays were performed in the presence of NDPEX14, a recombinant protein comprising the PEX5-binding domain of PEX14 (67) (Fig. 3D, compare lanes 1 and 5 with lanes 3 and 7). As shown before, this recombinant protein completely blocks the PEX5-mediated protein import pathway (36). Interestingly, when the protease treatment was omitted, cleaved PEX7 was also detected in the supernatant of the import assays but only under import-permissive conditions (Fig. 3D, compare lanes 2 and 4), suggesting that our in vitro system can also be used to study PEX7 export. Finally, and in agreement with the data shown in Fig. 2B, cleavage of preL4R-PEX7 was also observed when its import was promoted by ΔC1PEX5L(C11A) protein (Fig. 3E). Interestingly, when this export-incompetent PEX5L species is used in these assays, almost no cleaved PEX7 is recovered in the supernatant fraction (Fig. 3E, compare lanes 3 and 4), suggesting that export of cleaved PEX7 is somehow dependent on PEX5L ubiquitination/export (see also below). In summary, these results indicate that at least the N terminus of PEX7 reaches a location where it can be cleaved by the protease that processes PTS2 proteins, i.e., the peroxisomal matrix.
FIG 3.
PEX7 becomes transiently exposed to the organelle matrix during the PTS2-mediated protein import pathway. (A) 35S-prethiolase containing an arginine instead of a leucine at position 4 (preL4R-Thiol; lane 2), in contrast to 35S-prethiolase (pre-Thiol; lane 1), is not imported in vitro. Lanes I1, I2, and I3, 5% of the reticulocyte lysates containing 35S-PEX7, 35S-prethiolase, and 35S-preL4R-thiolase, respectively. (B) 35S-preL4R-PEX7 was subjected to import assays in the absence (lane 1) or presence (lanes 2 to 4 of the indicated recombinant proteins). Pronase-treated organelles were analyzed by SDS-PAGE and blotted onto a nitrocellulose membrane. clv-PEX7, cleaved 35S-preL4R-PEX7. (C) 35S-preL4R-PEX7 promotes import of 35S-prethiolase to peroxisomes from PEX7-knockout mice. PNS from PEX7-knockout mice was used in import assays with 35S-prethiolase in the presence of either a mock-translated reticulocyte lysate (lane 1) or a lysate containing 35S-preL4R-PEX7 (lane 2). Import and processing of 35S-prethiolase is best seen in import assays using unlabeled/cold preL4R-PEX7 (lane 3) due to the fact that mature thiolase comigrates with uncleaved preL4R-PEX7 (lane 2, asterisk). Lanes I1 and I2, 5% of the reticulocyte lysates containing 35S-preL4R-PEX7 and 35S-prethiolase used. (D) Control experiments showing that processing of 35S-preL4R-PEX7 in import assays occurs only under import-permissive conditions. 35S-preL4R-PEX7 was subjected to import assays in the presence of the indicated recombinant proteins. At the end of the incubation, the samples were halved and treated or not with pronase, as indicated. The import reaction mixtures were then centrifuged to obtain organelle pellets (P) and supernatants (S). Total pellets (derived from 500 μg of PNS) and one-fourth of the corresponding supernatants were subjected to SDS-PAGE and blotted onto a nitrocellulose membrane. The asterisk indicates a soluble minor preL4R-PEX7-derived fragment displaying some resistance to pronase. PEX19, a protein involved in another aspect of peroxisome biogenesis (74), was used in these assays as a negative control for NDPEX14. (E) Import assays with 35S-preL4R-PEX7 were performed in the presence of ΔC1PEX5L (lanes 1 and 3) or ΔC1PEX5L(C11A) (lanes 2 and 4) protein. Pronase-treated organelles (lanes P) and untreated supernatants (lanes S) were analyzed as described for panel D. Autoradiographs (top panels) and the Ponceau S-stained membranes (bottom panels) are shown. Lane I, 5% of the reticulocyte lysate containing 35S-preL4R-PEX7 used in each reaction.
Export of PEX7 from the peroxisome requires export of PEX5L, but the two events are not strictly coupled.
PEX7 functions as a shuttling receptor, meaning that peroxisomal PEX7 is eventually exported back to the cytosol (4). Aiming at characterizing in detail this process, we developed a two-step protocol in which 35S-PEX7 is first subjected to an import assay, and after blocking further import (see Materials and Methods for details), the organelle suspension is then subjected to a second incubation step, the export assay. The results of one of these assays performed under standard conditions show that the amount of organelle-associated protease-protected 35S-PEX7 decreases over time with the concomitant appearance of 35S-PEX7 in the supernatant (Fig. 4A). Interestingly, experimental conditions that inhibit export of peroxisomal PEX5L back into the cytosol also block export of PEX7. As shown in Fig. 4B (top), almost no export of PEX7 was detected in assays made in the presence of AMP-PNP (see also Fig. 4C). This nonhydrolyzable ATP analogue still allows PEX5L monoubiquitination at the DTM but blocks the receptor export module (45). A similar inhibition was observed when both the import and export incubations were made in the presence of a GST-ubiquitin fusion protein (Fig. 4B, middle, and C). As shown before, ubiquitination of DTM-embedded PEX5L with this ubiquitin analogue results in a species that is no longer export competent (38). Note that we have been unable to detect any ubiquitination of PEX7 in our in vitro assays (even under nonreducing conditions; data not shown), suggesting that the effect of GST-Ub on PEX7 export occurs via PEX5L. In agreement with this interpretation, and with the data shown in Fig. 3E, when 35S-PEX7 was imported in the presence of ΔC1PEX5L(C11A) protein, no significant export of 35S-PEX7 was detected (Fig. 4B, bottom, and C). Thus, peroxisomal PEX7 is exported back into the cytosol only when PEX5L is also exported.
FIG 4.
