Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2015 Aug 11.
Published in final edited form as: Biochemistry. 2015 Feb 5;54(6):1408–1420. doi: 10.1021/bi5013782

Ligand Recognition Specificity of Leukocyte Integrin αMβ2 (Mac-1, CD11b/CD18) and Its Functional Consequences

Nataly P Podolnikova , Andriy V Podolnikov , Thomas A Haas , Valeryi K Lishko , Tatiana P Ugarova †,*
PMCID: PMC4532391  NIHMSID: NIHMS713604  PMID: 25613106

Abstract

The broad recognition specificity exhibited by integrin αMβ2 (Mac-1, CD11b/CD18) has allowed this adhesion receptor to play innumerable roles in leukocyte biology, yet we know little about how and why αMβ2 binds its multiple ligands. Within αMβ2, the αMI-domain is responsible for integrin’s multiligand binding properties. To identify its recognition motif, we screened peptide libraries spanning sequences of many known protein ligands for αMI-domain binding and also selected the αMI-domain recognition sequences by phage display. Analyses of >1400 binding and nonbinding peptides derived from peptide libraries showed that a key feature of the αMI-domain recognition motif is a small core consisting of basic amino acids flanked by hydrophobic residues. Furthermore, the peptides selected by phage display conformed to a similar pattern. Identification of the recognition motif allowed the construction of an algorithm that reliably predicts the αMI-domain binding sites in the αMβ2 ligands. The recognition specificity of the αMI-domain resembles that of some chaperones, which allows it to bind segments exposed in unfolded proteins. The disclosure of the αMβ2 binding preferences allowed the prediction that cationic host defense peptides, which are strikingly enriched in the αMI-domain recognition motifs, represent a new class of αMβ2 ligands. This prediction has been tested by examining the interaction of αMβ2 with the human cathelicidin peptide LL-37. LL-37 induced a potent αMβ2-dependent cell migratory response and caused activation of αMβ2 on neutrophils. The newly revealed recognition specificity of αMβ2 toward unfolded protein segments and cationic proteins and peptides suggests that αMβ2 may serve as a previously proposed “alarmin” receptor with important roles in innate host defense.

graphic file with name nihms713604u1.jpg


Integrins are noncovalently associated α-β heterodimer receptors that mediate adhesive interactions of cells with the extracellular matrix and other cells. Integrins regulate a diverse range of processes, including cell migration, differentiation, the immune response, and maintenance of tissue architecture. Many integrins exhibit a very broad ligand binding specificity and can bind various proteins that share no obvious sequence similarity. Furthermore, even integrins that selectively recognize the RGD adhesion motif are capable of binding numerous ligands that lack this sequence and belong to diverse protein families. To date, the mechanisms underlying the broad ligand specificity exhibited by integrins remain unknown.

αMβ2 (Mac-1, CD11b/CD18), which belongs to the β2 subfamily of leukocyte integrins, is the most promiscuous integrin with more than 40 reported protein ligands. αMβ2 is expressed predominantly on myeloid cells and mediates adhesive reactions of leukocytes during the inflammatory response. In particular, it contributes to firm adhesion of neutrophils to endothelial cells, promotes their diapedesis, and participates in migration of neutrophils to sites of inflammation. 13 Many other neutrophil and monocyte/macrophage responses, including phagocytosis, homotypic aggregation, degranulation, and adherence to microorganisms, also depend on αMβ2. The complexity of αMβ2-mediated functions is believed to arise from its ability to recognize a multitude of structurally and functionally dissimilar ligands. The reported αMβ2 ligands include numerous proteins that constitute the extracellular matrix and many that become associated with the ECM during the inflammatory response (a partial list is provided in refs 4 and 5). It also binds several cellular receptors such as ICAM-1, GPIbα, and JAM-3.68 Further adding to the diversity, several proteases, such as elastase, myeloperoxidase, and plasminogen,911 and even the non-mammalian proteins ovalbumin and keyhole limpet hemocyanin, are αMβ2 ligands. Each year, new and structurally unrelated proteins are being added to this already impressive list. Particularly notable additions are CD40L, which may contribute to the pathogenesis of atherosclerosis,12 and HMGB1 (high-mobility group box 1, amphoterin),13 a nuclear protein that is released from necrotic cells and activated macrophages and recently emerged as a potent inflammatory mediator.1416 The mechanism by which this single integrin can recognize such a vast repertoire of structurally unrelated proteins, the biological significance of αMβ2’s broad specificity, and the physiological relevance of many identified ligands remain poorly understood.

The approximately 200-residue αMI-domain within αMβ2 mediates ligand binding17,18 and is therefore responsible for the receptor’s broad substrate specificity. Accordingly, binding sites for several ligands, including C3bi, fibrinogen, neutrophil inhibitory factor (NIF), and CCN1 (Cyr61), have been localized to the αMI-domain.1922 Earlier studies have identified peptides derived from several proteins that bind the αMI-domain, including the fibrinogen peptides 190GWTVFQKRLDGS202 (P1), 377YSMKKTTMKIIPFNRLTIG395 (P2), and CCN1-derived 305SSVKKYRPKYCGS317,2325 as putative binding sites for αMβ2. The αMI-domain binding peptides directly support cell adhesion, inhibit αMβ2-mediated cell adhesion, and are able to promote cell migration.2426 In addition to these sequences, the αMI-domain can bind other sequences in fibrinogen and CCN1, consistent with the existence of multiple binding sites for αMβ2 in these molecules.27 The αMI-domain recognition sequences derived from fibrinogen and other αMβ2 ligands do not contain a particular consensus motif similar to RGD and have no apparent sequence homology. However, the fact that all these peptides bind the αMI-domain and support αMβ2-mediated adhesion responses implies they contain a similar recognition signal. To identify this recognition signal, we previously used cellulose-bound peptide libraries to analyze a set of αMI-domain binding sequences derived from the γC and βC domains of fibrinogen.27 This approach was widely utilized to define the mechanisms of recognition in biological systems in which promiscuity in ligand binding plays an important role, including molecular chaperones.2830 We demonstrated that the αMI-domain binds short sequences enriched in basic and hydrophobic residues.27 However, although these analyses provided useful insights into the αMβ2 ligand binding preferences, the limited data set was not sufficient to determine the αMI-domain recognition motif.

