Skip to main content
PLOS One logoLink to PLOS One
. 2015 Jun 1;10(6):e0126510. doi: 10.1371/journal.pone.0126510

Computational Docking Study of p7 Ion Channel from HCV Genotype 3 and Genotype 4 and Its Interaction with Natural Compounds

Shilu Mathew 1,2,3, Kaneez Fatima 4, M Qaiser Fatmi 5, Govindaraju Archunan 3, Muhammad Ilyas 6, Nargis Begum 1, Esam Azhar 7, Ghazi Damanhouri 7, Ishtiaq Qadri 7,*
Editor: Shama Ahmad8
PMCID: PMC4451521  PMID: 26030803

Abstract

Background

The current standard care therapy for hepatitis C virus (HCV) infection consists of two regimes, namely interferon-based and interferon-free treatments. The treatment through the combination of ribavirin and pegylated interferon is expensive, only mildly effective, and is associated with severe side effects. In 2011, two direct-acting antiviral (DAA) drugs, boceprevir and telaprevir, were licensed that have shown enhanced sustained virologic response (SVR) in phase III clinical trial, however, these interferon-free treatments are more sensitive to HCV genotype 1 infection. The variable nature of HCV, and the limited number of inhibitors developed thus aim in expanding the repertoire of available drug targets, resulting in targeting the virus assembly therapeutically.

Aim

We conducted this study to predict the 3D structure of the p7 protein from the HCV genotypes 3 and 4. Approximately 63 amino acid residues encoded in HCV render this channel sensitive to inhibitors, making p7 a promising target for novel therapies. HCV p7 protein forms a small membrane known as viroporin, and is essential for effective self-assembly of large channels that conduct cation assembly and discharge infectious virion particles.

Method

In this study, we screened drugs and flavonoids known to disrupt translation and production of HCV proteins, targeted against the active site of p7 residues of HCV genotype 3 (GT3) (isolatek3a) and HCV genotype 4a (GT4) (isolateED43). Furthermore, we conducted a quantitative structure–activity relationship and docking interaction study.

Results

The drug NB-DNJ formed the highest number of hydrogen bond interactions with both modeled p7 proteins with high interaction energy, followed by BIT225. A flavonoid screen demonstrated that Epigallocatechin gallate (EGCG), nobiletin, and quercetin, have more binding modes in GT3 than in GT4. Thus, the predicted p7 protein molecule of HCV from GT3 and GT4 provides a general avenue to target structure-based antiviral compounds.

Conclusions

We hypothesize that the inhibitors of viral p7 identified in this screen may be a new class of potent agents, but further confirmation in vitro and in vivo is essential. This structure-guided drug design for both GT3 and GT4 can lead to the identification of drug-like natural compounds, confirming p7 as a new target in the rapidly increasing era of HCV.

Introduction

Hepatitis C virus (HCV) is chronically affecting approximately 180 million people worldwide. HCV infected individuals are at risk for liver cirrhosis as well as hepatocellular carcinoma [1, 2]. The enveloped HCV belongs to family Flaviviridae with seven main genotypes and roughly about 100 subtypes according to the wide geographical distribution of the HCV [3, 4]. HCV genotypes (GTs) 1–3 are distributed worldwide. The most common subtypes are 1a and 1b, accounting for about 60% of global HCV infections. These HCV subtypes prevail in Eastern Europe, Japan, and North America. GT2 remains less frequently reported than GT1. GT3 is endemic in Southeast Asia, and is unevenly distributed in various other countries around the world. GT4 is largely found in the Middle East, Central Africa, and Egypt, GT5 is almost exclusively found in South Africa, and GTs 6–11 are scattered across Asia [5–8]. The current treatment routes are limited to interferon-based and interferon-free regimens. Ribavirin and IFN-alpha-2 combination therapy has limited, but variable, effectiveness, depending on the HCV genotype and the host immune response [9, 10]. In the USA, simeprevir, an FDA approved NS3/4A protease inhibitor, is also dosed along with peg-IFN and ribavirin as triple therapy. Recently in 2011, Food and Drug Administration (FDA) and European Medicines Agency (EMEA) have approved two direct-acting antivirals (DAAs) namely boceprevir and telaprevir; these NS3/4A protease inhibitors have shown promising sustained virologic response (SVR) in phase III clinical trial, however, they are genotype specific [11]. Some combination therapies of some oral drugs have been also licensed by FDA during 2013 and 2014, which include sofosbuvir, a nucleotide analog that inhibits RNA polymerase, in combination with ribavirin for oral dual therapy of HCV GT2 and GT3 as well as sofosbuvir in combination with the viral NS5A inhibitor ledipasvir for the treatment of GT1 infection, respectively [12]. During 2012, at least 30 additional DAAs were in various stages of clinical development.

The HCV genome is expressed as large as a polyprotein and cleaved by proteases into an array of proteins. The single-stranded RNA genome encodes structural proteins, including core, glycoproteins E1 and E2, and p7, along with non-structural proteins NS2, NS3, NS4A, NS4B, NS5A, and NS5B [13]. The p7 ion channel is positioned in the middle of both the structural protein E2 and non-structural proteins [14]. HCV p7 is a viral channel-forming protein comprised of two elongated hydrophobic transmembrane (TM) domains linked by a cytosolic loop [15]. However, the structural information for p7 ion channel is known, including protein oligomerization as well as folding of the helices [16, 17]. The hexameric bundle structure was reported for the first time in a Nuclear Magnetic Resonance (NMR) spectroscopic study; the three-dimensional structure of the hexamer was generated using computational methods [18]. The recent advances in computational techniques have enabled us to build small protein molecules and portions of larger protein molecules with reasonably good resolution. Various approaches have been developed and adopted, including a combination of modeling, molecular docking, and molecular dynamics simulations [19]. Computer-modeling of proteins is guided by the knowledge of how membrane proteins are folded or inserted into the lipid membrane. Membrane proteins are translated with the aid of translocons [20–22]. Translocons are membrane-spanning proteins that enable the primary sequence of the membrane protein to form secondary structure within the hydrophobic region of the lipid membrane. The final topology of the membrane protein is dictated by the prime amino acid sequence of the protein [23–25]. The protein is finally released into lipid bilayer. Thus, once the secondary structure is formed, the protein retains this folded structure. These viral channel-forming proteins can also be built alone using computational techniques [26, 27].

Apart from forming a self-assembled, sophisticated, funnel-like architecture that selectively conducts cations, the p7 protein also plays a crucial role in viral assembly and envelopment processes in coordination with NS2 protein [14, 28, 29]. Steinmann and co-workers have shown that the production of viral particle by p7 is genotype-specific due to its interaction with other viral factors. However, the interaction pattern of p7 protein with other viral and host factors as well as its exact contribution in viral production remains uncertain [29]. Recently, a co-immunoprecipitation study using a replication-competent virus containing a double HA-tagged p7 was performed by Vieyres and co-workers that endorsed the formation of specific interaction between p7 and NS2, and highlighted its importance in virus production in cell culture [30]. Although the basic fundamental structures of p7 are becoming gradually understood, the conditions that lead to disruption of the assembly of the functional channel as well as the mechanism of drug-interactions are unknown. Furthermore, absence of clinical efficiency with current p7 inhibitors has cast doubt over their precise antiviral effects. Adamantine, rimantadine and alkylated imino sugars (IS) are known and identified as having particular resistance mutations that ascribe their methods of inhibition. Sensitivity of p7 ion channel activity to inhibition has been reported in vitro with hexamethylene chloride, adamantine, as well as long chain imino sugars. These inhibitors are active against only certain HCV genotypes, and various groups have reported differing sensitivities [16]. Present interferon-based therapy for HCV infected patients is insufficient, stimulating a route for combination of direct-acting antiviral (DAA). Several compounds targeting the three non-structural viral proteins NS3/4A protease, NS5A, and NS5B polymerase, still must be assessed.

p7 oligomerizes in the phospholipids membranes forming a cation-selective ion channel [31, 32], which is known for drug targetable region for molecular activity of protein; that is so far characterized. p7 is also grouped to the family of viroporin as the HIV-1 Vpu and influenza A protein M2 [15, 33, 34]. Viroporin inhibitors such as rimantidine and amantadine were first approved over 40 years ago as anti-influenza A drugs, proving an effective pharmacological expansion in the class of anti-viral complexes [35]. Rimantidine and amantadine hinder influenza A by obstructing H+ conduction via the M2 ion channel, thereby disturbing the conformational change in the viral proteins required for viral replication [36]. Recently, it was shown that p7 mediates cation conductance, and is inhibited by adamantine, long alkyl chain imino sugar and amiloride in vitro with varying reported efficacies [31, 37–39]. Additionally, p7 is known to precisely interact with the non-structural NS2 protein, indicating that its channel activity can be regulated [30, 40].

An in silico approach combining global search engines and macromolecule-ligand computational docking was applied to create the best possible models for assembled p7. We compared the inhibitory efficacy of three reported p7 inhibitors. In the study presented here, we modeled the monomeric p7 structures from GT3 (Asia) and GT4 (Middle East) to develop 3D structures, which were evaluated by protein simulation and PROCHECK. In addition, we docked the selected ligands into active site regions of the modeled structure from both genotypes. We focused on constructing and evaluating the 3D structures from representative with the type of interaction made with the residues of the model. Our results reveal a possible role for residues interacting with the p7 ion channel. It is likely that the future inhibitor natural compounds against p7 will have to be tested on multiple genotypes to determine the potential clinical efficacy.

Materials and Methods

The sequences for p7 ion channel, each consisting of 63 amino acids, were retrieved from UniProtKB. It was ensured that all the selected viral strains use homo sapiens as their host (Table 1). The UniProtKB entries for 12 strains of HCV GT1 are P27958, P26664, Q00269, Q9WMX2, Q03463, P26662, Q913V3, O92972, P26663, P29846, Q81754 and Q913D4; for HCV GT2 (6 strains) are P26660, Q99IB8, P26661, Q9DHD6, Q68749 and Q9QAX1; for HCV GT3 (4 strains) are Q81495, Q81258, Q81487 and Q68801; for GT4 (7 strains) are O39929, M1VKT9, A2CJ00, Q1ZZ56, A0A023JCC8, A8S500 and A8S507; for GT5 (2 strains) are O39928 and O91936; and for HCV GT6 (5 strains) are Q5I2N3, O39927, O92529, O92530 and O92532.