PEX7 is exported back to the cytosol in a PEX5L export-dependent manner. (A) 35S-PEX7 was imported for 15 min in the presence of p-PHYH, ΔC1PEX5L protein, ubiquitin, and ATP. The reaction mix was then diluted with ice-cold import buffer, and the organelles were isolated by centrifugation and subjected to an export assay in the presence of ATP (see Materials and Methods for details). Aliquots were collected at the indicated time points, and one half was treated with pronase while the other was left untreated. Equivalent amounts of organelles from the pronase-treated aliquots and supernatants from the untreated aliquots (derived from 125 μg of PNS) were analyzed by SDS-PAGE and blotted onto a nitrocellulose membrane. (B) PEX7 export assays. In “standard reactions,” the ΔC1PEX5L protein- and p-PHYH-mediated import of 35S-PEX7 was allowed to occur at 37°C for 15 min in the presence of ubiquitin and ATP. At this point, import was inhibited by the addition of NDPEX14 (30 μM), and the reaction was further incubated. Aliquots were taken at the indicated time points. Pronase-treated organelles were subjected to SDS-PAGE analysis and blotted onto a nitrocellulose membrane. PEX7 export was inhibited when ATP was replaced by AMP-PNP (top). Likewise, replacing ubiquitin by GST-Ub in the import step inhibits subsequent export of PEX7 (middle). The same inhibition was observed when recombinant ΔC1PEX5L protein was replaced by ΔC1PEX5L(C11A) protein (bottom). Lane I, 5% of the reticulocyte lysates containing 35S-PEX7. Autoradiograph (top panels) and the corresponding Ponceau S-stained membrane (bottom panels) are shown. (C) The bar graph shows the average percentage of PEX7 export after 20 min under the conditions described in the legend to panel B. Standard deviations (n ≥ 3 experiments) are also presented.
Several hypotheses could explain this phenomenon. An obvious one would be to assume that export of PEX7 is coupled to that of PEX5L. Alternatively, it might be that PEX5L arrested at the DTM simply blocks the site used by PEX7 to exit the organelle. In an attempt to clarify this issue, we determined the export kinetics of both proteins. Obviously, such an experiment would be informative only if we could find conditions where PEX5L reaches the peroxisome in a PTS2-only mode. With this in mind, we performed in vitro assays in the presence of a recombinant protein comprising the PTS1-binding domain of PEX5 (referred to as TPRs), a strategy previously shown to efficiently block the PTS1-dependent targeting of PEX5L to the peroxisome (29, 56), and asked whether peroxisomal targeting of PEX5L could be recovered by adding 35S-PEX7 and recombinant p-PHYH to the import assays. As shown in Fig. 5A, this strategy turned out to be feasible. Using these experimental conditions, we then employed the two-step import-export protocol described above to compare the export kinetics of 35S-PEX7 and 35S-PEX5L. Briefly, after an import step performed in the presence of AMP-PNP, the organelles were isolated by centrifugation, resuspended in import buffer, and subjected to an export assay. Aliquots were then withdrawn at various time points, and protease-treated organelles were analyzed by SDS-PAGE/autoradiography. As shown in Fig. 5B, two populations of 35S-PEX5L displaying different protease susceptibilities were detected in this experiment, as expected (34, 38, 64). The most abundant at time zero of the export step is the so-called stage 3 PEX5L, a DTM-embedded monoubiquitinated species that leaves the peroxisome very rapidly in the presence of ATP (Fig. 5B, compare lanes 0′ and 2′; see also references 38 and 64 and the legend to Fig. 5B for additional details regarding the properties of peroxisomal PEX5L). The other population is stage 2 PEX5L (the precursor of stage 3 PEX5L), a nonubiquitinated species that is cleaved at its N terminus by the protease used in these assays, yielding a 2-kDa-shorter protein. Due to the fact that the buffer used in the export step lacked ubiquitin and components of the ubiquitin-conjugating cascade, the majority of stage 2 PEX5L was not converted into stage 3 PEX5L and therefore remained in the organelles. Densitometric analyses of autoradiographs revealed that about 70% of total peroxisomal 35S-PEX5L left the organelle in the first 2 min of the export incubation (Fig. 5B; bottom panel). Importantly, the export kinetics of 35S-PEX7 is considerably slower, a difference particularly evident at the 2-min time point of the export assay. Apparently, when PEX5L is exported from the peroxisome, it leaves behind a fraction of PEX7, a finding strongly suggesting that export of the two proteins is not coupled. In summary, the data in Fig. 4 and 5 suggest that at least a fraction of PEX7 and PEX5L leave the peroxisome separately but through the same site; the finding that no peroxisomal PEX7 is exported whenever PEX5L is arrested at the DTM suggests that DTM-embedded PEX5L behaves as a plug blocking the release of peroxisomal PEX7 into the cytosol (see also Discussion).
FIG 5.
Peroxisomal PEX5L and PEX7 display different export kinetics. (A) Targeting of PEX5L to the peroxisome in a PTS2-only in vitro import system. A reticulocyte lysate containing 35S-PEX5L was preincubated with either a mock-translated lysate (lane 1) or a lysate containing 35S-PEX7 plus 0.5 μg of p-PHYH (lane 2). Each mixture was then subjected to import assays using PNS supplemented with ATP and 1 μM recombinant TPRs, the PTS1-binding domain of PEX5. After pronase treatment, organelles were subjected to SDS-PAGE analysis and blotted onto a nitrocellulose membrane. Lanes I1 and I2, 5% of the reticulocyte lysates containing 35S-PEX7 and 35S-PEX5L used in the assays, respectively. (B) A mixture of 35S-PEX7 and 35S-PEX5L preincubated with recombinant p-PHYH was subjected to a 15-min import assay using TPR-treated PNS in the presence of AMP-PNP. The reaction was diluted with ice-cold import buffer, and the organelles were isolated by centrifugation, resuspended in import buffer, and subjected to an export assay in the presence of ATP, TPRs, and NDPEX14. Aliquots were collected at the indicated time points. Pronase-treated organelles were analyzed as described for panel A. Lanes I1 and I2, 2% of the reticulocyte lysates containing 35S-PEX7 and 35S-PEX5L used in the assays, respectively. The bar graph shows averages and standard deviations (n = 3 experiments) of the amounts of peroxisomal 35S-PEX7, stage 2 35S-PEX5L (PEX5 stg2), and stage 3 35S-PEX5L (PEX5 stg3) at each time point. Stage 2 and stage 3 PEX5 are two DTM-embedded transmembrane PEX5 populations (38, 44). Stage 2 PEX5 is converted into stage 3 PEX5 by monoubiquitination at its cysteine 11. The two populations display different susceptibility to proteases: stage 2 PEX5 is cleaved near the N terminus yielding a 2-kDa-shorter protein, whereas stage 3 PEX5 is completely resistant because the N-terminal domain is protected by the covalently attached ubiquitin moiety. Note that stage 3 PEX5L runs exactly as unmodified full-length PEX5L upon SDS-PAGE under reducing conditions because the PEX5-ubiquitin thiolester linkage is destroyed by DTT. The arrowhead indicates an export-incompetent N-terminally truncated PEX5L species produced in the in vitro transcription/translation reactions (see also reference 56). This species also serves as an internal negative control in the export assay.