To improve our understanding of the principles that govern the multiligand binding properties of αMβ2, we have screened peptide libraries representing complete sequences of many known and predicted αMβ2 ligands for αMI-domain binding and selected recognition sequences by phage display. Analyses of a large data set allowed the identification of the αMI-domain recognition motif, which satisfactorily explained previous findings and led to important insights into functional consequences of αMβ2 recognition specificity.

EXPERIMENTAL PROCEDURES

Proteins and Peptides

The active conformer of the αMI-domain (residues αM Glu123–Lys315) was prepared with or without the GST fusion as described previously.21 The αMI-domain without fusion was labeled with 125I using IODO-GEN (Pierce, Rockford, IL). The D fragment (100 kDa) was prepared from human fibrinogen (Enzyme Research Laboratories, South Bend, IN) by digestion with plasmin as described previously.31 The peptides for binding experiments with the αMI-domain (RKLRSLWRR, LQLRFPRFV, LLHNYGVYT, GDDPSDKFF, QVLRIRKRA, ARLPIWF, GRLPMPW, and NRLLLTG) were synthesized according to standard Fmoc machine protocols using an Omega 396 synthesizer (Advanced ChemTech, Louisville, KY) and analyzed by reverse-phase high-performance liquid chromatography and mass spectrometry. The human cathelicidin peptide LL-37 ([LL-37, 37 aa]) was from AnaSpec, Inc. (San Jose, CA). The fibrinogen peptides TMKIIPFNRLIG (P2-C), GWTVFQKRLDGSV (P1), KYRLTYAYFAG, and SVNKYRGTAGNA were described previously.27 mAbs 44a and IB4 directed against human αM and β2 integrin subunits, respectively, were purified from conditioned media of hybridoma cells obtained from American Tissue Culture Collection (Manassas, VA) using protein A agarose. mAb CBRM1/5 conjugated to Alexa 488 was from Santa Cruz Biotechnology (Dallas, TX).

Synthesis and Screening of Peptide Libraries for αMI-Domain Binding

Peptide libraries representing the compete sequences of 15 proteins and eight antimicrobial peptides (Table 1) were prepared by parallel spot synthesis using cellulose membranes as described previously.32 Protein amino acid sequences were obtained from the NCBI database using the corresponding accession numbers (Table 1). The peptide libraries of the γC and βC domains of fibrinogen were described previously.27 The libraries were synthesized as 9-mer overlapping peptides with a three-amino acid offset. Peptides were C-terminally attached to the cellulose via a (β-Ala)2 spacer and were acetylated N-terminally. The membrane-bound peptides were tested for the ability to bind the αMI-domain essentially as described previously.27 In brief, membranes were blocked with 1% BSA and incubated with 5 μg/mL 125I-labeled αMI-domain in TBS containing 1 mM MgCl2, 0.1% BSA, and 2 mM dithiothreitol. Membranes were washed with TBS containing 0.05% Tween 20 and dried, and αMI-domain binding was visualized by autoradiography and analyzed by densitometry.

Table 1.

Protein and Peptide Sequences That Were Screened for αMI-Domain Binding

protein Protein Data Bank (PDB) entry no. of residues pI PDB entry for the three-dimensional structure shown to be an αMβ2 ligand, a predicted ligand, or a predicted nonligand
azurocidin precursor (CAP37, cationic antimicrobial protein, HBP) P20160 222 9.5 1A7S 8
bone syaloprotein (BSP) P10451 298 4.4 NAa predicted nonligand
cathepsin G P08311 235 11.4 1AU8 predicted ligandb
elastase P08246 238 9.9 1PPG 8
myeloperoxidase P05164 697 9.3 1DNW 10
CCN1 (Cyr61) O00622 357 8.5 NAa 22
fibrinogen A α chain (1–611) P02671 611 7.7 1FZA predicted ligandb
fibrinogen β C domain (200–461) P02675 261 7.0 1FZA 27
fibrinogen γ C domain (148–411) P02679 263 6.1 1FIB 23, 24, 27
ICAM-1 (IgG-like C2-type domain 3) P05362 67 4.2 NAa 60
ovomucoid P01005 186 4.8 NAa predicted nonligand
Pg N-terminal peptide (1–78) Q5TEH4 78 4.7 NAa 11
protein C P04070 419 5.6 1AUT predicted ligandb (2004)
proteinase 3 P24158 221 7.8 1FUJ 61
soybean trypsin inhibitor (SBTI) P01071 181 4.7 1AVU 4
antimicrobial peptides
 cathelicidin (hCAP-18/LL-37) P49913 37 10.6 2K6O Lishko et al., 2014c
 bactenecin 5 P19660 43 12.5 NAa predicted ligandb
 HNP-1 P59665 30 8.7 3GNY predicted ligand
 HBD-1 P60022 36 8.9 1E4S predicted ligand
 drosocin P36193 19 12.0 NAa predicted ligand
 tritrpticin P51524 13 12.5 1D6X predicted ligand
 polyphemusin 1 P14215 18 10.3 1RKK predicted ligand
 IDR-1 (innate defense regulator) NAa 13 11.0 NAa 62
a

Not available.

b

Supports adhesion of αMβ2-expressing cells, including αMβ2-transfected HEK293 cells, human neutrophils, human monocytoid U937 cells, and murine IC-21 macrophages.

c

Manuscript prepared for submission.

