Mechanisms and Modifications of Naturally Occurring Host Defense Peptides for Anti-HIV Microbicide Development

Abstract

Despite advances in the treatment of HIV infection, heterosexual transmission of HIV remains high, and vaccines to prevent HIV acquisition have been unfruitful. Vaginal microbicides, on the other hand, have demonstrated considerable potential for HIV prevention, and a variety of compounds have been screened for their activity and safety as anti-HIV microbicides. Among these are the naturally occurring host defense peptides, small peptides from diverse lineages with intrinsic antiviral activity.

Naturally occurring host defense peptides with anti-HIV activity are promising candidates for vaginal microbicide development. Their structural variance and accompanying mechanistic diversity provide a wide range of inhibitors whose antiviral activity can be exerted at nearly every stage of the HIV lifecycle. Additionally, peptide modification has been explored as a method for improving the anti-HIV activity of host defense peptides. Structure- and sequence-based alterations have achieved varying success in improving the potency and specificity of anti-HIV peptides. Overall, peptides have been discovered or engineered to inhibit HIV with therapeutic indices of >1000, encouraging their advancement toward clinical trials.

Here we review the naturally occurring anti-HIV host defense peptides, demonstrating their breadth of mechanistic diversity, and exploring approaches to enhance and optimize their activity in order to expedite their development as safe and effective anti-HIV vaginal microbicides.

Introduction

The global rate of HIV transmission remains at over two million people annually [1]. Of those infected, a rapidly growing number acquire HIV through male to female intercourse [1]. This is especially a problem in Sub-Saharan Africa and other regions where there is a high incidence of non-consensual intercourse. Here, where females remain at a greater risk, new and affordable methods for preventing vaginal HIV transmission are badly needed. HIV prophylaxis has been attempted by the use of recombinant vaccines and various formulations of microbicides. Despite nearly three decades of such research, no effective vaccine has emerged. For these reasons, improved microbicides are being pursued as a solution that could significantly reduce HIV transmission and ultimately reduce the number of AIDS-associated deaths.

Early attempts at the development of a topical HIV microbicide generally consisted of two major strategies. The first of these approaches was acidic formulations, designed to lower the pH of the vaginal milieu and thereby directly inactivate HIV; the second strategy employed a variety of surfactants, which acted by disrupting the lipid membranes of enveloped viruses such as HIV. While such strategies were shown to be effective in preventing HIV infection in a variety of in vitro studies, these treatments were often neutralized or degraded by the dynamic vaginal environment. In some cases, these treatments proved to be unsafe or even increased the risk of infection due to damage of the vaginal epithelia [2,3].

A safer alternative vaginal microbicide came later in the form of sulfated polyanionic or polysaccharide compounds, which were able to coat mucosal surfaces and protect target cells from infection [4,5]. Two of the more hopeful formulations from this category included Carraguard, a carrageenan based microbicide, and PRO2000, a sulfonated polyanionic compound shown to bind and coat both viral and host proteins. While preclinical data appeared promising, effective in vivo protection could not be achieved in phase III clinical trials [5,6]. With the disappointment of previous attempts at microbicide development, it has become evident that microbicides should work through safe, specific, and potent mechanism-based approaches, rather than the previously attempted non-specific compounds, so as to provide directed protection against viral infection while minimally affecting the contacted tissue.

This directed strategy for microbicide development has begun to yield promising results by implementing microbicide formulations containing the nucleoside analog reverse transcriptase inhibitor, tenofovir [7,8]. The first of these studies was CAPRISA 004, where a tenofovir-containing gel was found to reduce HIV transmission in South African women by as much as 54%, thus demonstrating that a topical microbicide could succeed in significantly preventing HIV infection. Despite these promising results, success is dependent on viral susceptibility to tenofovir and, with the discovery of naturally occurring drug-resistance mutations in chronically infected patients, new microbicides will be required to remain effective against the variety of HIV strains circulating among infected individuals [9].

Though still in early stages of development, naturally occurring anti-HIV peptides are surfacing as potent yet broad-spectrum biomolecules for topical microbicides. These peptides are generally under 50 amino acids, and may inhibit a variety of bacteria, fungi, and viruses. A major advantage of using naturally occurring peptides is the extensive variety of peptides that can be found. Naturally occurring host defense peptides exist across all major lineages and represent one of the most ancient and conserved forms of immunity. Among the hundreds of host defense peptides that have been isolated and characterized, many have demonstrated varying degrees of anti-HIV activity in cell culture and biochemical assays [10]. These peptides vary in size and structure, but can be categorized into three major structural classes; the α-helices, the β-sheets and hairpins, and the closed cyclic peptides. (Table 1)

Table 1. Natural peptides and their analogues inhibit HIV.