Peroxisomal PEX5L engaged in the PTS2 import pathway remains tightly bound to the organelle membrane.
All the presently available data suggest that PEX5L shuttles between the cytosol and the peroxisomal DTM, where it acquires a transmembrane topology, without ever entering completely into the organelle matrix (29, 34, 37, 38, 68). However, it is important to note all those data were obtained with experimental systems in which PEX5L is mostly involved in the PTS1-mediated protein import pathway. Considering a previously proposed hypothesis that PEX20, the yeast functional counterpart of PEX5L, may enter completely into the organelle matrix together with PEX7 (50), it is possible that mammalian PEX5L functioning in the PTS2 import pathway also follows a similar route. To address this possibility, we used the PTS2-dependent import assay described above and tried to determine whether 35S-PEX5L cofractionates with either membrane or matrix peroxisomal proteins. Briefly, protease-treated organelles from ATP- or AMP-PNP-supplemented import assays were disrupted by sonication and subjected to ultracentrifugation to separate membrane from soluble proteins. The efficiency of this procedure was assessed by monitoring the behavior of catalase, a peroxisomal matrix protein (69, 70), and PEX13, an intrinsic peroxisomal membrane protein and a component of the DTM (71). As shown in Fig. 6A, 35S-PEX5L quantitatively cofractionated with the membrane marker PEX13. This result strongly indicates that, similarly to the situation in the PTS1-mediated import pathway, peroxisomal PEX5L engaged in the PTS2 protein import pathway remains tightly bound to the peroxisomal membrane. A different behavior was observed for PEX7. Indeed, although a major fraction of 35S-PEX7 was found in the membrane pellet, some protein was also detected in the soluble fraction. A similar distribution was observed for endogenous rat liver PEX7 present in highly pure peroxisome preparations (Fig. 6B). The detection of a soluble population of PEX7 in these experiments could well support the idea that PEX7 is completely released into the matrix of the organelle during the PTS2 import pathway, although further data are necessary to corroborate this possibility (see also Discussion).
FIG 6.
Peroxisomal PEX5L remains tightly bound to the peroxisomal membrane, while a fraction of PEX7 behaves as a matrix protein. (A) A mixture of 35S-PEX7 and 35S-PEX5L preincubated with p-PHYH was subjected to an import assay using TPR-treated PNS in the presence of ATP (left) or AMP-PNP (right), as indicated. After pronase treatment, organelles were disrupted by sonication. Half of the suspension was left on ice (lane T), while the other half was subjected to ultracentrifugation to obtain membrane (P) and soluble (S) fractions. Samples were analyzed by SDS-PAGE and blotted onto a nitrocellulose membrane. After autoradiography to detect 35S-PEX7 and 35S-PEX5L, the membrane was probed with antibodies against catalase (α-CATALASE) and PEX13 (α-PEX13). PEX5 stg2 and PEX5 stg3, stage 2 and stage 3 35S-PEX5L, respectively. Note that PEX13 is converted into 28- to 30-kDa fragments after protease treatment (33). (B) An identical sonication experiment was done using rat liver purified peroxisomes. The nitrocellulose membrane was also probed with antibodies against PEX7 (α-PEX7).
DISCUSSION
In this work, we show that mammalian PEX7 is targeted to the peroxisome in a PEX5L- and PTS2-dependent manner, where it acquires resistance to exogenously added proteases. Importantly, both PEX7 and prethiolase, a PTS2 protein, reach this protease-protected location in a cytosolic ATP-independent manner (35, 46) (this work), implying that the PEX7-PTS2 protein complex enters the peroxisome upstream of the first ATP-dependent step of the PEX5L-mediated protein import pathway, i.e., prior to monoubiquitination of DTM-embedded PEX5L. Additional data presented in this work corroborate this conclusion. As shown in Fig. 2B and 3E, a mutant version of PEX5L that cannot be monoubiquitinated at the DTM is as functional as the normal protein in promoting peroxisomal import of both PEX7 and prethiolase. Clearly, the PEX5L-mediated entry of both PEX7 and its cargo into the peroxisome is not linked to monoubiquitination of PEX5L at the DTM. Interestingly, this conclusion is in contrast to the so-called “export-driven import model,” a hypothetical mechanism recently proposed for the yeast PEX18/PEX7 system (72, 73). According to this idea, monoubiquitination/export of PEX18, a member of the PEX20 family and a functional counterpart of PEX5L in the PTS2 protein import pathway, is mechanically linked to the translocation of PEX7, and presumably its cargo, across the peroxisomal membrane. Seemingly, the different architectures of the PTS2 protein import machineries in these organisms translate into at least some significant mechanistic differences.
