Lipopolysaccharide Phosphorylation by the WaaY Kinase Affects the Susceptibility of Escherichia coli to the Human Antimicrobial Peptide LL-37

Background: LL-37 is a human antimicrobial peptide that acts by damaging bacterial membranes.

Results: The absence of WaaY kinase decreases E. coli susceptibility to LL-37.

Conclusion: Lipopolysaccharide phosphorylation by WaaY is relevant to LL-37 activity.

Significance: This work provides insight into the first interaction of LL-37 and the bacterial outer membrane.

Abstract

The human cathelicidin LL-37 is a multifunctional host defense peptide with immunomodulatory and antimicrobial roles. It kills bacteria primarily by altering membrane barrier properties, although the exact sequence of events leading to cell lysis has not yet been completely elucidated. Random insertion mutagenesis allowed isolation of Escherichia coli mutants with altered susceptibility to LL-37, pointing to factors potentially relevant to its activity. Among these, inactivation of the waaY gene, encoding a kinase responsible for heptose II phosphorylation in the LPS inner core, leads to a phenotype with decreased susceptibility to LL-37, stemming from a reduced amount of peptide binding to the surface of the cells, and a diminished capacity to lyse membranes. This points to a specific role of the LPS inner core in guiding LL-37 to the surface of Gram-negative bacteria. Although electrostatic interactions are clearly relevant, the susceptibility of the waaY mutant to other cationic helical cathelicidins was unaffected, indicating that particular structural features or LL-37 play a role in this interaction.

Introduction

Antimicrobial peptides (AMPs)³ are evolutionarily ancient components of innate host defense, present in both animals and plants. They often have broad spectrum activity against many pathogenic microorganisms as well as the capacity to modulate the activity of cellular components of the immune system (1, 2). AMPs can be divided into several groups or families according to phylogenetic or structural criteria (3). In mammals, two prevalent families have been recognized: defensins and cathelicidins (4). The former are characterized by compact β-sheet structures stabilized by conserved S–S bridges (5, 6). Cathelicidins instead include a quite heterogeneous group of AMPs having in common a conserved, anionic, cathelin-like N-terminal proregion, whereas the cationic C-terminal antimicrobial domain is highly variable. Furthermore, the number of different cathelicidins present in a single species also varies from only one, as in humans, to over a dozen, as in pigs (7–9).

The only human cathelicidin, hCAP18 (10, 11), is produced by phagocytes, mucosal epithelial cells, and keratinocytes (12). The C-terminal bactericidal portion, LL-37, is a linear, cationic peptide with 37 residues and a net charge of +6 at physiological pH and is released from the precursor by the action of proteinase 3 (13). It is active against both Gram-positive and Gram-negative bacteria and some fungi (14). In addition, it binds lipopolysaccharide (LPS) (11) and protects the host from endotoxic shock by preventing LPS binding to CD14(+) cells, thereby suppressing the production of cytokines by those cells (15). A number of other biological functions have also been attributed to LL-37, ranging from immunomodulatory roles to the stimulation of angiogenesis and epithelial wound healing (16).

The antimicrobial activity of LL-37 is quite medium-dependent, being influenced by the presence of ions, especially anions, which can profoundly modify the structure of the peptide and promote a transition from a disordered form to an α-helical and oligomeric form (17, 18). It also binds, especially in the latter form, to organic components of its biological medium. As with many other helical AMPs, the positive charge of LL-37 promotes the initial interaction with anionic components of the microbial surface, whereas its amphipathic structure favors the subsequent insertion into and permeabilization of the cytoplasmic membrane. The exact mechanism of the cell lysis, however, has not been completely elucidated (19, 20), although it seems that the oligomeric nature of the peptide is relevant (18). In particular, the process by which the peptide migrates across the outer membrane to reach the cytoplasmic membrane and the role of different bacterial components affecting this migration remain largely unknown.

In this study, while searching for bacterial determinants affecting the sensitivity to LL-37, we have identified LPS heptose phosphorylation as a relevant factor. Our findings indicate a specific role of the LPS inner core in the binding of LL-37 to the surface of Gram-negative bacteria.

Experimental Procedures

Bacterial Strains, Media, and Growth Conditions

Bacterial strains used in this study are listed in Table 1. The wild-type strains and their mutants were grown at 37 °C under aerobic conditions in Luria-Bertani (LB) or in Mueller-Hinton (MH) broth. The antimicrobial and flow cytometry assays were performed on mid-log phase cultures. When required, antibiotics were added at the following concentrations: ampicillin (75 μg ml⁻¹), kanamycin (25–50 μg ml⁻¹), and tetracycline (15 μg ml⁻¹).