Determination of Energy Contributions of Amino Acids for αMI-Domain Binding and Establishment of the αMI Binding Algorithm

The algorithm predicting the αMI-domain binding sequences was constructed on the basis of the statistical energy contributions of individual amino acids within the 9-mer αMI-domain binding peptides using the strategy described previously for members of the Hsp70 family of molecular chaperones.28 The energy values were calculated according to the equation ΔGK = –RT ln Pb/Pn, where R is the gas constant (8.31 J mol−1 K−1), T is the absolute temperature in kelvin, and Pb and Pn are the relative frequencies with which each amino acid occurs in binding and nonbinding peptides, respectively. Because no specific distance pattern of residues within the αMI-domain binding peptides was apparent, the relative importance of each residue within the 9-mer was assumed to be equal. The combined energy value for binding and nonbinding peptides was calculated using the computer program IRMA (available upon request), which detects potential αMI-domain binding sites contained within protein primary sequences by searching for segments with the lowest ΔGK values.

Phage Display

The phage epitope library that displays random seven-residue insertions near the N-terminus of the pIII surface protein was purchased from New England Biolabs (Ipswich, MA). The library had a complexity in excess of 2 billion independent clones. Affinity panning was performed according to the manufacturer’s protocol. Briefly, the wells of 24-well plates were coated with the αMI-domain (20 μg/mL in PBS) for 3 h at 37 °C and postcoated with 1% PVA in PBS for 1 h at 22 °C. The wells were incubated with the phage library overnight at 4 °C. Following extensive washes with PBS containing 0.1% Tween 20, the αMI-domain-bound phages were eluted with 0.2 M glycine buffer (pH 2.0). The released phages were expanded and after the second panning were eluted with 20 μg/mL P2-C peptide. After the third panning, the phages were eluted with P2-C and the sequences of the inset were determined. Control isolations were performed using PVA. Twenty-six selected and 10 unselected phages from the PVA control were sequenced.

Solid-Phase Binding Assays

Selected peptides derived from different protein sequences were tested for their ability to compete with binding of the αMI-domain to immobilized D fragment; 96-well Immulon 4HBX microtiter plates were coated with 1 μg/mL D fragment for 3 h at 37 °C and postcoated with 1% BSA for 1 h. The αMI-domain as a fusion with GST (10 μg/mL) in TBS containing 1 mM MgCl2 and 0.05% Tween 20 was preincubated with different concentrations of peptides for 1 h at 22 °C, and 0.1 mL aliquots were added to the wells. After incubation for 1.5 h at 37 °C, the wells were washed and anti-GST mAb (1:5000 dilution) was added. The bound αMI-domain was quantified after reaction with goat anti-mouse IgG conjugated with alkaline phosphatase.

Leukocyte Migration Assays

Chemotaxis assays of U937 monocytic cells were performed on 22 mm × 22 mm coverslips. Agarose (1%; Life Technologies, Carlsbad, CA) was dissolved in Hank’s balanced salt solution and mixed with 2 mg/mL LL-37, which produced a final concentration of 15 μg/mL. A 10 μL drop of warm agarose solution containing LL-37 was placed at one corner of the cover glass ~1.5 mm from the edge. A control agarose drop was placed in the diagonally opposite corner of the coverslip, and the agarose was allowed to polymerize for 5 min. The coverslips were placed into wells of a six-well plate containing 5 mL of RPMI 1640 and 10% FBS. A 10 μL aliquot containing 5 × 104 U937 cells was loaded in the center of the cover glass, and the plate was incubated for 2 h at 37 °C in a humidified atmosphere containing 5% CO2. In this experimental format, the cells sediment approximately 5 min after being loaded to form an ~4–6 mm circle and begin to migrate toward the agarose drop containing LL-37. Photographs of cell migration were taken at 2 mm intervals.

In the second format, migration assays were performed with αMβ2-expressing HEK293 cells using Transwell inserts (5 μm pore size) as previously described.26,33 Briefly, the upper chamber of the Transwell system contained 3 × 105 cells and the lower chamber LL-37 (0.1–2 μg/mL). For inhibition experiments, cells were pretreated for 15 min with 20 μg/mL anti-αM mAb 44a, anti-β2 mAb IB4, or noninhibitory mAb OKM1. After incubation for 16 h at 37 °C, cells that adhered to the underside of the filter were fixed with paraformaldehyde and stained with Hematoxylin. Selected Transwell assays were performed with thioglycolate-elicited monocyte/macrophages isolated from the peritoneum of wild-type and αMβ2-deficient mice (The Jackson Laboratory, Bar Harbor, ME). Macrophages were purified using the EasySep Mouse selection kit (StemCell Technologies) with mAb against F4/80 conjugated to PE and allowed to migrate for 90 min.

Cell Adhesion Assays

Adhesion assays with αMβ2-expressing HEK293 and U937 monocytoid cells were performed essentially as described previously.24,34 Briefly, the wells of polystyrene microtiter plates (Immulon 4HBX, Dynex Technologies, Chantilly, VA) were coated with 2.5 μg/mL fibrinogen for 3 h at 37 °C and postcoated with 0.5% PVP for 1 h at 37 °C. Cells were labeled with 10 μM calcein AM (Invitrogen) and preincubated for 15 min at 22 °C with selected concentrations of peptides in DMEM and 0.1% BSA, and 100 μL aliquots (4.5 × 104 cells) were added to the wells. Immediately before cell addition, 10 μL of 1% BSA was added to the wells. After incubation at 37 °C for 30 min, the nonadherent cells were removed and fluorescence was measured in a fluorescence plate reader (CytoFluorII, Applied Biosystems, Foster City, CA).