	Native Peptide	Origin or Analogue	Sequence	IC50 μM	CC50 μM	Therapeutic Index	Mechanism of HIV Inhibition	Ref.
α-helix	cecropin A	Hyalophora cecropia	KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAL-NH2	2.0-3.0	2.0-4.0	1.2		[69]
	mellitin	Apis mellifera	GIGAVLKVLTTGLPALISWIKRKRQQ-NH2	0.90	0.94	1.0	Suppress viral gene expression	[69]
	LL-37	Homo sapiens	[LL-37, 37 aa]	20	>45	>2.3	Inhibit Reverse Transcriptase and Protease	[70, 71], A
		LL37	[LL-37, 37 aa]	15	>130	>8.3		B
		LL13-37	IGKEFKRIVQRIKDFLRNLVPRTES	7.0	>130	>18		B
		LL17-32	FKRIVQRIKDFLRNLV	70	>130	>1.8		B
		LL-37	[LL-37, 37 aa]	1.6	18	12		[72]
		GI-20	GIKEFKRIVQRIKDFLRNLV	1.1	23	21		[72]
		GI-20Q16	GIKQFKRIVQRIKDFLRNLV	0.91	14	15		[72]
	dermaseptin S4		ALWMTLLKKVLKAAAKAALNAVLVGANA	2.0	4.5	2.3	Disrupts Virion Integrity, Attachment, Transcytosis, Dendritic-to-T-Cell transfer	[73], C, D
		dermaseptin S4a	ALWMTLLKKVLKAAAKAALNAVLVGANA-NH2	2.0	5.6	2.8		C
		dermaseptin K4-S4a	ALWKTLLKKVLKAAAKAALNAVLVGANA-NH2	1.4	17	12		C
		dermaseptin S4(1-16)a	ALWMTLLKKVLKAAAK-NH2	>19	19	<1		C
		dermaseptin K4-S4-(1-16)a	ALWKTLLKKVLKAAAK-NH2	28	>100	>3.6		C
	maximin 3	Bombina maxima	GIGGKILSGLKTALKGAAKELASTYLH	0.56	4.2	7.6		[74]
	lysozyme	Homo sapiens	148 aa. 14.7kDA	0.064				E
		HL18	RVVRDPQGIRAWVAWRNR (98-115)	0.062				E
		HL9	RAWVAWRNR (107-115)	0.055				E
	caerin 1.9	Litoria chloris	GLFGVLGSIAKHVLPHVVPVIAEKL-NH2	1.2	20-25	19	Virucidal	F
	caerin 1.1	Litoria caerulea	GLLSVLGSVAKHVLPHVVPVIAEHL-NH2	7.8	>30	>3.8	Virucidal	F, G
	maculatin 1.1	Litoria genimaculata	GLFGVLAKVAAHVVPAIAEHF-NH2	11				F, G
	ponericin L2	Pachycondyla goeldii	LLKELWTKIKGAGKAVLGKIKGLL-NH2	1.4	25	18		H, I
	spinigerin	Pseudacanthot ermes spiniger	HVDKKVADKVLLLKQLRIMRLLTRL	3.1	>33	>11		I, [75]
β-sheet	gpnp	Cavia porcellus	RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC	7.9	>130	>16		[76, 77]
	rbnp-1	Oryctolagus cuniculus	VVCACRRALCLPRERRAGFCRIRGRIHPLCCRR	9.7	>130	>13		[76, 78-80]
	ratnp-4	Rattus norvegicus	VTCYCRRTRCGFRERLSGACGYRGRIYRLCCR	7.4	>130	>18		[76, 81]
	hnp1	Homo sapiens	ACYCRIPACIAGERRYGTCIYQGRLWAFCC	5-20	>8.7	>.70	Inhibit HIV gene exp., Upregulate CC-Chemokines, Inhibit fusion	[82, 83], J
	hnp2	Homo sapiens	CYCRIPACIAGERRYGTCIYQGRLWAFCC	5-20			Upregulate CC-Chemokines, Inhibit Fusion	[83, 84], J
	hnp3	Homo sapiens	DCYCRIPACIAGERRYGTCIYQGRLWAFCC	5-20				J
	hnp4	Homo sapiens	VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTR	2-5				J
	hbd2	Homo sapiens	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP	2.1-9.2	>9.2	>1.6	Inactivate virions, downregulate CXCR4	K