Table 1. The table denotes 63 amino acid residues of p7 ion channel obtained from complete HCV genome of various HCV genotypes and subtypes isolated from different countries.

Entry code Isolated Virus host Chain amino acid HCV p7 (all genotypes) strains Subtypes
P27958 North America Homo sapiens (Human) 747–809 63 >isolate H-1a|P27958|747-809ALENLVILNAASLAGTHGLVSFLVFFCFAWYLKGRWVPGAVYALYGMWPLLLLLLALPQRAYA isolate H 1a
P26664 North America Homo sapiens (Human) 747–809 63 >isolate1-1a|747-809ALENLVILNAASLAGTHGLVSFLVFFCFAWYLKGKWVPGAVYTFYGMWPLLLLLLALPQRAYA isolate 1 1a
Q00269 Japan Homo sapiens (Human) 747–809 63 >isolate HC-JT-1b|Q00269|747-809ALENLVVLNAASLAGADGILSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYA isolate HC-JT 1b
Q9WMX2 Europe Homo sapiens (Human) 747–809 63 >isolate Con1-1b|Q9WMX2|747-809ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYA isolate Con1 1b
Q03463 Japan Homo sapiens (Human) 747–809 63 >isolate HC-J1-1bALENLVILNAASLAGTRGLVSFLVFFCFAWYLKGRWVPGAAYALYGMWPLLLLLLALPQRAYA isolate HC-J1 1b
P26662 Japan Homo sapiens (Human) 747–809 63 >isolate Japanese-1b|P26662|747-809TLENLVVLNAASVAGAHGLLSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYA isolate Japanese 1b
Q913V3 Europe Homo sapiens (Human) 747–809 63 >isolate HCR6-1b|747-809ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGKLVPGAAYAFYGVWPLLLLLLALPPRAYA isolate HCR6 1b
O92972 Japan Homo sapiens (Human) 747–809 63 >strain HC-J4-1b|O92972|747-809ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA strain HC-J4 1b
P26663 Asia Homo sapiens (Human) 747–809 63 >isolate BK-1b|P26663|747-809ALENLVVLNSASVAGAHGILSFLVFFCAAWYIKGRLVPGATYALYGVWPLLLLLLALPPRAYA isolate BK 1b
P29846 Taiwan Homo sapiens (Human) 747–809 63 >isolate Taiwan-1b|P29846|747-809ALENLVVFNAASVAGMHGTLSFLVFFCAAWYIKGRLVPGAAYALYGVWPLLLLLLALPPRAYA isolate Taiwan 1b
P26660 Japan Homo sapiens (Human) 751–813 63 >isolateHC-J6-2a|P26660|751-813ALEKLVVLHAASAASCNGFLYFVIFFVAAWYIKGRVVPLATYSLTGLWSFGLLLLALPQQAYA isolate HC-G9 2a
Q99IB8 India Homo sapiens (Human) 751–813 63 >isolateJFH-1-2a|Q99IB8|751-813ALEKLVVLHAASAANCHGLLYFAIFFVAAWHIRGRVVPLTTYCLTGLWPFCLLLMALPRQAYA isolate India 2a
P26661 Japan Homo sapiens (Human) 751–813 63 >isolateHC-J8-2b|P26661|751-813ALEKLIILHSASAASANGPLWFFIFFTAAWYLKGRVVPVATYSVLGLWSFLLLVLALPQQAYA isolate HC-J6 2b
Q9DHD6 POLG_HCVJP Homo sapiens (Human) 751–813 63 >isolate JPUT971017-2b|Q9DHD6|751-813ALEKLIILHSASAASANGPLWFFIFFTAAWYLKGRVVPAATYSVLGLWSFLLLVLALPQQAYA isolate JFH-1) 2b
Q68749 POLG_HCVBB Homo sapiens (Human) 751–813 63 >isolateBEBE1-2c|Q68749|751-813ALEKLVILHAASAASSNGLLYFILFFVAAWCIKGRAVPMVTYTLLGCWSFVLLLMALPHQAYA isolate HC-J8 2c
Q9QAX1 POLG_HCVVA Homo sapiens (Human) 751–813 63 >isolateVAT96-2k|Q9QAX1|751-813ALEKLVILHAASAASSHGMLCFIIFFIAAWYIKGRVTPLVTYSYLGMWSFSLLLLALPQQAYA isolate JPUT971017 2k
Q81487 POLG_HCVTR Homo sapiens (Human) 755–817 63 >isolateTr-Kj-3b|Q81487|755-817AMENLVMLNALSAAGQQGYVWYLVAFCAAWHIRGKLVPLITYGLTGLWPLALLDLLLPQRAYA isolate BEBE1 3b
Q68801 POLG_HCVJK Homo sapiens (Human) 751–813 63 >isolateJK049-3k|Q68801|752-814ALENLIVLNAISAAGTHGIWWSLVAFCVAWHVRGRIFPIAVYSIVGLWPLLLLVLMLPYRAYA isolate VAT96 3k
O39929 POLG_HCVED Homo sapiens (Human) 747–809 63 >isolateED43-4a|O39929|747-809ALSNLININAASAAGAQGFWYAILFICIVWHVKGRFPAAAAYAACGLWPCFLLLLMLPERAYA isolate k3a 4a
M1VKT9 M1VKT9_9HEPC Homo sapiens (Human) 747–809 63 >isolateM1VKT9-4a|747-809ALSNLININAASAAGTQSFWYAILFICIAWHVKGRLPAIAAYAACGMWPLLLLLLMLPERAYA isolateM1VKT9 4a
A2CJ00 A2CJ00_9HEPC Homo sapiens (Human) 747–809 63 >isolateA2CJ00-4d|747-809LANLITINAVSVAGIHGFWHAILLICIAWHVKGRFPAAATYAACGLWPLLLLVLMLPERAYAF isolateA2CJ00 4d
Q1ZZ56 Q1ZZ56_9HEPC Homo sapiens (Human) 747–809 63 >isolateQ1ZZ56-4d|747-809LANLVTINAVSAAGTHGFWYAILVICIAWHVKGRIPAAATYAACGMWPLLLLVLMLPERAYAF isolateQ1ZZ56 4d
A0A023JCC8 A0A023JCC8_9HEPC Homo sapiens (Human) 747–809 63 >isolateA0A023JCC8-4d|747-809LANLITINAVSVASIHGFWYAIFVICIAWHVKGKLPAAATYAACGLWPLLLLVLMLPERAYAF isolateA0A023JCC8 4d
A8S500 A8S500_9HEPC Homo sapiens (Human) 747–809 63 >isolateA8S500-4f|747-809EAALTNLININAAAAVGTHGFYYAILFICVVWYIKGRAPAAAAYAACGMWPLLLLLLALPERA isolateA8S500 4f
A8S507 A8S507_9HEPC Homo sapiens (Human) 747–809 63 >isolateA8S507-4f|747-809AALANLITINATAAVGTHGFCYAILFICVVWYIKGRGPAAAAYAACGMWPLLLLLLALPERAY isolateA8S507 4f
O39928 New Zealand Homo sapiens (Human) 748–810 63 >isolateEUH1480-5a|O39928|748-810TCKNVIVLNAAAAAGNHGFFWGLLVVCLAWHVKGRLVPGATYLCLGVWPLLLVRLLRPHRALA isolate NZL1 5a
O91936 POLG_HCVSA Homo sapiens (Human) 748–810 63 >isolateSA13-5a|O91936|748-810ALENVIVLNAAAAAGTHGFFWGLLVICFAWHFKGRLVPGATYLCLGIWPLLLLLFLLPQRALA isolate Tr-Kj 5b
Q5I2N3 POLG_HCV6A Homo sapiens (Human) 752–814 63 >isolate6a33-6a|Q5I2N3|752-814AVERLVVLNAASAAGTAGWWWAVLFLCCVWYVKGRLVPACTYMALGMWPLLLTILALPHRAYA isolate JK049 6a
O39927 POLG_HCVEU Homo sapiens (Human) 751–813 63 >isolateEUHK2-6a|O39927|751-813AVERLVVLNAASAAGTAGWWWAVLFLCCVWYVKGRLVPACTYMALGMWPLLLTILALPPRAYA isolate ED43 6a
O92529 POLG_HCVT5 Homo sapiens (Human) 752–814 63 >isolateTh580-6b|O92529|752-814ALERLVVLNAASAAGTAGWCWTLIFLCCVWHVKGRLVPACTYTALGMWPILLVILALPQRAYA isolate EUH1480 6b
O92532 POLG_HCVVP Homo sapiens (Human) 752–814 63 >sp|O92532|748-810ALENVIVLNAASAASCQGLLWGLIFICCAWHVRGRAVPVTTYALLQLWPLLLLILALPRRAYA isolate VN004 6h
O92531 POLG_HCVVO Homo sapiens (Human) 752–814 63 >sp|O92531|749-811ALENLIVLNATSAAGSQGWVWGVVFICAAWYIRGRAAPITTYAILQLWPLLLLVLALPRRAYA isolate VN405 6k

Each strain is represented by Uniprot with their entry code.

PRALINE multiple sequence alignment

Multiple sequence alignment was done on the FASTA format of p7 ion channel for all genotypes by using IBIVU server [41–43]. PRALINE multiple sequence alignment used BLOSUM62 weight matrix algorithm with gap penalty and extension values of 12 and 1, respectively. PSI-BLAST pre-profile processing (Homology-extended alignment) was used for progressive alignment strategy [44, 45]. The alignment was also based on structural features which used DSSP-defined secondary structure using PSIPRED method [41].

Phylogenetic analysis

The Phylogeny.fr platform [46] was used to generate phylogenetic tree of all HCV genotypes in order to find out the evolutionary relationship among them. The processing steps of multiple alignment and refinement were done by using programs called MUSCLE 3.7 and Gblocks 0.91b, respectively. The parameter values of 16, 26 and 8 were used for minimum number of sequences for conserved position, minimum number of sequences for flanking position and maximum number of contiguous non conserved positions, respectively. Phylogenetic tree was constructed and visualized by PhyML 3.0 and TreeDyn 198.3 programs, respectively. Branch support (displayed in % and colored in red) was estimated with the approximate likelihood ratio test (aLRT) method as implemented in PhyML 3.0.