TABLE 1.

Strains, plasmids, and oligonucleotides used in this study

	Genotypes, characteristics, or sequences	Source
E. coli strains
DH5α	fhuA2 Δ(argF-lacZ)U169 phoA glnV44 Φ80 Δ(lacZ)M15 gyrA96 recA1 relA1 endA1 thi-1 hsdR17	Laboratory stock
HB101	F− leuB6 proA2 recA13 thi1 ara14 lacY1 galK2 xyl5 mtl1 rpsL20 supE44 hsdS20 lambda− rB−mB−	DSMZ
BW25113	lacIq rrnB3 rlacZ4787 hsdR514 DE(araBAD)567 DE(rhaBAD)568 rph-1l	Genobase (Keio Collection)
JW3600	BW25113 waaY::Kmr	Genobase
JW3599	BW25113 waaW::Kmr	Genobase
JW3698	BW25113 waaU::Kmr	Genobase
HCR1	HB101 waaY(rfaY)::Tn5	This study
HCR1C	HCR1/pKSM2	This study
Plasmids
pBluescript II KS(+)	Cloning vector, Ampr	Stratagene
pMOSBlue	Cloning vector, Ampr	GE Healthcare
pBLR1	pBluescript KS+ waaY::Tn5 (Ampr, Kmr)	This study
pBLR3	pBluescript KS+ ydbA::Tn5 (Ampr, Kmr)	This study
pBLR12	pBluescript KS+ ynfF::Tn5 (Ampr, Kmr)	This study
pBLR18	pBluescript KS+ yohG::Tn5 (Ampr, Kmr)	This study
pBLR19	pBluescript KS+ gadB::Tn5 (Ampr, Kmr)	This study
pBLR20	pBluescript KS+ yhiU::Tn5 (Ampr, Kmr)	This study
pKSM2	pMOSBlue waaQ promoter; waaY	This study
Oligonucleotides
RFAY-F	5′-ATGATTCAGAAGAGCAAGATCAAAG-3′	This study
RFAY-R	5′-TTAGCGCGCTGGTTTCCCTT-3′	This study
RFAZ-F	5′-ATGAAGAATATTAGATACATTGACAAAAA-3′	This study
RFAZ-R	5′-TTAATTAGCATAAGAATCGGTTGAAG-3′	This study
RFAK-F	5′-ATGCGCTTAGGAACTTTTCAC-3′	This study
RFAK-R	5′-TCACTTCTTATCTATACAACTTAATCT-3′	This study
RFAPR-F	5′-ATCTGCAGCGGCCCCATTTTCAAATCTA-3′	This study
RFAPR-R	5′-TTGGATCCCCCCATGATATCGCATCTTT-3′	This study
RFAYB-F	5′ATGGATCCATGATTCAGAAGAGCAAGATCAAAG-3′	This study
RFAYE-R	5′-TAGAATTCTTAGCGCGCTGGTTTCCCTT-3′	This study
TN5-F	5′-AAGGATCCGAGCCATATTCAACGGGAAA-3′	This study
TN5-R	5′-AAAAGCTTGCCTGAGCGAGACGAAATAC-3′	This study

Antimicrobial Peptides

Human LL-37; the cathelicidins BMAP-27, CRAMP, and Bac7(1–35); and ovine SMAP-29 were synthesized, purified, and stored as described previously (21). Polymyxin B was from Sigma-Aldrich. For the cell binding assay, LL-37 was fluorescently labeled via linkage of the thiol-reactive fluorescent dye BODIPY® FL N-(2-aminoethyl) maleimide (Invitrogen) to a C-terminal cysteine residue added ad hoc. Peptide labeling was performed in 10 mm sodium phosphate buffer, pH 7.4, containing 30% acetonitrile. Briefly, 2 mg of fluorescent dye dissolved in 2 ml of acetonitrile were added dropwise to 18 ml of a 0.1 mg ml⁻¹ peptide solution, under nitrogen bubbling, and after 2 h of incubation, stirring in the dark at room temperature, a further 2 mg of peptide was added, and the solution was left stirring overnight, in the dark, at 4 °C. The labeled peptide was purified by a semipreparative RP-HPLC (Phenomenex Jupiter^TM C18 column, 5 μm, 300 Å, 100 × 10 mm), confirmed by electrospray ionization MS, and lyophilized.