	hbd3	Homo sapiens	GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK	1.7-7.8	>7.8	>1.6		[85], K
β-turn/hairpin	protegrin 1	Sus scrofa	RGGRLCYCRRRFCVCVGR-NH2 (6-15, 8-13)	0.46-10.9	4.6-81	7.5		A, L, M, N
		PG-1(OH) Type I	RGGRLCYCRRRFCVCVGR-OH (6-8, 13-15)	1.1	7.8	7.3		M
		PG-1(OH) Type II	RGGRLCYCRRRFCVCVGR-OH (6-13, 8-15)	1.1	8.9	8.0		M
		PG-1(OH) Type III	RGGRLCYCRRRFCVCVGR-OH (6-15, 8-13)	1.4	6.8	4.7		M
		4-Cys(ACM)-PG-I-(OH)	RGGRLCYCRRRFCVCVGR-OH (LINEAR)	1.6	180	120		M
		cPG2	RGGRLCYCRRRFCVCVGR (CYCLIC)	12.8	140	11		N
		ccPG3	RGGCLCYCRRRFCVCVCR (CYCLIC, 3 bonds)	12.2	800	65		N
	griffithsin	Griffithsia sp.	121 aa. 12.7kDa	3.6E-6-6.3E-6	>0.78	>2400	Binds glycosylated gp120	O
		grifonin-1	Cha-SC-Chg-R-Chg-RSGSY-Cha-DN-Chg-R-Chg-c-NH2	0.19-0.55	>20	>54		P
	polyphemusin II	Limulus polyphemus	RRWCFRVCYKGFCYRKCR-NH2	0.42	11	25	Binds CXCR4	Q
		T22	RRWCYRKCYKGYCYRKCR-NH2	0.080	13	170		Q
		T140	RR-2Nal-CYRKk-PYR-Cit-CR	0.0035	45	13000		Q
	tachyplesin I	Tachypleus tridentatus	KWCFRVCYRGICYRRCR-NH2	>20	8.4	<.42	Binds CXCR4	Q
	VIRIP	Homo sapiens	LEAIPMSIPPEVKFNKPFVF	15	>1000	>68	Binds Env - gp41	R
	(-L)VIRIP		EAIPMSIPPEVKFNKPFVF	>1000	>1000			R
	VIR-175		LEAIPMSIPPEFLFGKPFVF	1.3	>1000	>750		R
	VIR-353		LEAIPCSIPpCFLFNKPFVF	0.20	>1000	>5000		R
	alpha-MSH	Homo sapiens	SYSMEHFRWGKPV	10			NF-kB Inhibitor	[86, 87], S
		KPV	KPV	10				S
cyclic	retrocyclin I		RCICGRGICRCICGRGIC	3.7	>52	>14	Fusion inhibitor -lectin	T, U
		RC-101	RCICGRGICRCICGKGIC	0.03-4.5	>260	>120		T
	retrocyclin II		RCICGRRICRCICGRGIC	0.52-1.6	>15	>14		[88]
	rtd1	Macaca mulatta	GFCRCLCRRGVCRCICTR	0.45-1.9	>48	>41		[88-91]
	rtd2	Macaca mulatta	GVCRCLCRRGVCRCICRR	0.83-3.2				[88, 90]
	rtd3	Macaca mulatta	GFCRCICTRGFCRCICTR	0.84-2.1				[88, 90]
	circulin a	Chassalia parvifolia	NKVCYRNGIPCGESCVWIPCISAALGCSCK	0.04-0.26	0.50	3.3		V, [92]
	circulin b	Chassalia parvifolia	NKVCYRNGVIPCGESCVFIPCISTLLGCSCK	0.04-0.26	0.50	3.3		V, [92]
	kalata b1	Oldenlandia affinis	WPVCTRNGLPVCGETCVGGTCNTPGCTCS	0.66	12	18		W, [92]
	cycloviolacin Y1	Viola yedoenis	GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN	1.2	>40	33		W
	cycloviolacin Y4	Viola yedoenis	GVPCGESCVFIPCITGVIGCSCSSNVCYLN	0.12	9.3	78		W
	cycloviolacin Y5	Viola yedoenis	GIPCAESCVWIPCTVTALVGCSCSDKVCYN	0.04	8.7	220		W
	siamycin I	Streptomyces sp.	CLGVGSCNDFAGCGYAIVCFW	0.05-5.7	93-150	42.2	Fusion inhibitor	[93-95]
Other	indolicidin	Bos taurus	LPWKWPWWPWRR-NH2	47	18.4	0.4	Virucidal, Integrase Inhibition	X
	gramicidin d	Bacillus brevis	VGAlAvVvWlWlWlW-ETA	8.2E-6	8.2E-3	1000		[96, 97], Y