One of the aims of this work was to characterize the intraperoxisomal pathway followed by mammalian PEX7 during the PTS2 protein transport cycle. Up till now, there was only one study addressing this problem in a systematic manner. This is a work by Nair and colleagues describing the properties of a yeast PEX7-green fluorescent protein (GFP) fusion protein, a protein that although unable to complement the phenotype of a ΔPEX7 strain, accumulates massively in the peroxisomal matrix (49). As shown by those authors, cleavage of the fusion protein at the PEX7-GFP junction yielded a PEX7 protein that could now exit the organelle and rescue the phenotype of the ΔPEX7 strain. Apparently, there is a way out of the peroxisome for a PEX7 protein that was artificially accumulated in the matrix of the organelle. Based on those findings, it was proposed that PEX7 follows an “extended cycling mechanism,” i.e., that PEX7 enters completely into the peroxisome matrix during the PTS2 protein transport cycle (49). The results described here for preL4R-PEX7 strongly suggest that at least the N terminus of mammalian PEX7 enters sufficiently deep into the peroxisome matrix milieu to become accessible to the peroxisomal protease that cleaves the engineered presequence. Furthermore, fractionation of organelles by sonication did reveal the existence of a PEX7 pool displaying the properties expected for a peroxisomal matrix protein. Thus, the data presented here for mammalian PEX7 are surely compatible with the “extended cycling mechanism” proposed by Nair and colleagues (see Fig. 7, pathway A) (49). However, we must note that proteins weakly associated with a biological membrane may also be extracted into the soluble fraction by sonication. Therefore, we cannot formally exclude a scenario in which PEX7, like PEX5L, is retained at the DTM during all the steps occurring at the peroxisome, exiting the DTM only after PEX5L export (Fig. 7, pathway B). It is important to note that this second possibility would still be compatible with the data on yeast PEX7. Indeed, if we assumed that yeast PEX20 family members are retained at the DTM during their passage through the peroxisome, exposing their PEX7-binding domain into the organelle matrix, as it is likely the case for mammalian PEX5L, then it would be also reasonable to assume that any functional PEX7 generated de novo in the peroxisomal matrix could interact with a DTM-embedded PEX20 protein, thus returning to its normal pathway.
FIG 7.
Working model for the PEX5L-PEX7-mediated import pathway. After its assembly in the cytosol, the trimeric PEX5L-PEX7-PTS2 protein complex docks at the docking/translocation machinery (DTM) (arrow 1). This receptor-cargo complex then becomes inserted into the DTM (arrow 2). This step culminates with the PTS2 cargo protein being delivered to the organelle matrix (where the PTS2 is cleaved) and PEX5L displaying a transmembrane topology (i.e., stage 2 PEX5L). At this stage, PEX7 is completely protected from exogenous proteases, exposing at least its N terminus to the peroxisome matrix. PEX7 may be completely released from the DTM into the matrix milieu (pathway A) or may be retained at the DTM until the export step (pathway B). Following insertion into the DTM, PEX5L is monoubiquitinated at the conserved cysteine 11 residue (arrow 3), yielding stage 3 PEX5L. Monoubiquitination of PEX5L allows its ATP-dependent extraction from the DTM (arrow 4) and the subsequent export of PEX7 (arrow 5). After deubiquitination of PEX5L (arrow 6), the protein transport cycle restarts.
Many important aspects of the PTS2-mediated protein import pathway remain unclear. One directly related to this work regards the molecular details of PEX7 export. Our data suggest that PEX7 leaves the peroxisomal compartment through the DTM site occupied by PEX5L and that peroxisomal PEX5L and PEX7 probably exit the organelle separately. However, the implications of these findings on the molecular mechanism of PEX7 export are largely dependent on whether or not PEX7 enters completely into the organelle matrix. In pathway A (Fig. 7), the DTM would have the capacity to interact with a matrix PEX7 protein and somehow promote its export in a PEX5L-independent manner, while retaining all resident peroxisomal proteins in the matrix of the organelle. Pathway B, on the other hand, obviates the need for such a selectivity filter at the matrix side of the DTM and suggests that the ATP-dependent extraction of PEX5L from the DTM could also be coupled to the disruption of the interaction between PEX5L and PEX7, thus preparing PEX7 for a new PTS2 recognition event. Regardless of the pathway followed by PEX7, it is clear from our data that its export from the peroxisome requires PEX5-free DTMs and therefore the action of the mechanoenzymes PEX1 and PEX6. Thus, these ATP-dependent enzymes surely influence PEX7 export, but whether this functional connection is merely indirect (i.e., via PEX5 export) or direct remains to be determined.
Another issue that warrants future studies regards the protein transport capacity of PEX5L. Can a single molecule of PEX5L simultaneously transport a PTS1 and a PTS2 protein to the peroxisome, or are these mutually exclusive events? Clearly, further work is necessary to understand these complex details of the peroxisomal protein import machinery.
ACKNOWLEDGMENTS
This work was funded by FEDER funds through the Operational Competitiveness Programme, COMPETE, and by National Funds through FCT, Fundação para a Ciência e a Tecnologia, under the project FCOMP-01-0124-FEDER-022718 (PEst-C/SAU/LA0002/2011) and FCOMP-01-0124-FEDER-019731 (PTDC/BIABCM/118577/2010). T.A.R., I.S.A., T.F., and C.P.G. were supported by Fundação para a Ciência e a Tecnologia, Programa Operacional Potencial Humano do QREN, and Fundo Social Europeu. M.F. was supported by FWO-Vlaanderen (Onderzoeksproject G.0754.09) and KU Leuven (OT/09/045).