Transposon Mutagenesis and Recombinant DNA Techniques

A transposon mutant library of the Escherichia coli strain HB101 strain was created using the EZ-Tn5^TM <KAN-2>Tnp Transposome kit (Epicenter Biotechnologies), following the instructions of the supplier. Briefly, E. coli HB101 cells were made competent as described previously (22) and transformed with the EZ-Tn5^TM <KAN-2>Tnp construct by electroporation. Mutagenized cells were selected on a medium supplemented with 25 μg ml⁻¹ kanamycin. The mutant clones were collected from the plates, pooled, resuspended in 20% glycerol, and stored at −80 °C. Approximately 60,000 clones were obtained.

Southern blot analyses were performed using genomic DNA that was purified from 20 random kanamycin-resistant colonies using the Sarkosyl-Pronase lysis method (23), digested with EcoRV, and transferred on an Amersham Biosciences Hybond-N+ nylon membrane (GE Healthcare). Hybridization was carried out under high stringency conditions, using a Tn5 fragment as a probe. The randomness of the insertion in the genome of mutants was confirmed. The Tn5 fragment was amplified by PCR directly from the transposon-transposase complex, supplied with the EZ-Tn5^TM <KAN-2>Tnp kit, using TN5-F and TN5-R primers (Table 1), and labeled with the digoxigenin-based DIG High Prime DNA Labeling and Detection Starter Kit II (Roche Applied Science). The membranes were washed, and signal was detected according to the manufacturer's instructions.

DNA manipulations, including digestion with restriction enzymes, agarose gel electrophoresis, ligation using T4 ligase, and transformation of E. coli cells, were performed using standard methods. Plasmids were extracted using an Illustra plasmidPrep Mini Spin kit (GE Healthcare), and purification of DNA fragments was performed by using the GenElute^TM gel extraction kit (Sigma). DNA sequencing was performed by BMR Genomics.

Selection of LL-37-resistant Mutants and Identification of the Sites of Transposon Insertion

Aliquots of the HB101 transposon mutant library were cultured in MH broth until an A₆₀₀ of 0.6 was reached and then diluted so that ∼5 × 10⁵ cfu were plated on MH agar containing 30 μm LL-37. Single colonies were then picked and inoculated in MH broth containing 5 μm LL-37 and 25 μg ml⁻¹ kanamycin to confirm the peptide-resistant phenotype. Untransformed HB101 colonies were treated in parallel as a control. The resistant mutant clones (HCR, for human cathelicidin-resistant) were harvested; the genomic DNA from six of them (HCR1, HCR3, HCR12, HCR18, HCR19, and HCR20) was extracted and digested with EcoRV; and the fragments were ligated to pBluescript II KS(+). Electroporated DH5α cells were transformed with the ligation mixture and selected for the presence of the Tn5 transposon on LB plates containing kanamycin. Plasmids named pBLR1, pBLR3, pBLR12, pBLR18, pBLR19, and pBLR20, according to the corresponding mutated clones (Table 1), were extracted from single colonies and sequenced using the KAN-2 FP-1 and KAN-2 RP-1 primers supplied with the EZ-Tn5^TM kit, which allowed the identification of the regions flanking the transposon. The sequences were assembled and aligned using BioEdit (24) and analyzed with BLAST (25).

Complementation of the waaY Mutation in trans

To complement the waaY mutation, the HCR1 mutant strain was transformed with the pKSM2 vector carrying a functional waaY gene downstream of the waaQ operon promoter (Table 1). An ∼300-bp fragment of the upstream region of the waaQ gene (26) was amplified from E. coli HB101 genomic DNA by PCR using the RFAPR-F and RFAPR-R primers and cloned into the PstI-BamHI sites in the pMOSBlue cloning vector (Amersham Biosciences) to generate pKSM1. The waaY gene was then amplified from HB101 genomic DNA by PCR using the RFAYB-F and RFAYE-R primers and cloned into the BamHI-EcoRI sites in pKSM1, creating the pKSM2 plasmid (Table 1).