A comprehensive compilation of natural peptides that inhibit HIV is shown, along with their structural motif, source, derived analogues, and sequence. For larger proteins whose activity is attributed to a smaller peptide domain, the parent protein and its derivatives are assigned according to the active domain structure. Structural classification is nonexclusive, as some cyclic peptides (e.g. retrocyclins and RTDs) contain β-turn motifs, and β-turns can also be considered β-sheets. Some peptides (e.g. VIRIP) were classified based on structural evidence rather than absolute classification. D-isomer amino acids are shown in lowercase, and non-canonical residues are abbreviated as:

Cha = (L)-Cyclohexylalanine

Chg = (L)-Cyclohexylglycine

Cit = (L)-Citrulline

2Nal = 3-(2-naphthyl)alanine

ETA = ethanolamine

Notable peptide modifications are bolded. For protegrin analogues, bond arrangements are indicated in parentheses. When available, mechanism of inhibition, IC₅₀ and CC₅₀ and therapeutic index are also included. All numbers were rounded to 2 significant figures. For IC₅₀ or CC₅₀ concentrations that were reported as a range, the mid-range value was used for calculating the therapeutic index.

Reference Key: A - Ref [38], B - Ref [37], C - Ref [16], D - Ref [19], E - Ref [18], F - Ref [15], G - Ref 17, H - Ref [14], I - Ref. [40], J - Ref [24], K - Ref. [28], L - Ref. [56], M - Ref. [57], N - Ref. [58], O - Ref. [26], P - Ref. [22], Q - Ref. [45], R - Ref. [30], S - Ref. [43], T - Ref. [29], U - Ref. [23], V - Ref. [13], W - Ref [11], X - Ref. [39], Y - Ref. [12].

Short α-helices make up a large group of peptides, including amphibian dermaseptins, maximins and caerins; mammalian cathelicidins; and insect peptides, such as mellitin. A large family of peptides, collectively known as α-and β-defensins, represents many of the anti-HIV peptides containing β-turns, while the hairpin category is comprised of relatively smaller peptides such as protegrin and polyphemusin. The cyclic structure is less commonly observed and is represented mainly by plant-derived peptides such as the circulins and cycloviolacins, as well as some bacterial peptides such as the antibiotic gramicidin S [11-13]. Another small family of cyclic peptides, the θ-defensins, has been discovered in some non-human primates. However, while characteristics such as charge and structure have been shown to be common across the majority these peptides, structure is not always indicative of how these peptides are able to prevent infections. Anti-HIV activity can be executed by many different specific mechanisms.

The prospect of naturally occurring antiviral peptides as potent anti-HIV compounds has attracted a great deal of research and continues to deliver promising results. Here, we will review the correlation between structure, mechanism, and activity of naturally occurring anti-HIV peptides. Further, we will discuss strategies for the modification of the many characterized anti-HIV peptides and how these approaches enhance their potential for clinical development.

Anti-HIV Mechanisms of Naturally Occurring Peptides

Naturally occurring antiviral peptides have been shown to exert their activity at nearly every stage of the HIV lifecycle. Despite similarities in structure and properties, naturally occurring antiviral peptides have diverse mechanisms targeting specific stages in of HIV infection (Fig. 1). The variety of unique anti-HIV properties displayed by these peptides offers great potential for modification and development into mechanism-based, HIV microbicides.

Fig. (1).

Mechanisms of anti-HIV peptides. Antiviral activity is exerted by representative peptides at the five major stages prior to infection. These stages are: direct inactivation of cell-free virions, attachment of virions to host cells at CD4 and CXCR4/CCR5, fusion of the viral envelope with the host cell membrane (shown here within the endosome), reverse transcription of viral RNA into DNA provirus, and integration of the provirus into the host genome.

A great majority of naturally occurring anti-HIV peptides prevent the initial steps of viral entry into host cells present at the sites of infection. The ability to inhibit HIV at an early stage makes these peptides desirable for development into microbicides. Peptides that inhibit HIV through direct inactivation are often α-helical, and are isolated from arthropod venom or amphibian skin [14-16]. The lytic activity of these peptides against enveloped viruses has been reported as a mechanism for the amphibian-derived caerins and dermaseptins, as well as the active fragment of human lysozyme [17-19]. Here, inhibition of HIV is often attributed to peptide-lipid interactions involving oligomerization of lytic peptides in bilayers and subsequent disruption of membrane integrity [20,21]. Interestingly, peptide-mediated membrane disruption has been shown in biophysical studies to occur through interactions between negatively charged bacterial lipids and cationic host defense peptides [20]. However, when used at concentrations meant to disrupt the host-derived lipids of enveloped viruses, these peptides will disrupt the mammalian cell membranes as well. It is likely for this reason that peptides whose anti-HIV activity remains solely dependent on lipid-peptide interactions, such as honeybee mellitin and various amphibian peptides, possess a low therapeutic index and exhibit a relatively high degree of cytotoxicity (Fig. 2). The observation that many peptides that directly inactivate HIV also maintain a relatively high degree of cytotoxicity suggests that secondary mechanisms, in addition to HIV envelope penetration/disruption, may be necessary for microbicide development. It is therefore understandable that several more HIV-specific mechanisms, in addition to membrane disruption, have also been observed for many anti-HIV peptides, in particular those that directly interfere with the HIV entry process.

Fig. (2).