Sequence alignment and homology modeling

The protein sequence of HCV p7 ion channel, retrieved from SWISS PROT database, contains about 63 amino acid residues [47]. ClustalW was used for multiple sequence alignment of protein FASTA sequence between prevalent HCV GT3 [48] and HCV GT4 (subtype-ED43) in Asia and Middle East. Multiple alignment parameters includes weight matrix that uses BLOSUM with gap open penalty and gap extension penalty values of 10 and 0.05, respectively [49] in Asia and Middle East. Multiple alignment parameters includes weight matrix that uses BLOSUM with gap open penalty and gap extension penalty values of 10 and 0.05, respectively [50].

The crystal structure of hepatitis C virus of GT1 [51] (PDB entry code3ZDO) was identified as a homologous protein of p7 domains, 753–815 and 747–809, of GT3a (Q81495) and GT4a (O39929), respectively, by using BLAST against PDB database. The crystal structure was then used as a template to model p7 ion channel of HCV GT3 and GT4. The energy minimization of the modeled proteins was done by using ModRefiner [52], which follows two-step procedure for constructing full-atom model. The first step builds the backbone for the available C-alpha and performs energy minimization to improve the quality followed by the second step which adds side chain atoms from a rotamer library, and conducts energy minimization to both side chains and backbone conformations [52].

3D structure validation

The final refined p7 models for HCV GT3 and GT4 were validated by using PROCHECK (Structural Analysis and Verification Server) to calculate the Ramachandran plot [53]. SuperPose version 1.0 was used to analyze energy criteria of modeled proteins for genotype 3 and 4 with 3D template structure [54], and to calculate the root mean square deviation (RMSD) value with the template [54].

Ligand generation and optimization

The structure of the four available drug molecules such as, long-alkyl-chain iminosugar derivatives (N-Butyldeoxynojirimycin NB-DNJ), hexamethylene amiloride, amantadine and BIT225 were obtained from PubChem [55] Similarly the 2D chemical structure of the natural molecules which has antiviral properties, were also drawn by using ACD Chemsketch. CHARMM force field was applied for energy minimization to obtain a convergence gradient by using CHARMM Boundary Potential Builder [56]. (Represented in Table 2.)

Table 2. Different types of active ligands taken into in silico study, with their chemical formula and their predicted function in disrupting different stages of viral cycles.

S.No Drug names Chemical Formula Viral step References
1 Amantadine C10H17N Ion channels activities [74]
2 Hexamethylene Chloride C12H30Cl2N2 HCV particle production [31, 74, 85]
3 NB-DNJ C10H21NO4 Folding of viral envelope and production of viral particles [29, 39, 78]
4 BIT225 C16H15N5O Ion channels activities [80]
5 Apigenin C15H10O5 HCV infection [74, 86]
6 EGCG C22H18O11 Early step of entry glycoproteins (attachment)Cell-to-cell spreadClearance of cell culture [64, 87]
7 Ladanein C17H14O6 HCV entry [88]
8 Luteolin C21H20O11 Replication [86]
9 Naringenin C15H12O5 AssemblySecretion (core and HCV RNA) [89, 90]
10 Quercetin C15H10O7 HCV replicationHCV production [91, 92]
11 Silymarin C25H22O10 Entry (fusion)ReplicationRNA and protein expression [37, 93, 94]
12 Honokiol C18H18O2 EntryReplication [95]
13 Nobelitin C21H22O8 Replication [96, 97]

VEGA-QSAR

A virtual model for property evaluation of chemicals within global architecture-quantitative structure-activity relationship (VEGA-QSAR) program was used to analyze the selected ligands to determine the relationship of physiochemical properties and biological activities of descriptor molecules in various classified QSAR models. QSAR models initially summarize a theoretical relationship between chemical structures and biological activity in a data-set of chemicals. Secondly, QSAR models determine the activities of new chemical compounds. Toxicity, ecotoxicity, predicted physiochemical properties of ligands such as logP (CAESAR-version 1.1.2), bio concentration factor (BCF) (CAESAR-version 2.1.13), carcinogenicity model (CAESAR 2.1.8), mutagenicity model (CAESAR version 2.1.12), skin sensitization model (CAESAR-version 2.1.5), developmental toxicity model (CAESAR-version 2.1.6), fathead minnow LC50 96hr (lethal concentration to kill 50% of the test animals) (Environmental Protection Agency (EPA)-version1.0.6), daphnia magna LC50 48hr (EPA-version 1.0.6), BCF reads across model (version-1.0.2), and ready biodegradability model (version 1.0.8) were determined. The VEGA-QSAR models were initially derived from CAESAR models, and other models were added to stimulate the already available models, one such model is EPA (US Environmental Protection Agency). The used input formats were SMILES and SDF files [57].

Docking studies

Comparative molecular docking study between HCV p7 GT3 and p7 GT4 with the selected molecules was performed by using CLC drug discovery workbench, which follows a template docking algorithm, and uses MolDock scoring function for binding energy calculations [58]. Molecule project system is initially used to upload the PDB files of the modeled p7 structures, containing a binding site setup as input. For each of the small molecules in the molecule table, the docking simulation searches for optimal binding modes to the binding site. A maximum of 10 binding modes of ligands for each p7 protein were generated by using default parameter of CLC drug discovery. The docking score used in the Drug Discovery Workbench is the PLANTSPLP score [59]. This score has a good balance between accuracy and evaluation time. The score mimics the potential energy change, when the protein and ligand come together. This means that a very negative score corresponds to a strong binding and a less negative or even positive score corresponds to a weak or non-existing binding. Based on the number of HBond interactions and docking score, the best-ranked compounds were selected for detailed binding interaction studies. The ligand-protein complexes were visualized in CLC drug discovery visualization tool [60].

Results and Discussion

Phylogenetic analysis

The amino acid sequences of the p7 ion channel from all complete HCV genotypes were aligned to generate a maximum likelihood tree (PhyML) with a divergent outgroup between each subtypes. The results of phylogenetic analyses are summarized in Fig 1. The p7 ion channel of GT1 shows closer similarity within different strains of subtype b. Strains from subtype a (GT1) are similar to GT3 p7 subtypes. p7 from subtypes GT4 and GT5 are predicted to have maximum likeness. Strains from GT4 subtype 4d such as isolateQIZZ56, isolateA2CJ00 and isolateA0A023JCC8 formed a cluster indicating low sequence variation as compared to those from GT4 subtypes 4f such as isolateA8S500 and isolateA8S507 which showed maximum similarity. The GT6 is slightly distributed between GT4, GT5, and GT2. The branch leading to GT4a isolateED43 is long, potentially because it had the most time to evolve. The rooting of the GT1 clade is less divergent among its subtypes compared to the vast divergence between GT4, GT5, and GT6. At the base of the tree, HCV GT1 subtypes 1a and 1b are clustered and diverse from the global subtype 1c, whereas both GT2 and GT3 subtypes are clustered together in their respective clade. Among the GT2 phylogenies, the 2a, 2c, and 2k subtypes formed a cluster diverse from the 2b subtypes. Within the core phylogeny, only strain isolateHC-J8-2b is present separate from this cluster, possibly due to less bootstrap support arised from inadequate phylogenetic details. Similarly, strain (isolate6a33) clustered outside, compared to subtype 6a (isolateEUHK2) and 6b (isolateTh580). GT6 subtypes are genetically very diverse, are distributed throughout the tree, and tended to be found at the base of the HCV GT4 and GT5 branches. Amino acid substitution/mutation rate per site in p7 protein among all genotypes of HCV was found to be 0.03%, meaning that the virus has accumulated a significant number of substitutions. Thereby, the phylogenetic analysis of HCV p7 genotype isolates from different strains and reference strains from various other parts of the world divulges great genomic diversity of GT4, GT5, and GT6, less diversity of GT1, and moderate diversity in GT2 and GT3.

Fig 1. Phylogenetic relationships among different HCV genotypes and their subtypes.

Fig 1

The numbers (shown in red) above the branches are the maximum likelihood branch support values that are obtained by using PhyML 3.0 program.

Consensus sequence alignment

The multiple sequence alignment of the consensus sequence from both GT3 and GT4 isolates studied is shown in Fig 2a & 2b. The exact HCV subtype 3a of GT3 represents the subtype 3a strain from Asia (isolatek3a), and has 100% identity with the New Zealand strain (isolateNZL1). The percent sequence identity among different subtypes of GT3 varied between 62% and 78%. Similarly, the consensus sequence alignment of HCV subtype 4a of GT4 was also performed, which showed a maximum identity of 87% with isolateED43 and isolateM1VKT9, whereas the percent sequence identity among the different subtypes of GT4 such as isolateA8S507, isolateA8S500, isolateA0A023JCC8, isolateQ1ZZ56, and isolateA2CJ00 varied between 73% and 77%. We observed less variation in residues at the C-terminal region of p7 as compared to the loop region and N-terminal region in GT4 sequences but each subtype of GT4 was consistently mutated at 39 positions which could be considered as novel, as the amino acid residue varied at that particular position for each GT4 sequence. Comparative sequence alignment was also performed separately for both GT3 p7 subtypes as well as GT4 p7 subtypes to identify the sequence with maximum conserved residues so that the target region for interaction of protein residues with the ligand molecules can be defined. Therefore, subtype 3a (isolatek3a) from GT3 and subtype 4a (isolateED43) from GT4 were further taken for homology modeling, as they showed maximum similarity with their respective genotypes compared to other subtypes. Multiple sequence alignment of protein FASTA sequence for the complete set of p7 sequences from all genotypes was also analyzed to highlight the conserved and mutated region which is presented in S1 Dataset.

Fig 2. Multiple sequence alignment of HCV p7Comparative sequence alignment of HCV p7 with all GT3 subtypes using ClustalW program.

Fig 2

The conserved residues in all sequences have been highlighted by black color, as it denotes residues sharing ‘very similar’ and ‘less similar’ properties at that position, respectively. If there are no highlights, it denotes that there is no common residue in that position of the sequence. Isolatek3a and isolateNZL1 from GT3a showed maximum similarity compared to strains isolateJK049 and isolateTr-Kj. Sequence alignment was also performed within GT4 subtypes using ClustalW tool. The conserved regions sharing very similar sequence are highlighted in black. The GT4 subtypes showed much variation in the N-terminal region (1-13aa), followed by loop region (25-45aa) compared to C-terminal region (50-63aa).