RT-PCR Analysis

The wild type E. coli HB101 and the mutant HCR1 strains were cultured until an A₆₀₀ of 0.4 was reached. Total RNA was extracted from bacterial cells using the TRIzol Plus RNA purification kit (Invitrogen), and any residual genomic DNA was removed by RQ1 RNase-free DNase (Promega). cDNA was synthesized using random primers (Promega) and the Moloney murine leukemia virus reverse transcriptase (USB-Affymetrix) in the presence of RNasin Plus RNase inhibitor (Promega), according to the supplier's instructions. PCR was performed using the RFAY-F/RFAY-R primers to amplify waaY, the RFAZ-F/RFAZ-R primers to amplify waaZ, and the RFAK-F/RFAK-R primers to amplify waaU (Table 1), using an annealing temperature of 55 °C.

Antimicrobial Activity Tests

Determination of the minimum inhibitory concentration (MIC) of LL-37 was performed as described previously (21). To monitor bacterial growth inhibition, a suspension of 1 × 10⁶ cfu ml⁻¹ E. coli cells was grown in microtiter plate wells with periodic shaking at 37 °C, in the presence of different peptide concentrations. The A₆₂₀ was measured every 10 min on a microtiter plate reader (Sunrise, Tecan). After 4 h, the samples were removed from the reader, further incubated overnight at 37 °C, and then visually examined for turbidity. The bactericidal activity of LL-37 against mutant and wild-type E. coli strains was estimated as described previously (27), so that bacteria were incubated with 2 μm LL-37 for 90 min in MH medium before being diluted and plated to allow colony counts. All results are mean values from at least three independent determinations.

Flow Cytometry Assays

Binding of BODIPY-labeled LL-37 to E. coli cells was determined by flow cytometry using a Cytomics FC500 instrument (Beckman-Coulter, Inc.) as described previously (28). Cultures of mid-log phase bacteria were harvested, diluted to 10⁶ cfu ml⁻¹ in 20% MH broth, incubated with 0.1 and 0.25 μm LL-37-BODIPY® at 37 °C for 10–30 min, and analyzed immediately. All experiments were conducted in triplicate, and data were expressed as mean fluorescence intensity ± S.D. Permeabilization of the E. coli cytoplasmic membrane by LL-37 was assessed by flow cytometry, measuring the uptake of propidium iodide (PI) as described previously (27). Permeabilization data are expressed as a percentage of PI-positive cells. Data analysis was performed with the FCS Express V3 software (De Novo Software). The significance of differences among groups was evaluated by using a paired t test. Values of p < 0.05 were considered statistically significant.

Results

Isolation of E. coli Mutants with Decreased Susceptibility to LL-37 after Tn5 Mutagenesis

Transposon mutagenesis of the E. coli strain HB101 was performed and resulted in a library of ∼60,000 clones. Mutants showing a decreased susceptibility to the human host defense peptide LL-37 were isolated by plating aliquots from this library on solid MH agar medium containing 30 μm LL-37, the concentration required to completely inhibit the growth of the wild-type strain (as opposed to just 2 μm inhibiting growth in liquid medium). Twenty colonies, named HCR1–HCR20, were isolated, and their decreased susceptibility to LL-37 was confirmed by subculturing clones in liquid medium containing 2 μm peptide (data not shown). Southern blot analysis carried out with a Tn5 fragment as a probe on all HCR clones showed that 15 of 20 displayed the same hybridization profile, whereas the other five mutants carried the Tn5 transposon in genomic fragments of different length (Fig. 1).

FIGURE 1.

Southern blot analysis of DNA from HCR clones. Genomic DNA from HCR clones was processed as described under “Experimental Procedures” and hybridized using a Tn5 fragment as a probe. The numbers correspond to the clones named HCR1–HCR20.

Identification of Genes Conferring Decreased Susceptibility to LL-37

To identify the interrupted genes in six mutants displaying different hybridization profiles (HCR1, HCR3, HCR12, HCR18, HCR19, and HCR20), the genomic DNA was subcloned in a plasmid vector and selected for kanamycin resistance, and the resulting clones were sequenced. The identified genes and the Tn5 insertion sites are reported in Table 2. The relation of five of these genes to LL-37 susceptibility is not immediately apparent from the known functions of their products (see Table 2), but the subcellular location of most of them in the outer membrane (ydbA_2, mdtQ, and mdtE) or periplasm (ynfF) suggests that they might have a role in modulating the interactions of the cathelicidin with the bacterial membranes. We focused on the sixth interrupted gene (waaY) identified in HCR1 because it was also found in all of the other 14 clones that displayed a similar hybridization profile, although with the insertion occurring in at least five different sites within the same gene, as revealed by PCR analysis (data not shown). This result strongly suggests a correlation between the function of the waaY gene product and bacterial susceptibility to LL-37, so that it is likely to be associated with the peptide's mode of action.