Therapeutic indices of naturally occurring anti-HIV peptides and their analogues. Anti-HIV peptides with available therapeutic indices are plotted as IC₅₀ against CC₅₀. For IC₅₀ or CC₅₀ concentrations that were reported as a range, the mid-range value was plotted. For peptides whose CC₅₀ was not reached experimentally, the highest concentration shown to be nontoxic was used as a CC₅₀ and the plotted symbol is appended with an upward arrow indicating that its CC₅₀ could be higher than the plotted value. Native peptides are closed symbols, and modified analogues are open symbols. Therapeutic index thresholds are indicated as lines at each 10-fold increment.

HIV entry occurs through a well-characterized, yet complex multi-step mechanism. The surface envelope protein, gp120, first engages the host cells by binding to the CD4 receptor present on monocytes, macrophages, dendritic cells, and the CD4+ T-cells. This initial binding brings gp120 into close proximity with one of two major co-receptors recognized by HIV: the chemokine receptors CCR5 and CXCR4. After binding to a co-receptor the viral envelope undergoes a conformational change exposing the fusion protein gp41, which then inserts its N-terminus into the host membrane. At this stage, which has been shown to occur at either the plasma membrane or within endosomes, gp41 mediates the fusion of the host and viral membranes allowing the release of the viral capsid into the host cytosol. This multistep process provides critical points at which infection can be blocked by several anti-HIV peptides.

Peptides shown to bind viral gp120, such as θ-defensins and the Griffithsia-derived grifonin-1, prevent the virus's initial engagement of the host cell [22-24]. This activity may be related to the lectin properties of these molecules combined with the prominent glycosylation of gp120. Lectin activity of naturally occurring antiviral peptides is particularly promising considering the success of several large protein lectins in reducing HIV transmission in organotypic models [25,26]. Another advantage of peptides with lectin activity is that while mutations in envelope proteins may provide resistance to many drugs targeting gp120, molecules with the ability to bind glycosylated proteins should retain their broad-spectrum activity.

HIV co-receptors CXCR4 and CCR5 may also act as targets for antiviral peptides, including horseshoe crab tachyplesins and polyphemusin II and human β-defensins 2 and 3 [27,28]. Polyphemusin II directly binds CXCR4, thus preventing the interaction of HIV gp120 with its host cell target. Beta-defensins 2 and 3 employ a similar mechanism, as they both bind the co-receptor CXCR4, preventing initial HIV engagement of host cells. Additionally, they induce CXCR4 internalization, thus reducing the levels of this co-receptor present on the cell surface.

The final stage of HIV entry is the gp41-mediated fusion of the viral envelope with the host membrane at either the cell surface or within endosomal compartments. An important advantage of a peptide that targets fusion, rather than earlier stages in entry, is that viral tropism and the highly variable gp120 sequence rarely affect anti-HIV activity of such peptides. This is supported by reports that peptides targeting fusion have been shown to be active against a more diverse group of primary HIV isolates of varying subtypes and tropisms [29,30]. HIV fusion is the primary target of the mammalian θ-defensins, in particular the human pseudogene product retrocyclin [31,32]. Theta-defensins likely bind to the C-terminal α-helix of gp41, thereby preventing formation of the 6-helix bundle structure that mediates membrane fusion [32,33]. Research on θ-defensins as fusion inhibitors has focused primarily on retrocyclin and its synthetic analogs. Retrocyclins have been shown to not only be active against a diverse range of subtypes from clinical isolates, but they also have been shown to overcome drug resistance mutations in gp41 through only a two-fold increase in peptide concentration [29,31]. In addition to their anti-HIV activity, retrocyclins are not cytotoxic at relatively high concentrations and do not elicit a host response while remaining active in both organotypic tissue and non-human primate models [34,35]. Another naturally occurring peptide shown to inhibit HIV fusion is a 20-residue cleavage product of human α1-antitrypsin known as VIRus Inhibitory Peptide (VIRIP). This peptide possesses a very specific mechanism whereby it forms a complex with a conserved domain of gp41, thus preventing the initial insertion of gp41 into the host membrane [30]. Where other peptide fusion inhibitors act by binding the N and C terminal heptad repeats of gp41, VIRIP is unique in that it binds to the hydrophobic “fusion peptide” region.

In addition to exhibiting extracellular activity, antiviral mechanisms of some peptides extend to target the early stages of intracellular HIV infection. Such peptides may still serve as effective microbicides if they can prevent successful integration of HIV into the host's genomic DNA. Indolicidin, a peptide of bovine origin, has been shown to prevent infection by specifically inhibiting integration of reverse-transcribed viral DNA into the host genome [36]. Components of the human cathelicidin peptide, LL-37, have also been shown to carry out their activity through inhibition of reverse transcriptase and the viral protease [37]. While mechanisms have been identified for both of these peptides using solely biochemical assays, it is important to note that they also possess anti-HIV activity in infected cell culture experiments [38,39].