Flow Cytometry

FACS analyses were performed to assess αMβ2 activation and expression on the cell surface of neutrophils induced by LL-37. Neutrophils isolated from human blood under sterile conditions were suspended in HBSS and 0.1% BSA at a density of 106 per 0.1 mL and incubated with different concentrations of LL-37 (0.5–10 μg/mL) or fMLP (200 nM) for 5 min at 22 °C. mAb CBRM1/5 (20 μL) conjugated to Alexa 488 was added to cells and incubated for 30 min on ice. The cells were analyzed in a FACS Scan (BD Biosciences) as described previously.5

RESULTS

Screening Peptide Libraries for αMI-Domain Binding

To determine the recognition specificity of αMβ2, we screened cellulose-bound peptide libraries representing the complete sequences of 15 proteins for αMI-domain binding (Table 1). These proteins were selected because they are known αMβ2 ligands (γC and βC domains of fibrinogen, CCN1, N-terminal Pg peptide, ICAM-1, myeloperoxidase, elastase, azurocidin, and soybean trypsin inhibitor) or because they are predicted to be candidate ligands on the basis of the knowledge of their amino acid sequences and physicochemical properties (cathepsin G, proteinase 3, and protein C). Indeed, cathepsin G and protein C support strong adhesion of αMβ2-expressing HEK293 cells and monocytoid U937 cells (unpublished data). In addition, bone sialoprotein (BSP) and ovomucoid were selected as predicted nonbinding proteins. Figure 1A shows representative peptide scans derived from the αMβ2 binding and predicted nonbinding proteins. The peptide libraries were composed of 9-mer peptides that overlap by six residues. Because 6-mer peptides present minimal αMI-domain binding signals,34 the scans contain all potential linear binding sites for the αMI-domain. The use of this screening approach is validated by previous findings that P1 (γ190–202) and P2 (γ377–395), recognition peptides derived from fibrinogen,27 and CCN1-H2 (305–317), the recognition peptide from CCN1,25 bound the αMI-domain when covalently coupled to the cellulose membrane (Figure 1A). Furthermore, the specificity of interactions is confirmed by inhibition of the αMI-domain binding to the γC library in the presence of soluble P2 peptide,27 and the lack of binding of radiolabeled αLI domain to the γC and other peptide libraries.

Figure 1.

Figure 1

Screen of cellulose-bound peptide libraries spanning the sequences of selected proteins and peptides for αMI-domain binding. (A) Peptide libraries derived from the sequences of human cathepsin G, elastase, azurocidin, proteinase 3, human myeloperoxidase, connective tissue growth factor (CCN1), protein C, soybean trypsin inhibitor (SBTI), bone syaloprotein (BSP), and ovomucoid were screened for αMI-domain binding. The numbers indicate the peptide (spot) numbers. (B) Peptide libraries derived from the sequences of mammalian and non-mammalian antimicrobial peptides: bovine bactenecin 5, human HNP-1, human cathelicidin LL-37, fruit fly drosocin, polyphemusin from American horseshoe crab, pig tritrpticin, and human β-defensin 1 (BD-1). IDR-1 (innate defense regulator 1) is a synthetic peptide.58 The libraries were constructed as described in Experimental Procedures, and αMI-domain binding was examined as described in Experimental Procedures.

The αMI-domain bound to only a subset of peptides in each library, thus providing an internal control for specificity (Figure 1A). αMI-domain binding peptides were present in all libraries tested, with no obvious pattern in their distribution within the scans. However, the binding peptides frequently occurred as clusters, indicating that neighboring peptides with overlapping sequences share αMI-domain binding sites. Furthermore, the frequency with which the αMI-domain binding peptides occurred in different libraries varied. Peptide libraries derived from predicted nonligands contain the smallest number of binders (e.g., BSP in Figure 1A). On the basis of their ability to bind the αMI-domain, as assessed by densitometry and visual inspection, the peptides were grouped into three populations: strong binders (196), good binders (462), and nonbinding (748).

Distribution of Amino Acids within the αMI-Domain Binding Peptides

We analyzed the relative occurrence of the 20 amino acids in 1406 peptides representing the entire library. The distribution of amino acids within the library was similar to that found in natural proteins (Figure 2A), except that Ala and Lys were less frequent (~1.4-fold) and Arg was more frequent (1.4-fold). The higher frequency of occurrence of Arg probably reflects the fact that established αMβ2 ligands such as elastase, myeloperoxidase, and azurocidin and the predicted ligand cathepsin G are cationic proteins that are unusually enriched with this amino acid. The distribution of amino acids in the αMI-domain binding and nonbinding peptides deviated substantially from that in the total library. As shown in Figure 2B, peptides that bind the αMI-domain strongly were enriched with basic residues Arg and Lys (~2–2.5-fold) and somewhat enriched with the large hydrophobic residues Leu, Ile, Phe, Val, and Met (~1.1–1.5-fold). While the increase in each hydrophobic residue was small, the combined enrichment was ~2-fold (Figure S1A of the Supporting Information). Negatively charged residues were strongly disfavored, and polar residues His, Asn, Gln, and Cys were depleted (~2.7-fold) (Figure 2B and Figure S1A of the Supporting Information). A similar trend existed in the population of good binders; basic residues were over-represented up to ~1.4-fold, whereas hydrophobic residues were enriched to the same degree as in strong binders (not shown). In contrast, nonbinding peptides were enriched in negatively charged and polar amino acids (Figure 2C and Figure S1B of the Supporting Information), whereas basic residues were strongly disfavored and hydrophobic residues slightly disfavored. Furthermore, Tyr was enriched in strong (Figure 2B) but not in nonbinding peptides (Figure 2C). In agreement with these findings and our previously published data,27 the basicity of peptides was consistent with their ability to bind the αMI-domain; the positively charged peptides exhibited the highest affinity for the αMI-domain, whereas neutral peptides had lower affinity. Negatively charged peptides were not active. Furthermore, the role of hydrophobic residues is illustrated by the finding that only simultaneous mutation of basic and hydrophobic residues in peptides constituting the γC library ablated αMI-domain binding.27

Figure 2.