BLAST alignment

We queried the reference sequence of the HCV GT3 p7 and HCV GT4 p7 target sequences by using the BLASTp (protein basic local alignment search tool) search. The BLASTp search revealed several sequences homologous to ion channel p7 GT3a (isolatek3a) and GT4a (isolateED43); the measles virus phosphoprotein (PDB code 3ZDO), was chosen as the best template for modeling the GT3 and GT4 p7 models. The 3ZDO ‘A’ chain, which had maximum identity with both of the selected genotypes, was chosen as a template sequence. The atomic structure of the stable domain of the measles virus phosphoprotein has a tight, four-stranded coiled coil, and consists of chains A, B, C, D, E, F, G, and H. This crystal structure was determined using X-ray diffraction at a resolution of 2.07 Å and was observed with more than one probable quaternary state. 3ZDO was obtained from the tetramerization domain of measles virus phosphoproteins, and had 56% identity to both the targets with query coverage of 100%. Accordingly, we generated a 3D macromolecule of 63 amino acid residues of the target GT3a and GT4a p7, based on alignment and modeling from an 84 amino acids sequence from chain A (3ZDO) of the measles virus phosphoprotein by a homology modeling procedure.

Comparison of Ramachandran plots

Both the modeled p7 ion channel were evaluated using the PROCHECK tool for stereochemical quality. By using Ramachandran plot, it was determined that both models had approximately 95% of AAs in the favored region, with less than 5% of the residues in the allowed region and 0.0% of the residues in the disallowed region (Table 3), indicating that the predicted models are highly reliable for further computational studies (Fig 3). Modeled p7 sequence alignment within GT3 and GT4 is denoted in Fig 4 with the consensus conserved regions. Fig 5 denotes the three-dimensional structure of both the GT3 and GT4 types p7 protein models. The RMSD value was calculated between the main-chain atom of the model and template, indicating close homology and ensuring reliability of the p7 model [61].

Table 3. Ramachandran plot describing the total number of residues as well as the number of residues located in allowed and disallowed regions for both the modeled p7 protein from HCV GT3 and HCV GT4.

Protein Models Favored regions Allowed region Generously Allowed region Disallowed region Total number of residues
HCV-3-p7 model 95.7% 4.3% 0.0% 0.0% 80
HCV-4-p7 model 95.8% 2.8% 1.4% 0.0% 80
1ZDO 99.0% 0.8% 0.0% 0.0% 505

Fig 3. Ramachandran plot of model p7 from GT3 and GT4 plotted between pi and psi angles of all amino acids.

Fig 3

Areas defined as red, yellow, light yellow and white indicate most favored, additional allowed, generously allowed and disallowed regions, respectively.

Fig 4. Modeled p7 alignment between GT3 and GT4 amino acid sequence and their conserved regions.

Fig 4

The degrees of conservation as well as the consensus between the amino acid sequences have been also mentioned.

Fig 5. The 3D structure of both the modeled GT3 p7 and GT4 p7.

Fig 5

(A) Coiled ribbon like structure of 63 amino acids p7 GT3 (b) Thread like structure of modeled p7 from GT4.

QSAR analysis

VEGA-QSAR analysis was carried out to predict different biochemical properties of potential ligands. Results attained through QSAR models could be effective to evaluate the chemical properties of chosen compounds, decreasing the necessity of animal tests. Different models were tested against antiviral compounds (Tables 4, 5 and 6). The selected compounds had both positive and negative predictions, including both mutagenicity and carcinogenicity. The fathead minnow LC50 was predicted to be less than 6.0 [-log (mol/L)] for all selected compounds, except for that of EGCG and honokiol, which were about 6.4 [-log (mol/L)] and 6.0 [-log (mol/L)], respectively. All compounds are sensitive to the skin except EGCG; NB-DNJ is known to be non-toxic compared to the other selected ligands. Only apigenin and luteolin are biodegradable. All the selected compounds are non-carcinogenic except for naringenin, silymarin, and quercetin. QSAR models predict hexamethylene chloride, NB-DNJ, and BIT225 as mutagenic. The log P value is a valuable parameter to understand the behavior of drug molecules; log P value is higher in honokiol (5.58 log units) and nobiletin (3.99 log units). Apigenin, NB-DNJ, and BIT225 have log P values less than 1.50 log units.

Table 4. Predicted values for the selected drugs using VEGA QSAR and their applicability domain analysis for various models.

QSAR Models Amantadine Hexamethylene Chloride NB-DNJ BIT225
Fathead minnow LC50 (96hr)-log (mol/l) 2.97 2.13 2.06 4.08
Daphnia Magna LC50 (48hr)-log (mol/l) 4.75 4.63 3.48 4.98
Mutagenicity model (CAESAR) Non-mutagen Mutagen Mutagen Mutagen
Carcinogenicity model Non-carcinogen NON-Carcinogen NON-Carcinogen NON-Carcinogen
Developmental Toxicity model Toxicant Toxicant Non- Toxicant Toxicant
BCF modellog(l/kg) 1.48 2.02 0.07 0.67
Ready biodegradability model NON Ready Biodegradable NON Ready Biodegradable NON Ready Biodegradable NON Ready Biodegradable
LogP prediction[log units] 2.44 2.36 0.38 1.85
Skin sensitization model (CAESAR) Sensitizer Sensitizer Sensitizer Sensitizer
BCF read-acrosslog(l/kg) 2.17 1.86 0.22 1.50

Table 5. QSAR predicted values and their applicability domain analysis for various models for active flavonoids.

QSAR Models Apigenin EGCG Ladanein Luteolin Naringenin Silymarin Quercetin
Fathead minnow LC50 (96hr)-log (mol/l) 4.42 6.42 4.95 4.95 4.58 4.58 4.58
Daphnia Magna LC50 (48hr)-log (mol/l) 2.61 1.76 4.46 3.25 2.61 2.61 2.61
Mutagenicity model (CAESAR) NON-Mutagen NON-Mutagen NON-Mutagen NON-Mutagen NON-Mutagen NON-Mutagen NON-Mutagen
Carcinogenicity model NON-Carcinogen NON-Carcinogen NON-Carcinogen NON-Carcinogen Carcinogen Carcinogen Carcinogen
Developmental Toxicity model Toxicant Toxicant Toxicant Toxicant Toxicant Toxicant Toxicant
BCF modellog(l/kg) 0.53 0.01 0.53 0.53 0.53 0.53 0.53
Ready biodegradability model Ready Biodegradable Non- Ready Biodegradable Ready Biodegradable Ready Biodegradable Non- Ready Biodegradable Non- Ready Biodegradable Non- Ready Biodegradable
LogP prediction[log units] 1.81 1.71 2.71 2.71 2.52 2.52 2.52
Skin sensitization model (CAESAR) Sensitizer Non- Sensitizer Sensitizer Sensitizer Sensitizer Sensitizer Sensitizer
BCF read-acrosslog(l/kg) 1.26 0.97 2.25 2.25 2.18 2.18 2.18

Table 6. QSAR predicted values for phenol compounds used for docking analysis and their applicability domain analysis for various models.

QSAR Models Honokiol Nobelitin
Fathead minnow LC50 (96hr)-log (mol/l) 6 5.37
Daphnia Magna LC50 (48hr)-log (mol/l) 3.62 4.45
Mutagenicity model (CAESAR) Non-mutagen Non-mutagen
Carcinogenicity model carcinogen Non- carcinogen
Developmental Toxicity model Toxicant Toxicant
BCF modellog(l/kg) 2.06 0.39
Ready biodegradability model Not-assignable Ready Biodegradable
LogP prediction[log units] 5.58 3.99
Skin sensitization model (CAESAR) sensitizer Non- sensitizer
BCF read-acrosslog(l/kg) 2.33 1.95

Virtual screening

Docking with selected drugs

In the CLC Molecule Project, in an entry, docking results are displayed together with the protein and other molecules in the project to visualize the binding mode of the ligand in the binding site. The ‘create interacting atoms group’ option was used to generate a custom atom group consisting of protein residues and molecules having at least one heavy atom within 5 Å of a ligand heavy atom. HCV p7 is distinguished into three regions, the loop region includes residues from 25 to 45 and the terminal regions include residues from 1–13 and 50–63, respectively for N- and C- terminal sites. The binding affinities, along with the re-rank score, were calculated for the best complexes. NB-DNJ formed maximum H-bonds with both GT3 and GT4 and exhibited the highest binding affinities (-28.74 kcal/mol and -28.70 kcal/mol, respectively). NB-DNJ is the only ligand from selected drugs which exhibits larger number of interactions with p7 residues. NB-DNJ is capable of forming hydrogen bonds, as it has large aliphatic chains thereby having largest number of rotatable bonds. GT3 p7 and GT4 p7 protein residues formed only one H-bond at the Thr27 and Gly34 residues with carbon atoms of amantadine. Hexamethylene chloride did not have any interactions with the modeled p7 residues in either genotype. In GT3 p7, BIT225 formed the best complex, forming five H-bonds with Leu8 (2), His17, and Thr27 (2) with an interaction energy value of -38.38 kcal/mol; in GT4 p7, only one H-bond interaction formed at Trp30 (energy value -30.47 kcal/mol). Only BIT225 was observed to have interactions with the N-terminal region of GT3 p7 involving residues Leu8 (2) and His17 (binding energy value-38.38 kcal/mol). The highest interaction energy value obtained was -45.80 kcal/mol, formed by hexamethylene chloride, due to a larger number of H-bonds formed within the carbonyl backbone and its flexible side chains. The best interaction observed by docking studies of NB-DNJ was with GT4 p7 residues Gly34, His31 (2), and Trp30 (2). Comparing both p7 genotype models, only amantadine extended one H-bond interaction with p7 ion channel at Thr27 in GT3 and at Gly34 in GT4 (Fig 6a & 6b). These docking results indicate that both the C-terminal and N-terminal side regions of p7 contain potential drug interacting sites (Table 7). The known antiviral drugs such as amantadine may have less binding affinity compared to BIT225 and NB-DNJ, however, the difference is not very significant in both HCV p7 GT3 and GT4. Leon et al have also reported that amantadine exhibits weaker binding energies due to its interactions with the loop regions of the p7 protein of HCV GT1a [62]. Based on the interaction energy and residues forming H-bonds, the compounds were ranked in the following descending order with respect to predicted effectiveness of binding NB-DNJ > BIT225 > amantadine > hexamethylene chloride. The docking experiment conducted by in silico method is shown in S1 and S2 Video files.