While many of these peptides remain in experimental stages, the mechanisms that they employ can all prevent the initial infection that would otherwise lead to acquisition of HIV. Obtaining a mechanistic understanding of these peptides can be useful to develop modifications leading to greater anti-HIV activity, decreased cytotoxicity, and improvement of expression/synthesis. Such modifications will likely be critical for development of naturally occurring peptides as microbicides.

Modification of Naturally Occurring Anti-HIV Peptides

The abundance of host defense peptides with diverse mechanisms of antiviral activity has supported their development as anti-HIV prophylactic microbicides. While such peptides are lauded for their ubiquitous occurrence across diverse lineages and their relatively broad spectrum antimicrobial activity, the challenge for microbicide development is in finding and isolating peptides that demonstrate potent and specific HIV inhibition; these compounds must not demonstrate toxicity to host cells or endogenous flora. The specificity of antiviral compounds is expressed as their therapeutic index, the ratio of their CC₅₀ (concentration at which host cell viability/proliferation is reduced by 50%) to their IC₅₀ (concentration at which viral infection is reduced by 50%) [40]. This is a useful gauge for the clinical potential of anti-HIV peptides. Some antiviral candidates exhibit desirable therapeutic indices as natural isolates (e.g. griffithsin, with an IC₅₀ >1000) [26]. Other compounds may not be as promising in their native form, but they can be drastically improved by engineered modifications to achieve favorable therapeutic indices (e.g. VIRIP, whose therapeutic index was enhanced from >68 to >5000 by sequence optimization) [30].

Various techniques have been explored in an effort to increase the therapeutic index of anti-HIV peptides via sequence-based and structural modifications. Further, several delivery approaches have been employed to improve the application and stability of anti-HIV peptides. In this section we will review the attempts and outcomes of several such modifications in order to evaluate techniques aimed at enhancing the therapeutic index of anti-HIV peptides and their clinical development as topical microbicides.

Many host defense peptides exhibit anti-HIV activity in their native form, whereas other peptides require modifications in order to meet the characteristics of an anti-HIV microbicide candidate. One straightforward technique for antiviral peptide improvement is the identification of active domains. In many cases, the antiviral activity of a large protein is attributed to only a small peptide fragment. Thus, the recombinant expression or synthetic production of the active portion is a practical way to streamline production and delivery of the antiviral peptide. This approach was demonstrated by the identification and isolation of the active portions of human anti-HIV proteins LL-37, lysozyme, and α-melanocyte-stimulating hormone (α-MSH).

The 14.7 kDa host defense protein lysozyme inhibits a wide range of microbes [41]. The protein as a whole exhibits anti-HIV activity at nanomolar concentrations, but this activity can be distilled down to a 9-amino acid peptide sequence, RAWVAWRNR. This peptide adopts an α -helical structure that inhibits HIV infection with approximately the same potency as full-length lysozyme [18]. Similarly, the anti-HIV activity of the human cathelicidin product LL-37 is achieved by a 25-residue region of the C-terminus. This fragment inhibits the activity of HIV reverse transcriptase enzyme with a lower IC₅₀ than the intact LL-37 protein (7μM, down from the original 15 μM) [37]. Thus, isolating the active domain of an antiviral protein can increase its potency.

An extreme instance of active domain isolation is demonstrated by the antiviral peptide α-MSH. Alpha-MSH is a human anti-inflammatory protein expressed by keratinocytes and monocytes, among other cell types. Importantly, microbicides that exhibit anti-inflammatory activity may perform dual functions in preventing HIV transmission. First, they can suppress HIV infection by inhibiting the activation of the proinflammatory transcription complex NF-κB, which otherwise drives replication of HIV by binding the proviral long terminal repeat and promoting transcription of the viral genome [42]. Second, by suppressing inflammation and reducing recruitment of immune cells to mucosal tissues, these peptides minimize the pool of potential CD4+ target cells that could become infected by invading HIV virions. In the case of the antiinflammatory protein α-MSH, antiviral activity can be achieved by only a three amino acid sequence, KPV, which suppresses NF-κB activation and concomitant HIV infection at equimolar concentrations in comparison to the full-length α-MSH protein [43]. These examples illustrate how active domain isolation can simplify antiviral peptide production by focusing expression and isolation to only the relevant domains.

In other cases, antiviral activity is exerted by a more complex structure and cannot be fully recapitulated by a smaller peptide derivative. Such is the case of the small peptide mimetic grifonin-1, which was modeled after the 12.7 kDa antiviral protein griffithsin. Griffithsin is isolated from Griffithsia sp. of red algae, and structural analysis suggests that its antiviral activity is achieved by three glycan-binding motifs that bind the envelope glycoprotein gp120 to inhibit viral attachment to host cells [26,44]. Grifonin-1 is a peptide mimetic of the proteoglycan-binding β-turn domains of griffithsin and was constructed using non-canonical residues to optimize its stability and efficacy. Yet in this instance, the peptide mimetic suffered a 1000-fold decrease in antiviral activity compared to the parent protein when assayed at equimolar concentrations [22]. Still, its therapeutic index remains high, and because of its smaller size, it may prove to possess advantages in delivery over its parent protein griffithsin.