Figure 2

Amino acid distribution in αMI-domain binding and nonbinding peptides. (A) Relative occurrence of all amino acids in 1406 peptides derived from 16 protein sequences (Table 1) that represent the entire library (gray bars) compared with that in protein sequences derived from the protein databases58,59 (black bars). The frequency of each amino acid in the group of strong αMI-domain binders (B) and nonbinding peptides (C) was calculated as a percentage of its occurrence in the whole peptide library (100%, dashed line). The data for each amino acid in strong binding and nonbinding peptides were obtained for each protein shown in Table 1 and presented as means ± the standard deviation. P values are given for comparison across the entire library. Statistical analyses were performed using a Student’s t test. *p < 0.05; **p < 0.01.

Identification of the αMI-Domain Recognition Motif (IRM)

Apart from being enriched with basic and hydrophobic residues, the αMI-domain binders displayed significant variability in amino acid sequences with no obvious consensus motif. However, we noted that hydrophobic residues often existed in the immediate proximity of basic residues forming small cores composed of three to five residues. The nature of these clusters and the amino acids involved in αMI-domain binding were determined by computational analyses of 196 strong binders. A list of strong binders is given in Table S1 of the Supporting Information. As shown in Table 2, the relative occurrence of various motifs in which hydrophobic residues surround basic residues was ~3.5–7.0-fold higher in the population of αMI-domain binding peptides than in nonbinding peptides. It is noteworthy that the αMI-domain binders contain uncommon combinations of amino acids in which basic residues are surrounded by one or two hydrophobic residues on both sides. For example, the occurrence of a rare motif HyHyBHyHy in which four hydrophobic residues flank basic residues on both sides (motif 10) was 6.2-fold higher in binders than in nonbinding peptides. Likewise, motif 9 (HyBHyHy) occurred 7 times more often in the population of strong binders than in nonbinding peptides. Even simple combinations such as BHy or HyB were ~5 times more frequent in the population of αMI-domain binders. Furthermore, strong binders often contained several short motifs. Analyses indicated that ~80% of all hydrophobic residues in the population were assembled into individual cores that were no more than two residues from basic residues. Hydrophobic residues were found more frequently at positions −1 and +1 than at positions −2 and +2 (Figure 3). For example, Ile and Met occurred 3.2- and 5.8-fold more often, respectively, in the immediate neighborhood of basic residues than at the secondary positions. Specific positioning of hydrophobic residues within the cores was not detected with the exception of that of Met, which was abundant at the −1 position (Figure 3). The positioning of the small basic/hydrophobic cores within 9-mer peptides does not appear to be important. Although the population of strong binders was enriched with Tyr (1.2-fold), which occurred slightly more frequently at the −3 position, no other preferences for this residue were noted. These analyses suggest that the principal feature of the αMI-domain recognition motif (IRM) is a short sequence composed of a central basic residue surrounded by hydrophobic residues.

Table 2.

Occurrence of Motifs Composed of Basic and Hydrophobic Residues in αMI-Domain Binding and Nonbinding Peptidesa

1 2 3 4 5 6 7 8 9 10
0 +1 −1 0 0 +1 +2 −2 −1 0 −1 0 +1 −2 −1 0 +1 −1 0 +1 +2 −2 −1 0 +1 −1 0 +1 +2 −2 −1 0 +1 +2
B Hy Hy B B X Hy Hy X B Hy B Hy Hy Hy B X X B Hy Hy Hy Hy B Hy Hy B Hy Hy Hy Hy B Hy Hy
strong binders 83 (4.6) 83 (5.5) 70 (3.5) 74 (5.7) 33 (5.5) 21 (5.3) 24 (4.8) 11 (5.5) 14 (7.0) 3.1 (6.2)
nonbinders 18 15 20 13 6 4 5 2 2 0.5
a

Numbers shown are the frequencies of occurrence of a particular motif in the population. Numbers in parentheses show the increase (x-fold) of each motif in the population of strong binders compared to the population of nonbinding peptides. B denotes basic residues Arg and Lys; Hy is any hydrophobic residue, and X is any residue (except Asp or Glu).

Figure 3.

Figure 3

Frequency of hydrophobic residues at the specified positions around basic residues in the population of strong αMI-domain binders. The relative occurrence of hydrophobic residues at the −2, −1, +1, and +2 positions around basic residues (Arg or Lys; set as “0”) in the population of strong αMI-domain binders (196 peptides) is given as a percentage. Although Pro was slightly depleted in the population, it was frequently found in the vicinity of basic residues and, therefore, was included in the analyses. The small hydrophobic amino acid Ala is not included.

Identification of the αMI-Domain Binding Motif by Phage Display

We also determined the αMI-domain binding sequences by an independent approach. Affinity panning of libraries of bacteriophages that display random peptide sequences at the N-terminus of protein pIII was used to characterize peptides that bind the αMI-domain. Because peptides containing at least six residues are sufficient for efficient binding to the αMI-domain, we chose to pan the phage library that displays 7-mer peptides. The library was incubated with the immobilized αMI-domain, and the bound phage were isolated using elution with the P2-C peptide. This approach is based on the finding that P2-C inhibits binding of the αMI-domain not only to fibrinogen (from which this peptide is derived) but also to many other ligands. After the three rounds of panning, the sequences of the inset of 26 clones were determined. Sequencing data demonstrated that six clones contained the ARLPIWF sequence, two clones contained ARLPLLW, two contained SMKPLWT, and one contained GRLPMPW, all of which resemble the most abundant ARLPIWF motif. Although there were no other apparent consensus sequences, seven clones with affinity for the αMI-domain contained the sequences in which Arg and Lys were flanked by hydrophobic residues (LTMPMIR, MAPHVRS, AATKLAF, LEPFFHR, SFRXVSP, AKQPFFW, and APHQXRS). The remaining clones contained no basic residues but were enriched with hydrophobic amino acids, especially Leu and Phe (data not shown). Only one Glu and one Asp were detected among 26 sequences. The sequences of inserts derived from phages eluted from PVA were enriched with Ser, Thr, and Gln and had no similarity. PVA is typically used as a postcoat in solid-phase binding assays with the αMI-domain and adhesion assays with αMβ2-expressing cells. These analyses indicate that the sequences revealed by phage display conform to the IRM pattern determined in the analyses of strong binders from peptide libraries.