TABLE 2.

E. coli clones grown on LL-37-enriched medium and description of the function of their gene products

Mutant	Mutated gene	Size	Tn5 positiona	Function of the gene product	Reference
		bp
HCR1	waaY(rfaY)	699	393–401	HepII-kinase to form LPS-inner core	29
HCR3	ydbA_2	3324	3128–3136	Fragment 1 of a split CDS predicted outer membrane protein	56
HCR12	ynfF	2424	222–230	Oxidoreductase subunit of a putative selenate reductase	56
HCR18	yohG (mdtQ)	1089	818–826	Outer membrane component of a multidrug efflux system	56
HCR19	gadB	1401	185–193	Glutamate decarboxylase of the glutamate-dependent acid resistance system	56
HCR20	yhiU (mdtE)	1158	342–350	Membrane component of the MdtEF-TolC multidrug efflux transport system	56

^a Starting from start codon

In E. coli, the waaY gene is located in the waa operon (formerly rfa) (Fig. 2A), a long transcription unit involved in LPS synthesis (29). In particular, waaY encodes a kinase that specifically adds a phosphate group to the second heptose residue in the inner core of LPS during the synthesis process (Fig. 2B) (29). The waaZ and waaU genes are located just downstream of waaY in the operon and are likely to encode for glycosyltransferases (30). Therefore, we checked by RT-PCR analysis whether the expression of those genes was affected in HCR1, but unlike waaY, they were properly transcribed, excluding polar effects (Fig. 3).

FIGURE 2.

Map of the waaQ operon and representation of the structure of the LPS of E. coli K12. A, map of the waaQ operon of E. coli K12. Arrows, experimentally verified promoters. Dashed arrow, predicted promoter (32, 53, 54). The position of the Tn5 transposon insertion into waaY is indicated. B, schematic representation of the structure of LPS of E. coli K12, based on two published schemes (29, 55). The site of action of WaaY is highlighted in the box. KDO, 3-deoxy-d-manno-2-octulosonic acid; Hep, l-glycero-d-manno-heptose; P, phosphate; PPEtn, 2-aminoethyl diphosphate.

FIGURE 3.

RT-PCR analysis of waaY, waaZ, and waaU transcripts in HB101 and HCR1 strains. RNA was isolated as described under “Experimental Procedures,” and the resulting cDNA was analyzed by gel electrophoresis for the presence of waaY, waaZ, and waaU transcripts of the waa operon, with expected sizes of 699, 852, and 1074 bp, respectively.

Inactivation of the waaY Gene Reduces the Susceptibility of E. coli to LL-37 in a Specific Manner

MIC assays indicated that the susceptibility to LL-37 was reduced 2-fold in HCR1 compared with the wild-type strain (Table 3). Growth kinetics assays showed that the mutant strain was as vital as the wild type (Fig. 4A), but whereas 1 μm LL-37 completely inhibited the growth of the wild-type strain over a 4-h period, it only slowed that of the mutant strain (Fig. 4B). The difference in the susceptibility was most evident in bactericidal activity assays in the presence of 2 μm LL-37, which showed a 4-log drop in the wild-type strain but only a 1-log drop in the mutant one. Furthermore, when the HCR1 strain was complemented by a plasmid carrying a functional copy of the waaY gene (HCR1C strain), the susceptibility to LL-37 was restored to the wild-type level or even increased (Fig. 4, B and C).

TABLE 3.

Susceptibility of E. coli strains to LL-37, other AMPs, and polymyxin B

Peptide	MIC
	HB101	HCR1	HCR1C
	μm
LL-37	1	2	1
LL-37-BY	2	4	2
CRAMP	1	1	1
SMAP-29	0.50	0.50	0.50
BMAP-27	0.25	0.25	0.25
Bac7(1–35)	0.5	0.5	0.5
Polymyxin B	0.125	0.125	0.125

FIGURE 4.