In addition to active domain isolation, intramolecular modifications that alter peptide sequence are often employed in hopes of improving the therapeutic index of anti-HIV peptides. Such modifications have been explored for antiviral peptides isolated from a myriad of sources and exhibiting diverse structures, with varying success. One group of antiviral peptides that has had little success in achieving promising therapeutic indices is comprised of peptides exhibiting direct virucidal activity by membrane lysis. As discussed above, membrane-disrupting anti-HIV peptides have poor therapeutic indices in their native forms. These permeabilizing peptides have been mutated in an effort to increase their therapeutic potential, which has been relatively unsuccessful. This is due to the difficulty of selectively targeting the peptides' lytic activity to viral membranes that are derived from host cell membranes over the host cells themselves. The difficulty of selectively directing antimicrobial peptides to the HIV membrane is evidenced by the peptides dermaseptin S4, the caerins, and indolicidin [15,16,39]. These peptides all execute antiviral activity by disrupting the viral membrane, and all are active in the micromolar range. Yet none of these molecules, nor their derivatives, achieve a therapeutic index of >20, as each induces cytotoxicity near its active concentration. Thus, anti-HIV peptides that function by lysis of viral membranes will likely be limited in therapeutic potential due to their corresponding disruption of host cell membranes.

While lytic peptides are unlikely to achieve specific inhibition of virions over host cells, the majority of anti-HIV peptides exert their inhibitory activity by mechanisms distinct from direct membrane disruption. For example, many antiviral peptides interact with host cell receptors or surface molecules, with viral surface proteins, or they may influence intracellular processes such as receptor trafficking or transcriptional regulation. In the case of such specific interactions, antiviral activity should be individually engineered to enhance peptide affinity for its target molecule. Such an approach was employed for optimization of the horseshoe crab antimicrobial peptide, polyphemusin II.

Polyphemusin II exhibits anti-HIV activity at submicromolar concentrations by binding to the host cell chemokine receptor CXCR4, one of two coreceptors utilized by HIV to enter host cells [27,45]. However the therapeutic index of native polyphemusin II is 25, limiting its potential for development. Yet a peptide with a defined mechanism but undesirable toxicity posed an opportunity for improvement, and through an extensive series of sequence and structural modifications, over 100 analogues of polyphemusin II have been constructed and therapeutic indices of >10,000 have been achieved [45-50]. Notably successful analogues include T22 (therapeutic index = 170) and T140 (therapeutic index = 13,000) [51]. While these modifications have produced potent and specific inhibitors, the prophylactic potential of these peptide analogues is still limited due to their restricted activity against only X4-tropic viruses. This is especially limiting since nearly all HIV founder strains (viral strains responsible for establishing initial infection) utilize the chemokine coreceptor CCR5 rather than CXCR4 to attach and fuse to host cells [52,53].

Yet the survey of sequence substitution and incorporation of non-canonical residues in polyphemusin II analogues paved the way for the optimization of other antiviral peptides. For example, while enantiomeric amino acid residues occur naturally in some antiviral peptides (e.g. gramicidin), they are now also frequently engineered into modified analogues of other antiviral peptides (e.g. analogues grifonin-1, VIR-353 and VIR-449) [22,30,54]. Additionally, synthesized analogues are now often engineered to contain non-canonical residues such as citrulline, naphthylalanine, cyclohexylalanine, and cyclohexylglycine to expand the available repertoire of structural building blocks [22,50]. This has allowed for a broader spectrum of physical characteristics to be incorporated into antiviral peptide analogues, which in turn increases our ability to optimize their anti-HIV activity. In addition to optimizing the therapeutic profile of analogues, incorporation of such non-classical residues may also enhance the stability of microbicides by imparting resistance to stereospecific proteolytic degradation [55].

While sequence substitutions have elucidated some useful trends and approaches, structural modifications aimed at improving antiviral peptides have been more difficult to interpret. As an example, the porcine peptide protegrin has been extensively modified by structural rearrangements that displayed varying success in improving antiviral activity. Protegrin is an 18 amino acid antimicrobial peptide that in its native form contains four cysteines, which are linked by two disulfide bonds to stabilize a β-hairpin structure [56]. Tamamura and colleagues engineered a series of disulfide-linked protegrin variants to construct each possible arrangement of two disulfide linkages between the four cysteines. Surprisingly, these bond rearrangements and accompanying major structural changes did little to alter antiviral activity or cytotoxicity to host cells [57].