Development of the Algorithm Predicting αMI-Domain Binding Sites

To further analyze the substrate binding preferences of αMβ2, we developed the αMI-domain recognition motif algorithm (IRMA), which allows the prediction of αMI-domain binding sites in naturally occurring protein sequences and synthetic peptides. The IRMA is based on scoring the statistical energy contributions of each amino acid in the nine residues constituting the proposed αMI-domain binding motif. The segment composed of nine residues was chosen arbitrarily, but its size is justified by findings that continuous stretches of that length are enriched in small cores composed of basic and hydrophobic residues and that their composition deviates significantly from that of the total library (Table 2). Although 6-mer peptides have the potential to bind the αMI-domain, this ability is realized only if they do not contain acidic residues. In contrast, 9-mer peptides can bind the αMI-domain even if they contain acidic residues, although as a rule the presence of each acidic residue needs to be compensated by an additional basic residue. The energy values were derived from the fold difference in the overall occurrence of each residue within strong binders and nonbinding peptides (Table S2 of the Supporting Information). We then wrote a computer program to calculate the combined energy value for any sequence present in the nanopeptides. This value serves as a measure of probability that the αMI-domain binds this sequence: the lower the energy, the higher the likelihood that the sequence binds the αMI-domain. As shown in Figure 4, the energy values obtained for most of the population of strong binders ranged from −18 to +2, and those for the general population of nonbinding peptides ranged from −2 to +20. A small population of peptides (~1%) displayed energy values that were either below or above these limits. The energy distribution within a pool of good binders (range from −8 to +8) fell between these two groups (Figure S2 of the Supporting Information). On the basis of these data, correct prediction is difficult for peptides with energy values between −2 and +8, but outside of this “gray area”, the ability to predict that a peptide binds (or does not bind) the αMI-domain is high.

Figure 4.

Figure 4

Distribution of energy values in populations of αMI-domain binding and nonbinding peptides. The energy distribution in populations of strong (—) and nonbinding (---) αMI-domain peptides was calculated as a percentage of the total peptides in each population.

To test the quality of the IRMA, we determined the energy distribution within peptide libraries covering the sequences of αMβ2 ligands and compared them with experimental data. Within protein sequences, the algorithm scans for the energy minima that represent the regions with the highest probability of αMI-domain binding. As shown in Figure 5 for the γC domain of fibrinogen, there was an excellent correlation between the energy minima and the experimentally found αMI-domain binding sites.27 It is noteworthy that several overlapping peptides encompassing the P2 sequence (spots 76–82) had the lowest energy values. Likewise, the strongest cluster in the scan of CCN1 [spots 91–96 (Figure 1A)] contains the peptide 305SSVKKYRPKYCGS317, a previously identified binding site for αMβ2,25 and had the lowest energy value. Similar relationships were obtained for all ligands tested, suggesting that a length of nine residues is optimal for predicting the majority of sites.

Figure 5.

Figure 5

Energy distribution within the peptide library spanning the γC domain of fibrinogen. (A) αMI-domain binding to the peptide scan derived from the γC domain of fibrinogen (residues γ148–411) described previously.27 (B) The 9-mer peptide library of the γC domain shown in panel A with segments having the lowest energy values highlighted in gray. (C) Energy value for each 9-mer peptide in the library calculated using the developed algorithm (shown on the ordinate). The position of each peptide in the library is shown on the abscissa. Peptides with negative energy values correspond to αMI-domain binding peptides (the spots in panel A), whereas those with positive energy values do not bind the αMI-domain.

Localization of the αMI-Domain Binding Sequences within Native Protein Structures

To determine the localization of identified αMI-domain binding sequences within native folded protein structures, we mapped the sequences onto the corresponding three-dimensional structures of neutrophil cationic proteins (see Table 1 for the PDB entries). Only continuous stretches composed of several strong binders were analyzed. αMI-domain binding sequences were found in segments representing different secondary structure elements, with a slightly higher frequency of occurrence in the exposed loops (52% of segments analyzed) than in α-helices (20%) and β-strands (28%). These analyses suggest that the αMI-domain does not have strong preferences for specific structural motifs. Although some of the αMI-domain recognition segments were partially or completely buried within the protein cores, many side chains of critical basic and hydrophobic residues constituting the binding sites were well exposed (shown for cathepsin G in Figure S4 of the Supporting Information). It should be noted that the high percentage of αMI-domain binding sequences found in exposed loops might reflect the fact that the proteins included in the analyses are cationic proteins.

Peptides Derived from Peptide Libraries and Phage Display Inhibit αMI-Domain Binding

We next examined whether the αMI-domain binding peptides identified in the scans of various proteins and by phage display block αMI-domain binding. We also examined the relationship between the energy values of peptides predicted by the IRMA and their inhibitory activities. Selected 9-mer peptides corresponding to sequences derived from several proteins and covering a range of energy values were synthesized by traditional Fmoc chemistry and tested in solid-phase binding assays (Table 3). In addition, two 7-mer peptides revealed by phage display, ARLPIWF and GRLPMPW, were synthesized. Many of the selected peptides inhibited αMI-domain binding in a dose-dependent manner. As shown in Table 3, their inhibitory activities varied widely with the highest potency (i.e., lowest IC50 values) observed for peptides with the lowest calculated energy values. The peptide RKLRSLWRR (MP-9) derived from myeloperoxidase (21.3 kJ/mol) was the most potent and, on a molar basis, ~12-fold more active than P2-C.24,27 A strong relationship between the peptides’ activities and their calculated energy scores was observed for the group of peptides with energy values in the range of approximately −20 to approximately −7 kJ/mol (Figure S3 of the Supporting Information). As expected, the peptides with higher energy scores were weak inhibitors (Table 3 and Figure S3 of the Supporting Information) and no significant correlation between the peptides’ activities and their energy scores was noted. The difference between the two groups of peptides showing a biphasic character of the relationship between inhibitory potencies and energy scores remains to be determined. The peptides that displayed positive energy values were inactive.