Fig 6. Computational docking study of GT3 p7 model and selected drugsMolecular binding of a set of selected ligands against GT3 p7 model (a) Amantadine, (b) BIT225, (c) Hexamethylene chloride, and (d) N-butyl-deoxynojirimycin.

Fig 6

The Hydrogen bonds have been shown as blue dashed lines. Molecular interactions of GT4 p7 model (shown as green ribbon) with different ligands such as (a) Amantadine, (b) BIT225, (c) Hexamethylene chloride, and (d) N-butyl-deoxynojirimycin. Hydrogen bonds have been shown as blue dashed lines.

Table 7. Molecular docking study between selected drugs along with both model of p7 GT3 and p7 GT4 and their intermolecular docking values presented with their interaction energy, HBond energy, docking score, number of interactions and the interacting residues.
P7 Domain Derivative Name Interacti on Energy (kcal/mol) HBond Energy (kcal/mol) Docking Score (kcal/mol) Interactions Protein Interactions
HCV-p7 GT3 Amantadine -32.09 -2.4965 -35.963 1 Thr27
Hexamethylenee chloride -45.80 -2.4628 -68.981 0 -
BIT225 -38.38 -4.1862 -43.737 5 Leu8(2),His17,Thr27(2)
NB-DNJ -28.74 -6.7858 -57.711 8 Leu45(2),Ser44(2),Lys33(2),Val32,His31
HCV-p7 GT4 Amantadine -32.51 -2.5501 -23.413 1 Gly34
Hexamethylenee chloride -40.13 -2.9394 -65.746 0 -
BIT225 -30.47 -6.2556 -47.140 1 Trp30
NB-DNJ -28.708 -8.0267 -63.972 5 Gly34,His31(2),Trp30(2)

Possible binding sites for flavonoids compounds

Using both the p7 ion channel models from GT3 and GT4, we show the interactions of both flavonoids and phenols involved in inhibition. Two main factors are critical to the success of a ligand-protein docking study. First, the energy function of binding to the proteins and second, the number of hydrogen bonds formed in the binding mode. In the GT3 p7 model, EGCG had the lowest binding energy due to binding interactions with Ser44 (2), Leu45 (2), Gly46, Val32, and Lys33 (2), forming as many as 8 H-bonds. It is, however, worth mentioning that EGCG has no effects on HCV RNA replication and on assembly or release of progeny virions [63, 64]. Therefore, this strong binding of EGCG may be assumed to inhibit the cell to cell spread of the virus to block the ion channeling process of p7 protein thereby disrupting the initial step of HCV cell entry [64]. The quercetin formed 5 H-bonds with Trp21, Val32, Leu45 (2), and Ser44 (Table 8). Luteolin and silymarin both formed four H-bonds. Only apigenin and luteolin interacted with the residues in the N-terminal site of GT3 p7, forming H-bonds with protein residues Ala10 and Gly18. Ladanein and naringenin exhibited high binding energy values and few interactions with the modeled HCV p7 protein. In analyzing the energy values of the HCV GT4 p7 model, the binding conformation score was much higher compared to that of the HCV GT3 p7 model. However, the number of interactions formed by natural molecules with HCV GT3 p7 model is significantly higher than the binding modes of drug interactions with HCV GT4 (Fig 7a and 7b). Most of the interactions formed by natural molecules targeted binding in the loop region which is essential for the mechanism and function of HCV p7.

Table 8. Selected bioactive flavonoids and their docking score along with the number of HBond formation with modeled p7 ion channel from both genotypes as obtained from molecular docking using CLC drug discovery analysis.
FlavonoidCompounds HCV p7 GT 3 HCV p7 GT4
Docking Score(kcal/mol) No of H bonds Interacting proteins Docking Score(kcal/mol) No of H bonds Interacting proteins
Apigenin -48.23 3 Ala10, Gly18, Trp30 -58.35 1 Trp30
EGCG -25.36 8 Ser44(2), Leu45(2), Gly46, Val32, Lys33(2) -49.36 2 His31,Trp30
Ladanein -60.25 1 Thr27 -70.82 1 Trp30
Luteolin -35.26 4 Ala10, Gly18, Trp(30) -37.36 2 Trp30,His31
Naringenin -58.62 2 Leu28, Thr27 -52.41 1 Trp30
Quercetin -35.56 5 Trp21, Val32, Leu45(2), Ser44 -45.81 3 Trp30,His31,Gly34
Silymarin -38.26 4 Thr27(2), Val32, Leu45(2) -50.04 1 Thr2
Fig 7. In silico docking study of p7 model of GT3 and GT4 with flavonoids.

Fig 7

(A) Snapshots of molecular interactions of GT3 p7 model with different flavonoids such as (a) Epigallocatechin-3-gallate, (b) Apigenin, (c) Naringenin, (d) Luteolin, (e) Quercetin, (f) Ladanein, and (g) Silymarin. Hydrogen bonds have been shown as blue dashed lines.(B) Flavonoid interactions with the GT4 p7 model (shown as green ribbon). (a) Apigenin, (b) Epigallocatechin-3-gallate, (c) Ladanein, (d) Luteolin, (e) Naringenin, (f) Quercetin, and (g) Silymarin. Hydrogen bonds have been shown as blue dashed lines.

Possible binding sites for Phenol compounds

To analyze the reliability of interaction mode by looking at the energy function score with phenolic compounds within the HCV GT3 p7, the docking score is lower for honokiol which formed 3 HBonds with Leu45, Ser44 (2) and Trp30 (2) (shown in Table 9), whereas nobiletin formed a higher docking score of -48.32 kcal/mol forming interactions with Leu45 (2), Trp30 and Ser44 (2). No interaction was observed at the N- and C-terminal regions of the GT3 p7 and GT4 p7 models in case of phenol compounds. Notably, in HCV GT4 p7, a decrease in the binding energy values with very few HBond interactions was observed (Fig 8a and 8b).

Table 9. Phenol compounds and their interactions with modeled p7 proteins from both genotypes as obtained from molecular docking studies.
PhenolCompounds HCV p7 GT3 HCV p7 GT4
Docking Score(kcal/mol) No of H bonds Interacting proteins Docking Score(kcal/mol) No of H bonds Interacting proteins
HonokiolNobelitin -36.25 3 Leu45,Ser44(2),Trp30(2) -73.84 0 -
-48.32 5 Leu45(2),Trp30,Ser44(2) -60.31 1 His31
Fig 8. Analyzing docking interaction of p7 model between GT3 and GT4 with phenol compounds.

Fig 8

(A) Molecular interaction of GT3 p7 model with phenolic compounds (a) Honokiol and its methoxy derivative (b) Nobiletin. Hydrogen bonds have been shown as blue dashed lines. (B) Interaction of GT4 p7 model (shown as green ribbon) with phenolic compounds (a) Honokiol (b) Nobiletin. Hydrogen bonds have been shown as blue dashed lines.

Current p7-based antiviral strategies

p7 plays a vital role in viral assembly and discharge of mature viral particles and is, thus, highly conserved across HCV genotypes, making p7 an excellent potential latent antiviral drug target. Amantadine, long alkyl chain immunosugar derivatives, and hexamethylene amiloride have been established as channel-blocking compounds and it is shown that the p7 protein interacts with the non-structural protein 2 of the HCV present at the endoplasmic reticulum; this interface is crucial for the infectivity of the virus [65]. Some p7 inhibitors exhibiting antiviral activity in cell culture have been reported, largely from various experiments studied with viroporins from various other viruses. These inhibitors include amantadine, known to inhibit the influenza A virus M2 channel [66–69], hexamethylene amiloride, known to inhibit HIV-1 vpu ion channel [66], and long-alkyl-chain iminosugar derivatives [37].

Amantadine

Amantadine is chemically known as 1-adamantanamine hydrochloride which has a dual pharmacological action of treating viral and Parkinson disease. Its mechanism of action is mainly to inhibit the release of viral DNA into the host cells by interacting with the function of transmembrane domain of M2 protein. With respect to high prevalence rate of drug-resistant virus, the consumption of amantadine derivative like rimantidine for treating prophylaxis is not proposed in the country like USA [70]. Smith and co-workers studied the effectiveness of the treatment using amantadine in patients affected with HCV who were earlier known to have been failed to respond with the interferon therapy [71]. However, studies have failed to approve the positive effect of both the interferon therapy as well as with IFN-α/ribavirin [72, 73]. There is still a hopes for amantadine as it was observed to inhibits p7 function in artificial membranes [39] as well as in cell-based assay, that it in turn inhibit activity of viral hepatitis [74]. Griffin et al. validated various p7 inhibitor molecules against both HCV cell lines and in vitro assay in a parallel approach. They identified inhibition of viral entry and few compounds denoted antiviral activity specific to block the function of p7 ion channel [75].

Amiloride

Amiloride categorized itself in guanidium group of compounds containing pyrazine derivative. It functions by blocking the sodium channel present in the epithelial tissue thereby rendering sodium reabsorption in kidney, resulting in depletion of sodium from the body without losing potassium. The Vpu-protein of HIV-1 is similar to p7 forms cation channels in vitro and improves the budding thereby releasing virus infectious particles [76]. Ewart et al. and team discussed about the HIV-1 vpu-protein has similar property to p7 which releases viral particles during budding and the study validated that the derivatives of amiloride retard the activity of ion channel resulting in budding triggered by HIV-1 Vpu [66]. Recently hexamethylene amiloride, a derivative of amiloride is known for its inhibition activity against p7 ion channel [31]. The study of cell toxicity with varying drug concentrations is required in cell culture, to attain p7 inhibition precludes a strong decision regarding the inhibitory influence of amiloride on infectious virus particle synthesized from tissue culture system [75].

Iminosugars derivatives

Iminosugars deoxynojirimycin (DNJ) are monosaccharide sugar molecules in which the oxygen ring substituted by a nitrogen atom [77]. Glucose-derivatives (DNJ), such as N-nonyl-DNJ, and N-butyl-DNJ are effective inhibitors against ER α-glucosidases both I and II when experimented in HCV surrogate model [78]. The α-glucosidases are well-known to eliminate glucose molecules from the N-linked glycans present in high manose bonded and hence this processing step is vital for the further interaction between both ER chaperones and the glycoproteins [79]. Thus, compounds comprising of a DNJ header group along with long alkyl side chain are known to have dual roles inhibiting the activity of ER α-glucosidases and becoming a barrier for p7 channel function. Due to non-responders to IFN-α-based therapy, a new derived compound called NN-DNJ (UT-231B) has entered the clinical phase II study but the antiviral efficacy is not yet confirmed [80].