Footnotes
Published ahead of print 27 May 2014
REFERENCES
- 1.Brocard C, Hartig A. 2006. Peroxisome targeting signal 1: is it really a simple tripeptide? Biochim. Biophys. Acta 1763:1565–1573. 10.1016/j.bbamcr.2006.08.022 [DOI] [PubMed] [Google Scholar]
- 2.Gould SJ, Keller GA, Hosken N, Wilkinson J, Subramani S. 1989. A conserved tripeptide sorts proteins to peroxisomes. J. Cell Biol. 108:1657–1664. 10.1083/jcb.108.5.1657 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Kunze M, Neuberger G, Maurer-Stroh S, Ma J, Eck T, Braverman N, Schmid JA, Eisenhaber F, Berger J. 2011. Structural requirements for interaction of peroxisomal targeting signal 2 and its receptor PEX7. J. Biol. Chem. 286:45048–45062. 10.1074/jbc.M111.301853 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Lazarow PB. 2006. The import receptor Pex7p and the PTS2 targeting sequence. Biochim. Biophys. Acta 1763:1599–1604. 10.1016/j.bbamcr.2006.08.011 [DOI] [PubMed] [Google Scholar]
- 5.Swinkels BW, Gould SJ, Bodnar AG, Rachubinski RA, Subramani S. 1991. A novel, cleavable peroxisomal targeting signal at the amino terminus of the rat 3-ketoacyl-CoA thiolase. EMBO J. 10:3255–3262 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Helm M, Luck C, Prestele J, Hierl G, Huesgen PF, Frohlich T, Arnold GJ, Adamska I, Gorg A, Lottspeich F, Gietl C. 2007. Dual specificities of the glyoxysomal/peroxisomal processing protease Deg15 in higher plants. Proc. Natl. Acad. Sci. U. S. A. 104:11501–11506. 10.1073/pnas.0704733104 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Kurochkin IV, Mizuno Y, Konagaya A, Sakaki Y, Schonbach C, Okazaki Y. 2007. Novel peroxisomal protease Tysnd1 processes PTS1- and PTS2-containing enzymes involved in beta-oxidation of fatty acids. EMBO J. 26:835–845. 10.1038/sj.emboj.7601525 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Braverman N, Dodt G, Gould SJ, Valle D. 1998. An isoform of pex5p, the human PTS1 receptor, is required for the import of PTS2 proteins into peroxisomes. Hum. Mol. Genet. 7:1195–1205. 10.1093/hmg/7.8.1195 [DOI] [PubMed] [Google Scholar]
- 9.Galland N, Demeure F, Hannaert V, Verplaetse E, Vertommen D, Van der Smissen P, Courtoy PJ, Michels PA. 2007. Characterization of the role of the receptors PEX5 and PEX7 in the import of proteins into glycosomes of Trypanosoma brucei. Biochim. Biophys. Acta 1773:521–535. 10.1016/j.bbamcr.2007.01.006 [DOI] [PubMed] [Google Scholar]
- 10.Otera H, Okumoto K, Tateishi K, Ikoma Y, Matsuda E, Nishimura M, Tsukamoto T, Osumi T, Ohashi K, Higuchi O, Fujiki Y. 1998. Peroxisome targeting signal type 1 (PTS1) receptor is involved in import of both PTS1 and PTS2: studies with PEX5-defective CHO cell mutants. Mol. Cell. Biol. 18:388–399 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Woodward AW, Bartel B. 2005. The Arabidopsis peroxisomal targeting signal type 2 receptor PEX7 is necessary for peroxisome function and dependent on PEX5. Mol. Biol. Cell 16:573–583. 10.1091/mbc.E04-05-0422 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Freitas MO, Francisco T, Rodrigues TA, Alencastre IS, Pinto MP, Grou CP, Carvalho AF, Fransen M, Sa-Miranda C, Azevedo JE. 2011. PEX5 protein binds monomeric catalase blocking its tetramerization and releases it upon binding the N-terminal domain of PEX14. J. Biol. Chem. 286:40509–40519. 10.1074/jbc.M111.287201 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Gatto GJ, Jr, Geisbrecht BV, Gould SJ, Berg JM. 2000. A proposed model for the PEX5-peroxisomal targeting signal-1 recognition complex. Proteins 38:241–246. 10.1002/(SICI)1097-0134(20000215)38:3<241::AID-PROT1>3.0.CO;2-1 [DOI] [PubMed] [Google Scholar]
- 14.Gunkel K, van Dijk R, Veenhuis M, van der Klei IJ. 2004. Routing of Hansenula polymorpha alcohol oxidase: an alternative peroxisomal protein-sorting machinery. Mol. Biol. Cell 15:1347–1355. 10.1091/mbc.E03-04-0258 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Klein AT, van den Berg M, Bottger G, Tabak HF, Distel B. 2002. Saccharomyces cerevisiae acyl-CoA oxidase follows a novel, non-PTS1, import pathway into peroxisomes that is dependent on Pex5p. J. Biol. Chem. 277:25011–25019. 10.1074/jbc.M203254200 [DOI] [PubMed] [Google Scholar]
- 16.Oshima Y, Kamigaki A, Nakamori C, Mano S, Hayashi M, Nishimura M, Esaka M. 2008. Plant catalase is imported into peroxisomes by Pex5p but is distinct from typical PTS1 import. Plant Cell Physiol. 49:671–677. 10.1093/pcp/pcn038 [DOI] [PubMed] [Google Scholar]
- 17.Dodt G, Warren D, Becker E, Rehling P, Gould SJ. 2001. Domain mapping of human PEX5 reveals functional and structural similarities to Saccharomyces cerevisiae Pex18p and Pex21p. J. Biol. Chem. 276:41769–41781. 10.1074/jbc.M106932200 [DOI] [PubMed] [Google Scholar]
- 18.Matsumura T, Otera H, Fujiki Y. 2000. Disruption of the interaction of the longer isoform of Pex5p, Pex5pL, with Pex7p abolishes peroxisome targeting signal type 2 protein import in mammals. Study with a novel Pex5-impaired Chinese hamster ovary cell mutant. J. Biol. Chem. 275:21715–21721. 10.1074/jbc.M000721200 [DOI] [PubMed] [Google Scholar]