Table 3.

Inhibitory Potencies of the αMI-Domain Binding Peptides Derived from the Peptide and Phage Display Librariesa

peptide origin IC50 (μM) ΣE (kJ/mol)b
RKLRSLWRR myeloperoxidase 2.5 ± 0.2 −21.3
QVLRIRKRA protein C 8.4 ± 0.5 −15.5
LQLRFPRFV cathepsin G 10.5 ± 1.6 −11.0
KYRLTYAFAG fibrinogen 12.6 ± 1.5 −9.3
ARLPIWF phage displayc 17 ± 3 −6.8
TMKIIPFNRLTIG (P2-C) fibrinogen 30 ± 2.5 −6.7
GRLPMPW phage displayc 36 ± 7 −3.8
NRLLLTG chaperone ligandd 110 ± 16 −2.9
SVNKYRGTAGNA fibrinogen 93 ± 11 −1.9
GWTVFQKRLDGS (P1) fibrinogen 72 ± 4 −0.12
LLHNYGVYT protein C 25% inhibitione 0.14
GDDPSDKFF fibrinogen no inhibition 15.1
a

Different concentrations of each peptide were preincubated with αMI-domain-GST, and the mixture was added to microtiter plates coated with human fibrinogen D fragment (1 μg/mL). The inhibitory potencies of the peptides are presented as molar concentrations required for 50% inhibition (IC50).

b

The combined energy value for each sequence was calculated as described in Experimental Procedures.

c

Peptide sequences derived from phage display analyses.

d

A commonly used chaperone ligand.45

e

At 200 μM.

To corroborate studies with isolated αMI-domains using whole receptors, we tested myeloperoxidase-derived peptide MP-9 for its ability to block adhesion of αMβ2-expressing cells. The peptide inhibited adhesion in a dose-dependent manner with IC50 values of ~10 and 3.5 μM for αMβ2-expressing HEK293 and U937 monocytic cells, respectively. On a molar basis, MP-9 was an ~4-fold more potent inhibitor of U937 cell adhesion than P2-C. MP-9 also directly supported strong cell adhesion (data not shown).

Binding of the αMI-Domain to Cationic Antimicrobial Peptides

The cationic nature of host defense peptides and the abundance of hydrophobic residues in their highly variable sequences suggest that they may contain αMI-domain binding sites. To investigate this possibility, we applied the developed algorithm to search the Antimicrobial Peptide Database (http://aps.unmc.edu/AP/main.html). The search revealed that numerous antimicrobial peptides, especially those with a net positive charge of >5, contain multiple IRMs. To confirm that these molecules interact with the αMI-domain, we synthesized peptide libraries covering the sequences of selected mammalian and non-mammalian host defense peptides, including human cathelicidin peptide LL-37, HNP-1, hBD-1, bovine bactenecin 5, fruit fly drosocin, pig tripticin, horseshoe crab polyphemusin, and the synthetic derivative IDR-1 (innate defense regulator) (Table 1). Figure 1B provides examples of selected peptides and shows that they all interacted with the αMI-domain at multiple sites. Notably, many peptides, such as LL-37 and bactenecin 5, contained long uninterrupted stretches of αMI-domain binding sequences.

The Human Cathelicidin LL-37 Peptide Induces αMβ2-Mediated Responses in Monocytes

We next examined the ability of cationic host defense peptides to bind the receptor using the human cathelicidin peptide LL-37 (Figure 6A), an important host defense peptide that is produced by phagocytic and epithelial cells.35 The protective effect of LL-37 seen in vivo36 has been ascribed to its immunomodulatory properties, including the ability to induce a chemotactic response, release of cytokines, gene expression, and activation of intracellular signaling in human monocytes (reviewed in refs 37 and 38). We analyzed whether any of these responses are mediated by αMβ2. As shown in Figure 6B, LL-37 induced a chemotactic response in U937 monocytic cells that was inhibited by the function-blocking anti-αM mAb 44a. LL-37 also induced migration of αMβ2-expressing HEK293 cells in a Transwell system (Figure 6C). This response was dependent on LL-37 concentration, occurred at low (0.1–2 μg/mL) LL-37 concentrations (Figure 6D), and was inhibited by function-blocking anti-αM mAb 44a and anti-β2 mAb IB4 but not by nonblocking anti-αM mAb OKM1 (Figure 6C). LL-37 did not induce migration of macrophages isolated from αMβ2-deficient mice, suggesting that the loss of αMβ2 is specific for the function of LL-37 (Figure 6E). As a control, αMβ2-deficient macrophages migrated to fMLP. The ability of LL-37 to induce αMβ2-mediated cell migration is reminiscent of that of the P2-C peptide, which duplicates the binding site for αMβ2 in fibrinogen.26 It is noteworthy though that LL-37 is the first naturally occurring bioactive peptide shown to bind αMβ2.

Figure 6.