BIT225

A latest experimental drug developed from Biotron Limited for treating both HCV and HIV infection [81]. Moreover, BIT225 was capable to block the Vpu ion channel function by disrupting the HIV assembly with the host white blood cells. It also expressed antiviral synergy with NS5B polymerase inhibitors, ribavirin and IFN-α. The drug has been credited targeting p7 ion channel activity and has efficiently accomplished a phase Ia, in healthy volunteers with single dose trial and phase Ib to assess the pharmacokinetics of frequent medication for certain doses in HCV affected patients [81].

Conclusions

In our study, the three dimensional structure of the p7 ion channel was modeled by using precise computational tools. The p7 ion channel protein from HCV was modeled in the absence of any complete p7 structure and hence high-resolution template structure was used. Studies have reported regarding various drug binding site that stabilize the closed p7 channels through an allosteric mechanism as proposed in controversial studies of IAV M2 [82–84]. It is still assumed that the p7 folds is characterized as a hairpin as it still remains indistinct regarding rearrangements of the protein structure between the monomer and hexamer forms [80, 82]. Fascinatingly, an amiloride-based GT1a p7 inhibitor and BIT225 [80], is presently under clinical trials combined with ribavirin and interferon. We conclude the depth of the number of residues binding modes and the native binding energy is obscured with the change in the protein structure of the two genotypes. In this work, molecular docking has been performed with 10 naturally occurring plant extracts and four known drugs to inhibit p7 activity. The loop region of the p7 has been found to harbor residues necessary for the mechanism of function of p7. It is also hypothesized that binding of the ligand molecules in the loop region inactivates essential dynamics required for the protein. Drugs have variable levels of interactions from GT to GT. Antiviral drugs, whose effectiveness is limited to GT1 may not be as effective in GT3 and GT4. Currently, there is no one-size-fits-all treatment available. Sequence variation in genotype validates and determines the specificity from GT to GT as well as from sequence to sequence. In light of our reported data set, our present in silico study supports the sequence variation which determines the drug interaction and enhances the benefit of multiple DAA combinations.

Perspectives on the Future Directions

This computational study will show an impulse to start broader screening for small natural molecules as HCV p7 inhibitors. The key molecules screened and analyzed in this study should be a promising starter for large scale screening from the list of large number of chemical compounds available from the Ligand info meta database by using the latest virtual screening methods. Current advancement in understanding the molecular basis for p7 function might also shoot interest in designing and developing compounds that can target key residues. Continuous research and recent advances in the field of science will hopefully pay result in the discovery of more natural compounds for use in the laboratory and clinical trials with lesser side effects. Deeper biochemical knowledge of the complex p7 nature will in due course help to describe the molecular mechanisms of ion channel and its folding which can be a vital to achieve an efficient drug against human and animal virus particles. In summary, we aligned the entire p7 structure from all genotypes available, modeled the p7 protein from GT3 (Asia) and GT4 (Middle East) and compared its docking interaction with both known inhibitors as well natural compounds that are known to have antiviral properties. This study will build a way to research in depth the molecular mechanism of interactions of p7, of other HCV genotypes and support for screening more specific natural inhibitors from available chemical and biological medicinal plant extracts.

Supporting Information

S1 Dataset. Genotype sequence and multiple alignment.

(DOC)

S1 Video. In silico docking study of p7GT3.

(MP4)

S2 Video. Computational docking study of p7GT4.

(MP4)

Acknowledgments

We are thankful to Bharathidasan University (Tiruchirappalli, India) and King Fahd Medical Research Center (King Abdul Aziz University, Jeddah, Saudi Arabia) for providing the facilities respectively. We are also thankful to Ashraf Ali and Mohamed Suhail for their support. We also thank Shiny Mathew in various software installations and optimizing the use of the application.

Data Availability

All relevant data are within the paper and its Supporting Information files.

Funding Statement

Financial support of this work was provided by the King Abdulaziz City for Science and Technology, (KACST)-Large grant 162-34, to Ishtiaq Qadri.