Antibacterial activity of LL-37 against the E. coli HB101, HCR1, and HCR1C strains. A and B, growth kinetics of bacterial suspensions (10⁶ cfu/ml) incubated at 37 °C with or without LL-37. The growth was recorded at 620 nm for 4 h. The HB101 (solid line), HCR1 (dashed line), and HCR1C (dotted line) cells were incubated in the absence (A) or presence (B) of 1 μm LL-37. C, bactericidal activity of LL-37 against the different stains (starting inoculum, 10⁶ cfu/ml). Histograms indicate the number of untreated cells (white) and of viable bacterial cells treated with 2 μm LL-37 (black) for 90 min at 37 °C. The averaged number of cfu ml⁻¹ ± S.D. (error bars) of three independent experiments is shown. *, p < 0.05 peptide-treated HCR1 cells versus peptide-treated HB101 and HCR1C cells.

To confirm the role of the WaaY kinase in mediating the susceptibility to LL-37, a waaY deletion mutant strain from the Keio library (JW3600) (31) and its parental strain BW25113 were also tested, giving similar results, with a 2-fold increase in MIC (2 μm for BW25113 versus 4 μm for JW3600) and a similar effect on growth kinetics (data not shown). On the other hand, the susceptibility of the waaZ- and waaU-null mutants to LL-37 was unaffected (data not shown). Their gene products are reported to affect LPS core structure in other regions (KdoII and HepIV, respectively) (32).

On the whole, these results indicate that inactivation of the waaY gene confers a phenotype that is less susceptible to LL-37 due to a specific modification of the LPS core oligosaccharide. To test how general this effect is, the HCR1 strain was treated with different cathelicidins (Table 4). No differences in terms of MIC values (Table 3) or effect on bacterial growth rate (not shown) was observed between HCR1 and the wild-type HB101 in the presence of the bovid α-helical cathelicidins BMAP-27, CRAMP, and SMAP-29 or of the linear, proline-rich peptide Bac7(1–35). These results indicate that the inactivation of waaY confers a phenotype that specifically reduces the susceptibility to LL-37.

TABLE 4.

Amino acid sequence and charge of antimicrobial peptides used in this study

Peptidea	Sequence	aab	qc
LL-37	[LL-37, 37 aa]OH	37	6+
CRAMP	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH	34	6+
SMAP-29	RGLRRLGRKIAHGVKKYGPTVLRIIRIA-NH2	28	10+
BMAP-27	GRFKRFRKKFKKLFKKLSPVIPLLHL-NH2	26	11+
Bac7(1–35)	RRIRPRPPRLPRPRPRPLPFPRPGPRPIPRPLPFP-OH	35	11+

^a LL-37 is from humans, CRAMP is from mice, SMAP-29 is from sheep, and BMAP-27 and Bac7(1–35) are from cattle.

^b Amino acid.

^c Peptide charge, taking into account C-terminal amidation (-NH₂) and considering His as neutral.

LL-37 Has a Reduced Capacity to Bind to and to Permeabilize E. coli HCR1

The WaaY kinase phosphorylates HepII, and this could favor the binding of LL-37, which is cationic. To evaluate whether the decreased susceptibility of the HCR1 strain to LL-37 derived from an altered capacity of the peptide to bind to the bacterial surface, HB101 and HCR1 cells were incubated with subinhibitory concentrations of a BODIPY-labeled, fluorescent derivative of LL-37 (LL-37-BY), and surface fluorescence was then analyzed by flow cytometry. Note that labeling with BODIPY does not alter the charge of the peptide, and only a slight decrease in its potency was observed, even if the difference in the susceptibility to the peptides between the wild type and the waaY mutant remained identical (Table 3). The tagged LL-37 was found to bind efficiently to the surface of HB101 cells in a dose-dependent manner, whereas surface binding to the HCR1 mutant was significantly lower (Fig. 5, A and B), suggesting that the reduced LPS anionicity influences the initial interaction of the peptide with the surface of target cells. Surface binding comparable with that of the wild-type HB101 was instead observed for HCR1C cells, so that the complementation of waaY restores the interaction to a normal level (Fig. 5, A and B).

FIGURE 5.

Binding of LL-37 to and permeabilizing effect on wild-type HB101 and mutant HCR1 E. coli cells. Fluorescence of E. coli HB101, HCR1, and HCR1C cells incubated with 0.1 μm (A) and 0.25 μm (B) LL-37-BODIPY for 10 min at 37 °C and then analyzed by flow cytometry. The averaged mean fluorescence intensity (MFI) ± S.D. (error bars) of three independent experiments is shown. *, p < 0.01 peptide-treated HCR1 cells versus peptide-treated HB101 and HCR1C cells. C, percentage of PI-positive cells after incubation of E. coli HB101 (solid line), HCR1 (dotted line), and HCR1C (dashed line) with 0.5 μm LL-37 at different times. The background level of permeabilized, fluorescent cells obtained by using peptide-untreated samples was always lower than 3% and was removed from the corresponding peptide-treated sample. The averaged percentages of PI-positive cells ± S.D. from three independent experiments are shown. *, p < 0.05 peptide-treated HCR1 cells versus peptide-treated HB101 and HCR1C cells at the 30 and 60 min time points.