- 19.Schliebs W, Kunau WH. 2006. PTS2 co-receptors: diverse proteins with common features. Biochim. Biophys. Acta 1763:1605–1612. 10.1016/j.bbamcr.2006.08.051 [DOI] [PubMed] [Google Scholar]
- 20.Otzen M, Wang D, Lunenborg MG, van der Klei IJ. 2005. Hansenula polymorpha Pex20p is an oligomer that binds the peroxisomal targeting signal 2 (PTS2). J. Cell Sci. 118:3409–3418. 10.1242/jcs.02463 [DOI] [PubMed] [Google Scholar]
- 21.Purdue PE, Yang X, Lazarow PB. 1998. Pex18p and Pex21p, a novel pair of related peroxins essential for peroxisomal targeting by the PTS2 pathway. J. Cell Biol. 143:1859–1869. 10.1083/jcb.143.7.1859 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Sichting M, Schell-Steven A, Prokisch H, Erdmann R, Rottensteiner H. 2003. Pex7p and Pex20p of Neurospora crassa function together in PTS2-dependent protein import into peroxisomes. Mol. Biol. Cell 14:810–821. 10.1091/mbc.E02-08-0539 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Stein K, Schell-Steven A, Erdmann R, Rottensteiner H. 2002. Interactions of Pex7p and Pex18p/Pex21p with the peroxisomal docking machinery: implications for the first steps in PTS2 protein import. Mol. Cell. Biol. 22:6056–6069. 10.1128/MCB.22.17.6056-6069.2002 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Schafer A, Kerssen D, Veenhuis M, Kunau WH, Schliebs W. 2004. Functional similarity between the peroxisomal PTS2 receptor binding protein Pex18p and the N-terminal half of the PTS1 receptor Pex5p. Mol. Cell. Biol. 24:8895–8906. 10.1128/MCB.24.20.8895-8906.2004 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Grou CP, Carvalho AF, Pinto MP, Alencastre IS, Rodrigues TA, Freitas MO, Francisco T, Sa-Miranda C, Azevedo JE. 2009. The peroxisomal protein import machinery—a case report of transient ubiquitination with a new flavor. Cell. Mol. Life Sci. 66:254–262. 10.1007/s00018-008-8415-5 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Hasan S, Platta HW, Erdmann R. 2013. Import of proteins into the peroxisomal matrix. Front. Physiol. 4:261. 10.3389/fphys.2013.00261 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Hu J, Baker A, Bartel B, Linka N, Mullen RT, Reumann S, Zolman BK. 2012. Plant peroxisomes: biogenesis and function. Plant Cell 24:2279–2303. 10.1105/tpc.112.096586 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Liu X, Ma C, Subramani S. 2012. Recent advances in peroxisomal matrix protein import. Curr. Opin. Cell Biol. 24:484–489. 10.1016/j.ceb.2012.05.003 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Gouveia AM, Guimaraes CP, Oliveira ME, Sa-Miranda C, Azevedo JE. 2003. Insertion of Pex5p into the peroxisomal membrane is cargo protein-dependent. J. Biol. Chem. 278:4389–4392. 10.1074/jbc.C200650200 [DOI] [PubMed] [Google Scholar]
- 30.Agne B, Meindl NM, Niederhoff K, Einwachter H, Rehling P, Sickmann A, Meyer HE, Girzalsky W, Kunau WH. 2003. Pex8p: an intraperoxisomal organizer of the peroxisomal import machinery. Mol. Cell 11:635–646. 10.1016/S1097-2765(03)00062-5 [DOI] [PubMed] [Google Scholar]
- 31.Oeljeklaus S, Reinartz BS, Wolf J, Wiese S, Tonillo J, Podwojski K, Kuhlmann K, Stephan C, Meyer HE, Schliebs W, Brocard C, Erdmann R, Warscheid B. 2012. Identification of core components and transient interactors of the peroxisomal importomer by dual-track stable isotope labeling with amino acids in cell culture analysis. J. Proteome Res. 11:2567–2580. 10.1021/pr3000333 [DOI] [PubMed] [Google Scholar]
- 32.Reguenga C, Oliveira ME, Gouveia AM, Sa-Miranda C, Azevedo JE. 2001. Characterization of the mammalian peroxisomal import machinery: Pex2p, Pex5p, Pex12p, and Pex14p are subunits of the same protein assembly. J. Biol. Chem. 276:29935–29942. 10.1074/jbc.M104114200 [DOI] [PubMed] [Google Scholar]
- 33.Gouveia AM, Reguenga C, Oliveira ME, Sa-Miranda C, Azevedo JE. 2000. Characterization of peroxisomal Pex5p from rat liver. Pex5p in the Pex5p-Pex14p membrane complex is a transmembrane protein. J. Biol. Chem. 275:32444–32451 [DOI] [PubMed] [Google Scholar]
- 34.Gouveia AM, Guimaraes CP, Oliveira ME, Reguenga C, Sa-Miranda C, Azevedo JE. 2003. Characterization of the peroxisomal cycling receptor, Pex5p, using a cell-free in vitro import system. J. Biol. Chem. 278:226–232. 10.1074/jbc.M209498200 [DOI] [PubMed] [Google Scholar]
- 35.Alencastre IS, Rodrigues TA, Grou CP, Fransen M, Sa-Miranda C, Azevedo JE. 2009. Mapping the cargo protein membrane translocation step into the PEX5 cycling pathway. J. Biol. Chem. 284:27243–27251. 10.1074/jbc.M109.032565 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Francisco T, Rodrigues TA, Freitas MO, Grou CP, Carvalho AF, Sa-Miranda C, Pinto MP, Azevedo JE. 2013. A cargo-centered perspective on the PEX5 receptor-mediated peroxisomal protein import pathway. J. Biol. Chem. 288:29151–29159. 10.1074/jbc.M113.487140 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Oliveira ME, Gouveia AM, Pinto RA, Sa-Miranda C, Azevedo JE. 2003. The energetics of Pex5p-mediated peroxisomal protein import. J. Biol. Chem. 278:39483–39488. 10.1074/jbc.M305089200 [DOI] [PubMed] [Google Scholar]