References

  • 1. Hoofnagle JH. Course and outcome of hepatitis C. Hepatology. 2002;36(S21–S29). [DOI] [PubMed] [Google Scholar]
  • 2. Seeff LB. Natural history of chronic hepatitis C. Hepatology. 2002;36(S35-S46). [DOI] [PubMed] [Google Scholar]
  • 3. Simmonds PBJ, Combet C, Deléage G, Enomoto N, Feinstone S, Halfon P, et al. Consensus proposals for a unified system of nomenclature of hepatitis C virus genotypes. Hepatology. 2005;42(4)962–73. [DOI] [PubMed] [Google Scholar]
  • 4. Gottwein JM, Bukh J. Cutting the gordian knot-development and biological relevance of hepatitis C virus cell culture systems. Adv Virus Res. 2008;7151–133. Epub 2008/07/01. 10.1016/S0065-3527(08)00002-X . [DOI] [PubMed] [Google Scholar]
  • 5.Available: http://www.who.int/inf-fs/en/fact164.html.
  • 6. Mondelli MU, Silini E. Clinical significance of hepatitis C virus genotypes. J Hepatol. 1999;31 Suppl 165–70. Epub 2000/01/06. . [DOI] [PubMed] [Google Scholar]
  • 7. M H. Hepatitis C viruses. 3rd ed Fields BN KD, Howley PM, editor. Philadelphia Lippincott—Raven; 1996. [Google Scholar]
  • 8. Recommendations for Prevention and Control of Hepatitis C Virus (HCV) Infection and HCV-Related Chronic Disease. Centers for Disease Control and Prevention, 1998. [PubMed] [Google Scholar]
  • 9. Antaki N C A, Kamal S, Moucari R, Van der Merwe S, Haffar S, Gadano A, et al. The neglected hepatitis C virus genotypes 4, 5 and 6 an international consensus report. Liver Int. 2010;30(3)342–55. 10.1111/j.1478-3231.2009.02188.x [DOI] [PubMed] [Google Scholar]
  • 10. Manns MP, Wedemeyer H., and Cornberg M.. Treating viral hepatitis C efficacy, side effects, and complications. Gut. 2006;551350–9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11. Cooper C, Lester R, Thorlund K, Druyts E, El Khoury AC, Yaya S, et al. Direct-acting antiviral therapies for hepatitis C genotype 1 infection a multiple treatment comparison meta-analysis. QJM. 2013;106(2)153–63. Epub 2012/11/20. 10.1093/qjmed/hcs214 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12. Conteduca V, Sansonno D, Russi S, Pavone F, Dammacco F. Therapy of chronic hepatitis C virus infection in the era of direct-acting and host-targeting antiviral agents. J Infect. 2014;68(1)1–20. Epub 2013/09/10. 10.1016/j.jinf.2013.08.019 . [DOI] [PubMed] [Google Scholar]
  • 13. Pawlotsky SCaJM. HCV Genome and Life Cycle. SL T, editor. Norfolk (UK) Horizon Bioscience; 2006. [PubMed] [Google Scholar]
  • 14. Atoom AM, Taylor NG, Russell RS. The elusive function of the hepatitis C virus p7 protein. Virology. 2014;462–463377-87. Epub 2014/07/09. 10.1016/j.virol.2014.04.018 . [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15. Nieva JLM, V.Carrasco L. Viroporins structure and biological functions. Nat Rev Microbiol. 2012;10(8)563–74. Epub 2012/07/04. 10.1038/nrmicro2820 . [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16. OuYang BX, S. Berardi M. Zhao J., Dev X., Yu J., Sun W., Chou B., J. J. Unusual architecture of the p7 channel from hepatitis C virus. Nature. 2013;498(7455)521–5. Epub 2013/06/07. 10.1038/nature12283 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17. Patargias G, Zitzmann N, Dwek R, Fischer WB. Protein-protein interactions modeling the hepatitis C virus ion channel p7. J Med Chem. 2006;49(2)648–55. Epub 2006/01/20. 10.1021/jm050721e . [DOI] [PubMed] [Google Scholar]
  • 18. Wang YT, Hsu HJ, Fischer WB. Computational modeling of the p7 monomer from HCV and its interaction with small molecule drugs. Springerplus. 2013;2324 Epub 2013/08/21. 10.1186/2193-1801-2-324 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19. Hao Zhang JZ, Guangyun Yu, Ming Jiang, and Peixun Liu. A Combination of 3D-QSAR, Molecular Docking and Molecular Dynamics Simulation Studies of Benzimidazole-Quinolinone Derivatives as iNOS Inhibitors. Int J Mol Sci. 2012;13(9)11210–27. 10.3390/ijms130911210 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20. Rapoport TA GV, Heinrich SU, Matlack KE. Memrbane-protein integration and the role of the translocon channe. Trends Cell Bio. 2004;14568–75. [DOI] [PubMed] [Google Scholar]
  • 21. Cheng Z GR. Slow translocon gating causes cytosolic exposure of transmembrane and lumenal domains during membrane protein integration. Nature Struc Biol. 2006;13930–6. [DOI] [PubMed] [Google Scholar]
  • 22. Johnson AE v WM. The translocon a dynamic gateway at the ER membrane. Annu Rev Cell Dev Biol. 1999;15799–842. [DOI] [PubMed] [Google Scholar]
  • 23. Hessa TKH, Bihlmaier K, Lundin C, Boekel J, Andersson H, Nilsson I, et al. Recognition of transmembrane helices by the endoplasmic reticulum translocon. Nature Struc Biol. 2005;433377–81. [DOI] [PubMed] [Google Scholar]
  • 24. G VH. Transcending the impenetrable how proteins come to terms with membranes. Biochim Biophys Acta. 1988;947307–33. [DOI] [PubMed] [Google Scholar]
  • 25. Fink A S-MN, Gerber D, Shai Y. Transmembrane domains interactions within the membrane milieu principles, advances and challenges. Biochim Biophys Acta. 2012;1818974–83. [DOI] [PubMed] [Google Scholar]
  • 26. Krüger JFW. Assembly of viral membrane proteins. J Chem Theory Comput. 2009;52503–13. [DOI] [PubMed] [Google Scholar]
  • 27. Hsu H-J F W. In silico investigations of possible routes of assembly of ORF 3a from SARS-CoV. J Mol Mod. 2011;18501–14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28. Gentzsch JBC, Steinmann E, Friesland M, Menzel N, Vieyres G, Perin PM, Frentzen A, Kaderali L, Pietschmann T. Hepatitis C Virus p7 is Critical for Capsid Assembly and Envelopment. PLoS Pathog. 2013;9(5). Epub Epub 2013 May 2. 10.1371/journal.ppat.1003355 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29. Steinmann E, Whitfield T, Kallis S, Dwek RA, Zitzmann N, Pietschmann T, et al. Antiviral effects of amantadine and iminosugar derivatives against hepatitis C virus. Hepatology. 2007;46(2)330–8. Epub 2007/06/30. 10.1002/hep.21686 . [DOI] [PubMed] [Google Scholar]
  • 30. Vieyres G, Brohm C, Friesland M, Gentzsch J, Wolk B, Roingeard P, et al. Subcellular localization and function of an epitope-tagged p7 viroporin in hepatitis C virus-producing cells. J Virol. 2013;87(3)1664–78. Epub 2012/11/24. 10.1128/JVI.02782-12 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31. Premkumar A W L, Ewart GD, Gage PW. Cation-selective ion channels formed by p7 of hepatitis C virus are blocked by hexamethylene amiloride. FEBS Lett. 2004;557(1–3)99–103. Epub 2004/01/27. . [DOI] [PubMed] [Google Scholar]
  • 32. Wozniak AL, Griffin S, Rowlands D, Harris M, Yi M, Lemon SM, et al. Intracellular proton conductance of the hepatitis C virus p7 protein and its contribution to infectious virus production. PLoS Pathog. 2010;6(9)e1001087 Epub 2010/09/09. 10.1371/journal.ppat.1001087 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33. Saldanha JW, Czabotar PE, Hay AJ, Taylor WR. A model for the cytoplasmic domain of the influenza A virus M2 channel by analogy to the HIV-1 Vpu protein. Protein Pept Lett. 2002;9(6)495–502. Epub 2003/01/30. . [DOI] [PubMed] [Google Scholar]
  • 34. Sakai A C M, Faulk K, Govindarajan S, Emerson SU, Purcell RH, Bukh J. The p7 polypeptide of hepatitis C virus is critical for infectivity and contains functionally important genotype-specific sequences. Proc Natl Acad Sci U S A. 2003;10011646–51. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35. Rosenberg MR, Casarotto MG. Coexistence of two adamantane binding sites in the influenza A M2 ion channel. Proc Natl Acad Sci U S A. 2010;107(31)13866–71. Epub 2010/07/21. 10.1073/pnas.1002051107 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36. Shimbo K, Brassard DL, Lamb RA, Pinto LH. Ion selectivity and activation of the M2 ion channel of influenza virus. Biophys J. 1996;70(3)1335–46. Epub 1996/03/01. 10.1016/S0006-3495(96)79690-X [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37. Pavlovic D DCAN, Olivier Argaud, Blumberg Baruch, Dwek Raymond A., Wolfgang B. Fischer, and Zitzmann Nicole. The hepatitis C virus p7 protein forms an ion channel that is inhibited by long-alkylchain iminosugar derivatives. Proc Natl Acad Sci U S A. 2003;1006104–8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38. Montserret R, Saint N, Vanbelle C, Salvay AG, Simorre JP, Ebel C, et al. NMR structure and ion channel activity of the p7 protein from hepatitis C virus. J Biol Chem. 2010;285(41)31446–61. Epub 2010/07/30. 10.1074/jbc.M110.122895 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39. Griffin SD BL, Clarke DS, Worsfold O, Evans SD, Jaeger J, Harris MP, Rowlands DJ. The p7 protein of hepatitis C virus forms an ion channel that is blocked by the antiviral drug, Amantadine. FEBS Lett. 2003;53534–8. [DOI] [PubMed] [Google Scholar]
  • 40. Popescu CI, Callens N, Trinel D, Roingeard P, Moradpour D, Descamps V, et al. NS2 protein of hepatitis C virus interacts with structural and non-structural proteins towards virus assembly. PLoS Pathog. 2011;7(2)e1001278 Epub 2011/02/25. 10.1371/journal.ppat.1001278 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41. Simossis V.KJaHJ A. Homology-extended alignment strategy. Nucleic Acid Res. 2005;33(3)816–24. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42. Pirovano W. FKAaHJ. Transmembrane structure integration. Bioinformatics. 2008;24(4)492–7. 10.1093/bioinformatics/btm636 [DOI] [PubMed] [Google Scholar]
  • 43. J. H. Original alignment method. Computers and Chemistry. 1999;23341–64. [Google Scholar]
  • 44. J. H. Iterated profile scoring scheme. Curr Protein Pept Sci. 2000;1(3)816–24. [Google Scholar]
  • 45. J. H. Iterated profile scoring scheme. Comput Chem. 2002;26(5)459–77. [DOI] [PubMed] [Google Scholar]
  • 46. Dereeper A, Guignon V, Blanc G, Audic S, Buffet S, Chevenet F, et al. Phylogeny.fr robust phylogenetic analysis for the non-specialist. Nucleic Acids Res. 2008;36(Web Server issue)W465–9. Epub 2008/04/22. 10.1093/nar/gkn180 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47. Apweiler R B Aa. Nucleic Acids Res. 1999;2749–54. [Google Scholar]
  • 48. Yamada N, Tanihara K, Mizokami M, Ohba K, Takada A, Tsutsumi M, et al. Full-length sequence of the genome of hepatitis C virus type 3a comparative study with different genotypes. J Gen Virol. 1994;75 (Pt 11)3279–84. Epub 1994/11/01. . [DOI] [PubMed] [Google Scholar]
  • 49. Chamberlain RW, Adams N, Saeed AA, Simmonds P, Elliott RM. Complete nucleotide sequence of a type 4 hepatitis C virus variant, the predominant genotype in the Middle East. J Gen Virol. 1997;78 (Pt 6)1341–7. Epub 1997/06/01. . [DOI] [PubMed] [Google Scholar]
  • 50. Henikoff S, Henikoff JG. Amino acid substitution matrices from protein blocks. Proc Natl Acad Sci U S A. 1992;89(22)10915–9. Epub 1992/11/15. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51. Communie G, Crepin T, Maurin D, Jensen MR, Blackledge M, Ruigrok RW. Structure of the tetramerization domain of measles virus phosphoprotein. J Virol. 2013;87(12)7166–9. Epub 2013/04/12. 10.1128/JVI.00487-13 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52. Xu D, Zhang Y. Improving the physical realism and structural accuracy of protein models by a two-step atomic-level energy minimization. Biophys J. 2011;101(10)2525–34. Epub 2011/11/22. 10.1016/j.bpj.2011.10.024 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53. Laskowski R A MMW, Moss D S, Thornton J M PROCHECK—a program to check the stereochemical quality of protein structures. J App Cryst. 1993;26283–91. [Google Scholar]