After the initial interaction with the outer membrane, part of the LL-37 molecules translocate to the bacterial cytoplasmic membrane, probably a primary target. To determine whether the effect of knocking out the waaY gene and reducing surface binding affected the efficiency of bacterial permeabilization by the peptide, we compared the percentage of cells that became positive for the fluorescent probe PI after exposure of wild-type or mutant cells to the peptide. As shown in Fig. 5C, LL-37 caused ∼50% permeabilization of HB101 cells within 30 min, whereas the percentage was markedly reduced in the mutant HCR1 cells (∼25%) under the same conditions at both 0.5 μm (Fig. 5C) and 0.25 μm concentrations (data not shown). The HCR1C strain, harboring multiple copies of the waaY gene, showed an even higher level of membrane binding and permeabilization than the wild type (Fig. 5). These results strongly support the correlation between the initial peptide binding to the phosphate groups in the inner core of LPS and its subsequent capacity to damage the cytoplasmic membrane barrier.

Discussion

A large body of experimental evidence indicates that membrane permeabilization is a key step in the killing of microorganisms by many antimicrobial host defense peptides, including the human cathelicidin LL-37. This can occur either via pore formation or a more generalized membrane compromising (17, 19), but the details of these possible modes of action are not completely understood. In particular, the factors affecting the approach of the peptide to the inner membrane from the extracellular milieu and the structural features that favor its transit through the outer layers of the cell wall are still unclear.

In the present study, we have identified an E. coli mutant, HCR1, with decreased susceptibility to LL-37 due to the interruption of the waaY gene by a transposon insertion. This gene encodes an LPS kinase, suggesting that decreased susceptibility derives from less phosphorylated LPS, thereby affecting the peptide's initial accumulation at the outer membrane; translocation to the periplasm; and ultimately its capacity to accumulate on, interact with, and then permeabilize the cytoplasmic membrane.

The LPS layer of the Gram-negative bacterial outer membrane functions as an effective barrier against some external solutes (33) but has a rather variable structure. Lipid A, the membrane anchor, is linked to core oligosaccharide (OS), a short chain of sugar residues that have multiple phosphorylation sites, and in some strains can then extend into O-antigen, which consists of a variable number of oligosaccharide repeats (32). The genes responsible for the biosynthesis, phosphorylation, and modification of core OS in E. coli and Salmonella enterica Typhimurium are clustered in the waa locus (32), which includes a long transcription unit (32) (see Fig. 2A). The product of waaY is a kinase responsible for the phosphorylation of HepII, the second of the three l-glycero-d-manno-heptose (Hep) residues in the LPS inner core region in E. coli and S. enterica Typhimurium (29). Its absence reduces the negative charge of the core OS without altering the stability of the LPS layer (32).

We found that the HCR1 strain, lacking this kinase, was able to grow both on solid and in liquid media containing LL-37 at concentrations that inhibit the parental strain. Its advantage over the wild-type strain was most evident for short exposure times in liquid medium. This suggested a modification of the initial interaction between LL-37 and the bacterial surface. Note that interruption of the waaY gene by Tn5 insertion does not cause polar effects on the expression of downstream genes, and knocking these genes out in any case does not affect the susceptibility, so the effect seems specific to the activity of the WaaY kinase. Furthermore, complementation of the waaY mutation completely restored the sensitivity to the parental strain level.

LPS is among the first structures that AMPs encounter in their trajectory toward the inner membrane of Gram-negative bacteria, and it has been shown to play a relevant role in the mode of action of antimicrobial peptides, such as defensins (34). LPS, with its negatively charged groups, participates in electrostatic interactions with these cationic molecules (35). It is well known that some bacteria can, in fact, acquire some protection against AMPs by reducing the net negative charge of lipid A (36–39), and this has been very recently extended to commensal gut bacteria (40). Further strong support for the role of waaY in decreasing sensitivity to AMPs comes from a recent work showing that the S. enterica Typhimurium can mutate its homologue of waaY, resulting in a resistant phenotype, under selective pressure from LL-37 (41).