- 38.Carvalho AF, Pinto MP, Grou CP, Alencastre IS, Fransen M, Sa-Miranda C, Azevedo JE. 2007. Ubiquitination of mammalian Pex5p, the peroxisomal import receptor. J. Biol. Chem. 282:31267–31272. 10.1074/jbc.M706325200 [DOI] [PubMed] [Google Scholar]
- 39.Williams C, van den Berg M, Sprenger RR, Distel B. 2007. A conserved cysteine is essential for Pex4p-dependent ubiquitination of the peroxisomal import receptor Pex5p. J. Biol. Chem. 282:22534–22543. 10.1074/jbc.M702038200 [DOI] [PubMed] [Google Scholar]
- 40.Miyata N, Fujiki Y. 2005. Shuttling mechanism of peroxisome targeting signal type 1 receptor Pex5: ATP-independent import and ATP-dependent export. Mol. Cell. Biol. 25:10822–10832. 10.1128/MCB.25.24.10822-10832.2005 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Platta HW, El Magraoui F, Schlee D, Grunau S, Girzalsky W, Erdmann R. 2007. Ubiquitination of the peroxisomal import receptor Pex5p is required for its recycling. J. Cell Biol. 177:197–204. 10.1083/jcb.200611012 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Platta HW, Grunau S, Rosenkranz K, Girzalsky W, Erdmann R. 2005. Functional role of the AAA peroxins in dislocation of the cycling PTS1 receptor back to the cytosol. Nat. Cell Biol. 7:817–822. 10.1038/ncb1281 [DOI] [PubMed] [Google Scholar]
- 43.Debelyy MO, Platta HW, Saffian D, Hensel A, Thoms S, Meyer HE, Warscheid B, Girzalsky W, Erdmann R. 2011. Ubp15p, a ubiquitin hydrolase associated with the peroxisomal export machinery. J. Biol. Chem. 286:28223–28234. 10.1074/jbc.M111.238600 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Grou CP, Carvalho AF, Pinto MP, Huybrechts SJ, Sa-Miranda C, Fransen M, Azevedo JE. 2009. Properties of the ubiquitin-pex5p thiol ester conjugate. J. Biol. Chem. 284:10504–10513. 10.1074/jbc.M808978200 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Grou CP, Francisco T, Rodrigues TA, Freitas MO, Pinto MP, Carvalho AF, Domingues P, Wood SA, Rodriguez-Borges JE, Sa-Miranda C, Fransen M, Azevedo JE. 2012. Identification of ubiquitin-specific protease 9× (USP9X) as a deubiquitinase acting on ubiquitin-peroxin 5 (PEX5) thioester conjugate. J. Biol. Chem. 287:12815–12827. 10.1074/jbc.M112.340158 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Miyata N, Hosoi K, Mukai S, Fujiki Y. 2009. In vitro import of peroxisome-targeting signal type 2 (PTS2) receptor Pex7p into peroxisomes. Biochim. Biophys. Acta 1793:860–870. 10.1016/j.bbamcr.2009.02.007 [DOI] [PubMed] [Google Scholar]
- 47.Grunau S, Schliebs W, Linnepe R, Neufeld C, Cizmowski C, Reinartz B, Meyer HE, Warscheid B, Girzalsky W, Erdmann R. 2009. Peroxisomal targeting of PTS2 preimport complexes in the yeast Saccharomyces cerevisiae. Traffic 10:451–460. 10.1111/j.1600-0854.2008.00876.x [DOI] [PubMed] [Google Scholar]
- 48.Leon S, Zhang L, McDonald WH, Yates J, III, Cregg JM, Subramani S. 2006. Dynamics of the peroxisomal import cycle of PpPex20p: ubiquitin-dependent localization and regulation. J. Cell Biol. 172:67–78. 10.1083/jcb.200508096 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Nair DM, Purdue PE, Lazarow PB. 2004. Pex7p translocates in and out of peroxisomes in Saccharomyces cerevisiae. J. Cell Biol. 167:599–604. 10.1083/jcb.200407119 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Liu X, Subramani S. 2013. Unique requirements for mono- and polyubiquitination of the peroxisomal targeting signal co-receptor, Pex20. J. Biol. Chem. 288:7230–7240. 10.1074/jbc.M112.424911 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Bout A, Teunissen Y, Hashimoto T, Benne R, Tager JM. 1988. Nucleotide sequence of human peroxisomal 3-oxoacyl-CoA thiolase. Nucleic Acids Res. 16:10369. 10.1093/nar/16.21.10369 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Dammai V, Subramani S. 2001. The human peroxisomal targeting signal receptor, Pex5p, is translocated into the peroxisomal matrix and recycled to the cytosol. Cell 105:187–196. 10.1016/S0092-8674(01)00310-5 [DOI] [PubMed] [Google Scholar]
- 53.Grou CP, Carvalho AF, Pinto MP, Wiese S, Piechura H, Meyer HE, Warscheid B, Sa-Miranda C, Azevedo JE. 2008. Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor. J. Biol. Chem. 283:14190–14197. 10.1074/jbc.M800402200 [DOI] [PubMed] [Google Scholar]
- 54.Croes K, Foulon V, Casteels M, Van Veldhoven PP, Mannaerts GP. 2000. Phytanoyl-CoA hydroxylase: recognition of 3-methyl-branched acyl-CoAs and requirement for GTP or ATP and Mg(2+) in addition to its known hydroxylation cofactors. J. Lipid Res. 41:629–636 [PubMed] [Google Scholar]
- 55.Costa-Rodrigues J, Carvalho AF, Fransen M, Hambruch E, Schliebs W, Sa-Miranda C, Azevedo JE. 2005. Pex5p, the peroxisomal cycling receptor, is a monomeric non-globular protein. J. Biol. Chem. 280:24404–24411. 10.1074/jbc.M501985200 [DOI] [PubMed] [Google Scholar]
- 56.Carvalho AF, Grou CP, Pinto MP, Alencastre IS, Costa-Rodrigues J, Fransen M, Sa-Miranda C, Azevedo JE. 2007. Functional characterization of two missense mutations in Pex5p-C11S and N526K. Biochim. Biophys. Acta 1773:1141–1148. 10.1016/j.bbamcr.2007.04.011 [DOI] [PubMed] [Google Scholar]