  • 54. Maiti R, Van Domselaar GH, Zhang H, Wishart DS. SuperPose a simple server for sophisticated structural superposition. Nucleic Acids Res. 2004;32(Web Server issue)W590–4. Epub 2004/06/25. 10.1093/nar/gkh477 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Available: https//pubchem.ncbi.nlm.nih.gov/search/search.cgi.
  • 56.Available: http//mmtsb.scripps.edu/webservices/sbmdpotential.html.
  • 57.Available: http://www.vega-qsar.eu/.
  • 58.Available: http://www.clcbio.com/products/clc-drug-discovery-workbench/.
  • 59. Korb O, Stutzle T, Exner TE. Empirical scoring functions for advanced protein-ligand docking with PLANTS. J Chem Inf Model. 2009;49(1)84–96. Epub 2009/01/08. 10.1021/ci800298z . [DOI] [PubMed] [Google Scholar]
  • 60.Available: http://www.clcbio.com/products/clc-sequence-viewer/.
  • 61. Prabal K. Maiti TAP, Nagarajan Vaidehi, and William A. Goddard. The stability of Seeman JX DNA topoisomers of paranemic crossover (PX) molecules as a function of crossover number. Nucleic Acids Res 2004;32(20)6047–56. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62. Bichmann L, Wang YT, Fischer WB. Docking assay of small molecule antivirals to p7 of HCV. Comput Biol Chem. 2014;53PB308–17. Epub 2014/12/03. 10.1016/j.compbiolchem.2014.11.001 . [DOI] [PubMed] [Google Scholar]
  • 63. Calland N AA, Belouzard S, Wychowski C, Duverlie G, Descamps V, Hober D, Dubuisson J, Rouillé Y, Séron K. (−)-Epigallocatechin-3-gallate is a new inhibitor of hepatitis C virus entry. Hepatology. 2012;55720–9. [DOI] [PubMed] [Google Scholar]
  • 64. Ciesek S vHT, Colpitts CC, Schang LM, Friesland M, Steinmann J, Manns MP, Ott M, Wedemeyer H, Meuleman P, Pietschmann T, Steinmann E. The green tea polyphenol, epigallocatechin-3-gallate, inhibits hepatitis C virus entry. Hepatology. 2011;54(6)1947–55. Epub 2011/08/13. 10.1002/hep.24610 . [DOI] [PubMed] [Google Scholar]
  • 65. Gabriel A. Cook LAD, Tian Ye, and Stanley J. Opella. The Three Dimensional Structure and Interaction Studies of HCV p7 in DHPC by Solution NMR. Biochemistry. 2013;52(31). 10.1021/bi4005655 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66. Ewart GD, Mills K, Cox GB, Gage PW. Amiloride derivatives block ion channel activity and enhancement of virus-like particle budding caused by HIV-1 protein Vpu. Eur Biophys J. 2002;31(1)26–35 Epub 2002/06/06. . [DOI] [PubMed] [Google Scholar]
  • 67. Mould JA, Drury JE, Frings SM, Kaupp UB, Pekosz A, Lamb RA, et al. Permeation and activation of the M2 ion channel of influenza A virus. J Biol Chem. 2000;275(40)31038–50. Epub 2000/07/27. 10.1074/jbc.M003663200 . [DOI] [PubMed] [Google Scholar]
  • 68. Tosteson MT, Pinto LH, Holsinger LJ, Lamb RA. Reconstitution of the influenza virus M2 ion channel in lipid bilayers. J Membr Biol. 1994;142(1)117–26. Epub 1994/10/01. . [DOI] [PubMed] [Google Scholar]
  • 69. Pinto LH, Lamb RA. Understanding the mechanism of action of the anti-influenza virus drug amantadine. Trends Microbiol. 1995;3(7)271 Epub 1995/07/01. . [DOI] [PubMed] [Google Scholar]
  • 70. Smith JP. Treatment of chronic hepatitis C with amantadine. Dig Dis Sci. 1997;42(8)1681–7. Epub 1997/08/01. . [DOI] [PubMed] [Google Scholar]
  • 71. Van Soest H VdS, Koek GH,De Vries RA, Van Ooteghem NA, Van Hoek B, Drenth JP, Vrolijk JM, Lieverse RJ, Houben P, Van der Sluys Veer A, Siersema PD, Schipper ME, Van Erpecum KJ, Boland GJ. No beneficial effects of amantadine in treatment of chronic hepatitis C patients. Dig Liver Dis. 2009;42496–502. [DOI] [PubMed] [Google Scholar]
  • 72. Griffin SD H R, Clarke DS, Barclay WS, Harris M, Rowlands DJ. A conserved basic loop in hepatitis C virus p7 protein is required for amantadine-sensitive ion channel activity in mammalian cells but is dispensable for localization to mitochondria. J Gen Virol. 2004;85451–61. [DOI] [PubMed] [Google Scholar]
  • 73. Von Wagner M H W, Teuber G, Berg T, Goeser T, Spengler U, Hinrichsen H, Weidenbach H, Gerken G, Manns M, Buggisch P, Herrmann E, Zeuzem S. Placebo-controlled trial of 400 mg amantadine combined with peginterferon alfa-2a and ribavirin for 48 weeks in chronic hepatitis C virus-1 infection. Hepatology. 2008;481404–11. [DOI] [PubMed] [Google Scholar]
  • 74. Griffin S S C, Owsianka AM, Patel AH, Rowlands D, Harris M. Genotype-dependent sensitivity of hepatitis C virus to inhibitors of the p7 ion channel. Hepatology. 2008;481779–90. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75. Ewart GD, Sutherland T, Gage PW, Cox GB. The Vpu protein of human immunodeficiency virus type 1 forms cation-selective ion channels. J Virol. 1996;70(10)7108–15. Epub 1996/10/01. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76. Dwek RA B T, Platt FM, Zitzmann N. Targeting glycosylation as a therapeutic approach. Nat Rev Drug Discov. 2002;1 65–75. [DOI] [PubMed] [Google Scholar]
  • 77. Durantel DB-N, N. Carrouee-Durantel S. Butters T. D. Dwek R. A. Zitzmann N. Study of the mechanism of antiviral action of iminosugar derivatives against bovine viral diarrhea virus. J Virol. 2001;75(19)8987–98. Epub 2001/09/05. 10.1128/JVI.75.19.8987-8998.2001 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 78. Helenius A, Aebi M. Roles of N-linked glycans in the endoplasmic reticulum. Annu Rev Biochem. 2004;731019–49. Epub 2004/06/11. 10.1146/annurev.biochem.73.011303.073752 . [DOI] [PubMed] [Google Scholar]
  • 79. Pawlotsky JM C S, McHutchison JG. The hepatitis C virus life cycle as a target for new antiviral therapies. Gastroenterology. 2007;1321979–98. [DOI] [PubMed] [Google Scholar]
  • 80. Luscombe CA H Z, Murray MG, Miller M, Wilkinson J, Ewart GD. A novel hepatitis C virus p7 ion channel inhibitor, BIT225, inhibits bovine viral diarrhea virus in vitro and shows synergism with recombinant interferon-alpha-2b and nucleoside analogues. Antiviral Res. 2010;86144–53. [DOI] [PubMed] [Google Scholar]
  • 81. Toshana L.Foster GST, Kalverda Arnout P., Jayakanth Kankanala, Matthew Bentham, Wetherill Laura F., Joseph Thompson, Barker Amy M., Dean Clarke, Marko Noerenberg, Pearson Arwen R., Rowlands David J., Homans Steven W., Mark Harris, Richard Foster and Stephen Griffin. Structure-guided design affirms inhibitors of hepatitis C virus p7 as a viable class of antivirals targeting virion release. Viral Hepatitis. 2013;59(2). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 82. Pielak RM S J, Chou JJ. Mechanism of drug inhibition and drug resistance of influenza A M2 channel. Proc Natl Acad Sci U S A. 2009;1067379–84. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 83. Schnell JR C J. Structure and mechansim of the M2 proton channel of influenza A virus. Nature Struc Biol. 2008. 451591–5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 84. Tedbury P W S, Pause A, King B, Griffin S, Harris M. The subcellular localization of the hepatitis C virus non-structural protein NS2 is regulated by an ion channel-independent function of the p7 protein. J Gen Virol. 2011;92(819–830). 10.1099/vir.0.027441-0 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 85. Lemaitre V A R, Kim CG, Watts A, Fischer WB. Interaction of amiloride and one of its derivatives with Vpu from HIV-1 A molecular dynamics simulation. FEBS Lett. 2004;56375–81. [DOI] [PubMed] [Google Scholar]
  • 86. Liu MM Z L, He PL, Zhang YN, Zhou JY, Shen Q, Chen XW, Zuo JP, Li W, Ye DY. Discovery of flavonoid derivatives as anti-HCV agents via pharmacophore search combining molecular docking strategy. Eur J Med Chem. 2012;5233–43. [DOI] [PubMed] [Google Scholar]
  • 87. Calland N. AA, Belouzard S., Wychowski C., Duverlie G., Descamps V., Hober D., Dubuisson J., Rouillé Y., Séron K. (-)-Epigallocatechin-3-gallate is a new inhibitor of hepatitis C virus entry. Hepatology. 2012;55720–9. 10.1002/hep.24803 [DOI] [PubMed] [Google Scholar]
  • 88. Haid S N A, Gentzsch J, Grethe C, Geuenich S, Bankwitz D, Chhatwal P, Jannack B, Hennebelle T, Bailleul F, Keppler OT, Poenisch M, Bartenschlager R, Hernandez C, Lemasson M, Rosenberg AR, Wong-Staal F, Davioud-Charvet E, Pietschmann T. A plant-derived flavonoid inhibits entry of all HCV genotypes into human hepatocytes. Gastroenterology. 2012;143213–22. [DOI] [PubMed] [Google Scholar]
  • 89. Goldwasser J C P, Lin W, Kitsberg D, Balaguer P, Polyak SJ, Chung RT, Yarmush ML, Nahmias Y. Naringenin inhibits the assembly and long-term production of infectious hepatitis C virus particles through a PPAR-mediated mechanism. J Hepatol. 2011;55963–71. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 90. Nahmias Y G J, Casali M, van Poll D, Wakita T, Chung RT, Yarmush ML. Apolipoprotein B-dependent hepatitis C virus secretion is inhibited by the grapefruit flavonoid naringenin. Hepatology. 2008;471437–45. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 91. Gonzalez OF, Raychaudhuri V., Loo S., Loo R., Arumugaswami J., Sun V., Dasgupta R., French A., S. W. The heat shock protein inhibitor Quercetin attenuates hepatitis C virus production. Hepatology. 2009;50(6)1756–64. Epub 2009/10/20. 10.1002/hep.23232 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 92. Bachmetov L G-TM, Shapira A, Vorobeychik M, Giterman-Galam T, Sathiyamoorthy P, Golan-Goldhirsh A, Benhar I, Tur-Kaspa R, Zemel R. Suppression of hepatitis C virus by the flavonoid quercetin is mediated by inhibition of NS3 protease activity. J Viral Hepat. 2012;19e81–e8. 10.1111/j.1365-2893.2011.01507.x [DOI] [PubMed] [Google Scholar]
  • 93. Polyak SJ M C, Shuhart MC, Wang CC, Liu Y, Lee DY. Inhibition of T-cell inflammatory cytokines, hepatocyte NF-kappaB signaling, and HCV infection by standardized Silymarin. Gastroenterology. 2007;132(5)1925–36. Epub 2007/05/09. 10.1053/j.gastro.2007.02.038 . [DOI] [PubMed] [Google Scholar]
  • 94. Wagoner J N A, Kane OJ, Martinez LE, Nahmias Y, Bourne N, Owen DM, Grove J, Brimacombe C, McKeating JA, Pécheur EI, Graf TN, Oberlies NH, Lohmann V, Cao F, Tavis JE, Polyak SJ. Multiple effects of silymarin on the hepatitis C virus lifecycle. Hepatology. 2010;51(6)1912–21. Epub 2010/06/01. 10.1002/hep.23587 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 95. Lan KH W Y, Lee WP, Lan KL, Tseng SH, Hung LR, Yen SH, Lin HC, Lee SD. Multiple effects of Honokiol on the life cycle of hepatitis C virus. Liver Int. 2012;32(6)989–97. Epub 2011/11/22. 10.1111/j.1478-3231.2011.02621.x . [DOI] [PubMed] [Google Scholar]
  • 96. Suzuki M S K, Yoshizaki F, Oguchi K, Fujisawa M, Cyong JC. Anti-hepatitis C virus effect of citrus unshiu peel and its active ingredient nobiletin. Am J Chin Med. 2005;33(1)87–94. Epub 2005/04/23. 10.1142/S0192415X05002680 . [DOI] [PubMed] [Google Scholar]
  • 97. Hegde VR P H, Patel M, Das PR, Butkiewicz N, Arreaza G, Gullo VP, Chan TM. Two antiviral compounds from the plant Stylogne cauliflora as inhibitors of HCV NS3 protease. Bioorg Med Chem Lett. 2003;132925–8. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

S1 Dataset. Genotype sequence and multiple alignment.

(DOC)

S1 Video. In silico docking study of p7GT3.

(MP4)

S2 Video. Computational docking study of p7GT4.

(MP4)

Data Availability Statement

All relevant data are within the paper and its Supporting Information files.


Articles from PLoS ONE are provided here courtesy of PLOS

RESOURCES