On the other hand, Tam and colleagues cyclized protegrin, which slightly enhanced the therapeutic index by subduing cytotoxicity to mammalian cells. However, when a third disulfide bond was incorporated by introducing two additional cysteine residues in the cyclic analogue, the CC₅₀ was improved another 6-fold, resulting in nearly a 9-fold increase in therapeutic index compared to native protegrin [58]. This result suggests that the stabilized hairpin motif might be important for executing anti-HIV activity. Yet, in surprising contrast to the improved therapeutic profile achieved by the stabilized cyclization of protegrin, complete elimination of all disulfide bonds was even more successful in enhancing the therapeutic index of protegrin; a linearized analogue achieved an overall improvement >15-fold compared to native protegrin, arguing that structural rigidity is likely not an important determinant of antiviral activity [57]. Thus, apparently disparate structural alterations achieved similar enhancement of therapeutic potential for the anti-HIV peptide protegrin. The interpretation of these results is confounded by the lack of a recognized antiviral mechanism for protegrin; without understanding the critical molecular interactions that allow protegrin to inhibit HIV, it is increasingly difficult to rationalize and predict the effect of structural rearrangements on the therapeutic profile of antiviral peptides. Protegrin modifications stand in contrast to the engineered analogues of polyphemusin II, which achieved exceptional therapeutic indices on account of a mechanistic understanding of its antiviral activity. These contrasting examples highlight the importance of elucidating the mechanism of viral inhibition in order to successfully design improved anti-HIV peptides.

Through extensive substitutions and rearrangements, a pool of promising antiviral peptides has been assembled, some with therapeutic indices exceeding 1000. Once an antiviral peptide has demonstrated safety and efficacy in vitro, a suitable application system must be formulated for its mucosal delivery to be evaluated in animal and clinical studies. These formulations can be tailored to ensure stability and safety for the intended exposed surfaces (vaginal, penile, rectal), and they have evolved from simple gel and cream suspensions to dissolvable films for mucosal application and vaginal rings for slower release of antimicrobial compounds with fewer reapplications [59]. These formulation options allow microbicides to be designed for immediate application pre-coitus or for continual delivery in the form of long-lasting rings.

Recently, another technique has surfaced in the vaginal microbicide field; the recombinant expression of antimicrobial proteins by transgenic lactobacilli is being explored as a delivery option. Lactobacillus species comprise the majority of the endogenous commensal vaginal microbiota. These probiotic bacteria produce antimicrobial bacteriocins, proteins that have been shown to inhibit urogenital pathogens [60]. Lactobacilli are also known to contribute lactic acid and hydrogen peroxide to the vaginal canal, which can prevent HIV by direct viral inhibition or indirectly by inhibiting pathogenic infections that increase host susceptibility to HIV acquisition [61-63]. In fact, pathogenic conditions in which lactobacilli are depleted from the vaginal lumen are accompanied by increased rates of HIV transmission, such as the microbial shift condition bacterial vaginosis, in which displacement of vaginal lactobacilli is accompanied by a 60% increased rate of HIV infection [64]. As the benefits of these commensal flora have been elucidated, the past decade has seen an increase in studies to supplement the natural antiviral activity of the vaginal microbiome and even to enhance it through recombinant techniques.

To this end, the expression of antiviral peptides by probiotic lactobacilli has been eagerly explored. The transformation of lactobacilli has been improved, and it has been shown that these bacteria can achieve superior folding of recombinant antiviral proteins compared to mammalian expression systems [65]. Furthermore, recombinant fusion inhibitor peptides corresponding to the heptad repeat-2 region of the HIV envelope protein gp41 were expressed by these transgenic bacteria, and they successfully inhibited HIV fusion in vitro [66]. Initial in vivo studies have demonstrated successful colonization of the human vaginal canal when lactobacilli were administered in repeated doses [67]. Most recently, recombinant lactobacilli expressing the antiviral protein cyanovirin-N were administered vaginally to macaques, which successfully prevented vaginal infection by SHIV up to 63% [68]. This rate of inhibition is likely a combined effect of the endogenous protective factors contributed by the lactobacilli in addition to the antiviral protein they were engineered to recombinantly express. Thus, in addition to accomplishing sustained delivery of antiviral compounds, the intravaginal application of transgenic lactobacilli has the dual advantage of also bolstering the endogenous protective barrier of the female reproductive tract. This merits further investigation as a clinical strategy for vaginal microbicide delivery.

Looking ahead, the isolation and optimization of natural peptides with potent and specific anti-HIV activity support their development as prophylactic topical microbicides. Considering the failure of cytotoxic detergent-based microbicides to provide safe and effective protection against HIV, the superior therapeutic indices and diverse mechanisms of action of naturally occurring anti-HIV peptides provide a spectrum of promising antiviral candidates. As experience and understanding of these peptides accumulate, our ability to enhance their activity brings them ever nearer to clinical development as anti-HIV microbicides.