- 57.Carvalho AF, Costa-Rodrigues J, Correia I, Costa Pessoa J, Faria TQ, Martins CL, Fransen M, Sa-Miranda C, Azevedo JE. 2006. The N-terminal half of the peroxisomal cycling receptor Pex5p is a natively unfolded domain. J. Mol. Biol. 356:864–875. 10.1016/j.jmb.2005.12.002 [DOI] [PubMed] [Google Scholar]
- 58.Pinto MP, Grou CP, Alencastre IS, Oliveira ME, Sa-Miranda C, Fransen M, Azevedo JE. 2006. The import competence of a peroxisomal membrane protein is determined by Pex19p before the docking step. J. Biol. Chem. 281:34492–34502. 10.1074/jbc.M607183200 [DOI] [PubMed] [Google Scholar]
- 59.Fransen M, Wylin T, Brees C, Mannaerts GP, Van Veldhoven PP. 2001. Human pex19p binds peroxisomal integral membrane proteins at regions distinct from their sorting sequences. Mol. Cell. Biol. 21:4413–4424. 10.1128/MCB.21.13.4413-4424.2001 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Dodt G, Braverman N, Wong C, Moser A, Moser HW, Watkins P, Valle D, Gould SJ. 1995. Mutations in the PTS1 receptor gene, PXR1, define complementation group 2 of the peroxisome biogenesis disorders. Nat. Genet. 9:115–125. 10.1038/ng0295-115 [DOI] [PubMed] [Google Scholar]
- 61.Otera H, Setoguchi K, Hamasaki M, Kumashiro T, Shimizu N, Fujiki Y. 2002. Peroxisomal targeting signal receptor Pex5p interacts with cargoes and import machinery components in a spatiotemporally differentiated manner: conserved Pex5p WXXXF/Y motifs are critical for matrix protein import. Mol. Cell. Biol. 22:1639–1655. 10.1128/MCB.22.6.1639-1655.2002 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Brites P, Motley AM, Gressens P, Mooyer PA, Ploegaert I, Everts V, Evrard P, Carmeliet P, Dewerchin M, Schoonjans L, Duran M, Waterham HR, Wanders RJ, Baes M. 2003. Impaired neuronal migration and endochondral ossification in Pex7 knockout mice: a model for rhizomelic chondrodysplasia punctata. Hum. Mol. Genet. 12:2255–2267. 10.1093/hmg/ddg236 [DOI] [PubMed] [Google Scholar]
- 63.Motley AM, Brites P, Gerez L, Hogenhout E, Haasjes J, Benne R, Tabak HF, Wanders RJ, Waterham HR. 2002. Mutational spectrum in the PEX7 gene and functional analysis of mutant alleles in 78 patients with rhizomelic chondrodysplasia punctata type 1. Am. J. Hum. Genet. 70:612–624. 10.1086/338998 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Costa-Rodrigues J, Carvalho AF, Gouveia AM, Fransen M, Sa-Miranda C, Azevedo JE. 2004. The N terminus of the peroxisomal cycling receptor, Pex5p, is required for redirecting the peroxisome-associated peroxin back to the cytosol. J. Biol. Chem. 279:46573–46579. 10.1074/jbc.M406399200 [DOI] [PubMed] [Google Scholar]
- 65.Haas AL, Warms JV, Rose IA. 1983. Ubiquitin adenylate: structure and role in ubiquitin activation. Biochemistry 22:4388–4394. 10.1021/bi00288a007 [DOI] [PubMed] [Google Scholar]
- 66.Hwang ST, Schatz G. 1989. Translocation of proteins across the mitochondrial inner membrane, but not into the outer membrane, requires nucleoside triphosphates in the matrix. Proc. Natl. Acad. Sci. U. S. A. 86:8432–8436. 10.1073/pnas.86.21.8432 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Schliebs W, Saidowsky J, Agianian B, Dodt G, Herberg FW, Kunau WH. 1999. Recombinant human peroxisomal targeting signal receptor PEX5. Structural basis for interaction of PEX5 with PEX14. J. Biol. Chem. 274:5666–5673 [DOI] [PubMed] [Google Scholar]
- 68.Leon S, Goodman JM, Subramani S. 2006. Uniqueness of the mechanism of protein import into the peroxisome matrix: transport of folded, co-factor-bound and oligomeric proteins by shuttling receptors. Biochim. Biophys. Acta 1763:1552–1564. 10.1016/j.bbamcr.2006.08.037 [DOI] [PubMed] [Google Scholar]
- 69.De Duve C, Baudhuin P. 1966. Peroxisomes (microbodies and related particles). Physiol. Rev. 46:323–357 [DOI] [PubMed] [Google Scholar]
- 70.Fahimi HD. 1969. Cytochemical localization of peroxidatic activity of catalase in rat hepatic microbodies (peroxisomes). J. Cell Biol. 43:275–288. 10.1083/jcb.43.2.275 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71.Gould SJ, Kalish JE, Morrell JC, Bjorkman J, Urquhart AJ, Crane DI. 1996. Pex13p is an SH3 protein of the peroxisome membrane and a docking factor for the predominantly cytoplasmic PTs1 receptor. J. Cell Biol. 135:85–95. 10.1083/jcb.135.1.85 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Hensel A, Beck S, El Magraoui F, Platta HW, Girzalsky W, Erdmann R. 2011. Cysteine-dependent ubiquitination of Pex18p is linked to cargo translocation across the peroxisomal membrane. J. Biol. Chem. 286:43495–43505. 10.1074/jbc.M111.286104 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Schliebs W, Girzalsky W, Erdmann R. 2010. Peroxisomal protein import and ERAD: variations on a common theme. Nat. Rev. Mol. Cell Biol. 11:885–890. 10.1038/nrm3008 [DOI] [PubMed] [Google Scholar]
- 74.Fujiki Y, Matsuzono Y, Matsuzaki T, Fransen M. 2006. Import of peroxisomal membrane proteins: the interplay of Pex3p- and Pex19p-mediated interactions. Biochim. Biophys. Acta 1763:1639–1646. 10.1016/j.bbamcr.2006.09.030 [DOI] [PubMed] [Google Scholar]