We cannot exclude the possibility that lack of the phosphate is only indirectly involved in reducing sensitivity to LL-37 (e.g. by affecting the composition and/or conformation of the LPS). However, because waaY inactivation results in a significant reduction of the amount of LL-37 bound to the cell surface (Fig. 5A), the simplest explanation is that the phosphate group on HepII is an important initial docking site for this peptide. In this respect, it is also interesting to note that S. enterica Typhimurium produces PmrG, a specific phosphatase capable of dephosphorylating HepII, leading to an increased resistance to Fe(III). This ion seems to share the same binding sites with polymyxin B (42). A similar mechanism might therefore be more generally used to modulate the susceptibility toward other types of cationic AMPs. Significantly, PmrG is regulated by the two-component regulatory system PmrA/PmrB, involved in diverse other mechanisms conferring resistance to cationic AMPs, including a transferase that modulates the negative charge on lipid A by introducing aminoarabinose (43, 44). A PmrG homologue is present in E. coli (45), although it has not yet been experimentally established whether it has a similar role.

The key step in the inactivation mechanism of many cationic AMPs is the permeabilization of the bacterial cytoplasmic membrane, which occurs when peptide molecules accumulate on the bacterial surface over a threshold level. A reduced binding to and migration across the outer membrane would significantly affect this process. Flow cytometric assays confirm that the lack of HepII phosphorylation results in both reduced binding to and permeabilization of HCR1 cells by LL-37 when compared with the wild-type cells (Fig. 5).

An important aspect of waaY inactivation is that the general stability of the LPS layer seems unaffected when HepII is not phosphorylated. Conversely, it is affected upon inactivation of the waaP gene, which removes the kinase required for HepI phosphorylation. In E. coli and Salmonella spp., HepII can be phosphorylated by the WaaY kinase only if HepI has previously been phosphorylated. Conceptually, the complete loss of the phosphates from the OS, if waaP is deleted, should lead to an even lower susceptibility to AMPs. However, it also leads to significant structural changes of the LPS and a pleiotropic phenotype known as deep-rough (46, 47), characterized by hypersensitivity to detergents and hydrophobic antibiotics (29) and by a loss of virulence in vivo (48). The waaP knock-out mutant was, in fact, found to be hypersensitive to LL-37 as well as to the detergent SDS (data not shown). Thus, phosphorylated HepI is important for outer membrane stability because it is likely to be needed for cross-linking of adjacent LPS molecules by divalent cations and polyamines (49), so it cannot be dispensed with. On the other hand, HepII phosphorylation is less significant for LPS stability; therefore, it can be dispensed with as a bacterial stratagem to decrease the susceptibility toward some cationic AMPs.

It may be relevant that this holds true for LL-37 but not other α-helical cathelicidins or structurally different proline-rich ones, suggesting a specific type of interaction that may depend on particular structural characteristics of LL-37. This peptide is unlike most cationic, helical AMPs, including closely related primate orthologues, which only adopt a helical conformation upon contact with bacterial membranes. Due to a particular pattern of side-chain electrostatic attractions, it shows a relatively stable helical structure also in aqueous, physiological conditions, which drives it to aggregate and to approach the cytoplasmic membrane and interact with it in an oligomeric form (50). Binding to LPS appears to further aid the helical structuring and aggregation (35, 51), which may impede the transit through the outer membrane and the accumulation at the cytoplasmic membrane, and phosphorylated HepII could play a role in this interaction.

In conclusion, with this study, we have obtained new insight into the mode of action of the human host defense peptide LL-37, establishing a role for a specific phosphate group of the inner core of LPS that adds to that of other lipid A phosphates, known to be important for the binding of cationic AMPs in general (52). Moreover, modulating HepII phosphorylation alters sensitivity of bacterial cells to an important effector of the innate immunity, LL-37. This could represent one of the several strategies that contribute to pathogen survival in the host. The resistance conferred by switching off the waaY gene is not outstanding per se, and we report that it is limited to LL-37. However, it could become relevant in combination with other alterations that increase other aspects of resistance.

Author Contributions

K. B. and S. F. designed and performed most of the experiments, M. M. performed assays to characterize the mutant phenotype, M. B. carried out flow cytometric analyses, A. T. and R. G. provided conceptual advice, and A. T. contributed to the writing of the manuscript. M. S. designed the study, supervised the experiments, and edited the manuscript with contributions from all of the other authors.