Figure 6

LL-37 promotes functional responses in monocytes via integrin αMβ2. (A) Sequence of LL-37 with the αMI-domain recognition motifs underlined. (B) Migration of U937 monocytoid cells along the gradient of LL-37 in the absence (top) or presence (bottom) of function-blocking anti-αM mAb 44a. Cells were added to the spots marked by crosses. The direction of cell migration toward the agarose gel impregnated with 15 μg/mL LL-37 is shown above the figure (arrow), and the gradient of LL-37 is shown at the bottom. The edges of the gel in panels c and f are marked by dashed lines. Cell migration was determined after 2 h at 37 °C. In the absence of blocking mAb 44a (a), cells moved toward the LL-37 concentration gradient (b) and some cells arrived at the edge of the agarose gel (c). In contrast, no cell migration was detected in the presence of anti-αM mAb 44a (d–f). Photographs were taken using a 20× objective. A schematic representation of the experimental design is shown at the right. (C) Migration of αMβ2-expressing HEK293 cells to LL-37 (0.5 μg/mL) in a Transwell system. As indicated, cells in the upper wells were pretreated with 20 μg/mL anti-αM mAb 44a, anti-β2 mAb IB4, or mAb OKM1. Migration data are expressed as mean cells/view ± the standard error from three or more experiments. Three asterisks denote medium alone. (D) Dose-dependent migration of αMβ2-expressing HEK293 cells toward LL-37. (E) Migration of thioglycolate-elicited macrophages isolated from the peritoneum of wild-type and αMβ2-deficient mice to LL-37 (1 μg/mL) and fMLP (100 nM). (F) LL-37-induced expression of the activation-dependent epitope in the αMI-domain. Neutrophils were pretreated with fMLP (200 nM) or different concentrations of LL-37 and then incubated with a conformation-dependent mAb CBRM1/5. Epitope expression was assessed by flow cytometry. Selected cells were pretreated with NIF (1 μg/mL) before the addition of LL-37 (4 and 10 μg/mL) followed by mAb CBRM1/5.

To investigate the possibility that LL-37 is capable of inducing an activated state of αMβ2, we assessed the reactivity of LL-37-treated neutrophils with mAb CBRM1/5, which specifically recognizes an activation-dependent epitope in the αMI-domain.39 As shown in Figure 6F, LL-37 induced expression of the CBRM1/5 epitope in a concentration-dependent manner. The number of cells expressing the activation epitope induced by 10 μg/mL LL-37 was slightly higher than that stimulated by fMLP. When neutrophils were first incubated with the neutrophil inhibitory factor (NIF), a specific inhibitor that blocks ligand binding to the αMI-domain, and then treated with LL-37, no binding of CBRM1/5 was detected (Figure 6F). These data indicate that binding of LL-37 to αMβ2 induces receptor activation and initiates leukocyte migration.

DISCUSSION

By analyzing a large number of sequences present in peptide and phage libraries, we identified the binding motif(s) for the αMI-domain responsible for the broad ligand recognition exhibited by integrin αMβ2. This motif is defined by the following general features. First, the αMI-domain recognizes short (6–9-mer) sequences enriched with basic and hydrophobic residues that contain small cores consisting of a central basic residue flanked by hydrophobic residues. The motifs recognized by the αMI-domain are best described as HyBHy, HyHyBHy, HyBHyHy, and HyHyBHyHy patterns in which Hy is any hydrophobic residue and B is Arg or Lys. These motifs are enriched 5–7-fold in the population of the αMI-domain binding compared to nonbinding peptides. Motifs in which one of the hydrophobic residues is substituted for any other residue except Asp and Glu are also good αMI-domain binders. Motifs such as BXHy, HyXB, HyHyBX, and XBHyHy (where X is any residue) are enriched 4–7-fold in the population of αMI-domain binders. Second, acidic residues are strongly disfavored. Third, hydrophobic residues occur more frequently in the immediate neighborhood of basic residues, i.e., at the −1 and +1 positions, than at the −2 and +2 positions. Fourth, the presence of several basic residues in the 9-mer strongly increases the likelihood of αMI-domain binding. Fifth, the absence (or strong depletion) of acidic and hydrophilic residues in the regions flanking the 9-mer recognition sequence increases its probability of serving as an αMI-domain binding site. Thus, the αMI-domain recognition motif is a relatively small segment and has a high degree of redundancy in the hydrophobic residues that surround critical basic residues. These characteristics are consistent with the capacity of αMβ2 to recognize a wide variety of unrelated sequences and thus form the basis for αMβ2 ligand binding promiscuity.

The finding that the presence of basic and hydrophobic amino acids is an important feature of the αMI-domain binding peptides supports and extends our earlier studies with fibrinogen24,27 and CCN125 as well as the localization of αMβ2 recognition sequences reported in other studies. For example, the identification of the αMI-domain recognition motif explains the ability of αMβ2 to bind LYQAKRFKV or SSVKKYRPKYCGS, the peptides derived from Factor X.40 Although the αMβ2 binding nanopeptide CPCFLLGCC (LLG-C4) derived from phage display41 does not contain basic residues, the presence of a Phe-Leu-Leu hydrophobic core may account for its capacity to interact with αMβ2. It is interesting that several negatively charged peptides tested in our scans (1.8%) bound the αMI-domain and were anomalously enriched with Leu (2.6-fold) and Trp (3.7-fold). However, LLG-C4 was also shown to interact with the monospecific integrin αLβ2, whereas typical αMβ2 ligands, such as P2-C (γTMKIIPFFNRLTIG), do not.5 Therefore, the presence of basic residues appears to endow the peptide sequences with recognition activity toward αMβ2. Although Ile, Leu, Phe, Val, and Met are enriched in the αMI-domain binding peptides, no apparent dominant hydrophobic residues were identified and no specific positioning of hydrophobic residues (except for methionine at the −1 position) has been noted (Figures 2B and 3). However, we cannot exclude the possibility that some hydrophobic residues are more important than others, and further studies of their contribution, as well as that of aromatic residues, are needed to dissect structural features of the αMI-domain recognition motif.

The nature of the αMI-domain recognition motif (IRM) explains why the capacity of αMβ2 to bind proteins increases dramatically after their chemical or thermal denaturation4 or after their unfolding as a consequence of adsorption to plastic surfaces:4,42 the IRMs are rich in hydrophobic residues whose side chains are normally buried in the interior of folded proteins, and protein unfolding results in the exposure of such sequences. This behavior is exemplified by P2-C, which is part of the β-sheet in the γC domain of fibrinogen. This sequence is hidden in the soluble intact protein but becomes unmasked as a result of its unfolding upon adsorption onto various surfaces or during deposition in the extracellular matrix.42,43 The masking of potential αMI-domain binding sites in the interior of folded proteins could, at least in part, explain the observation that many intact soluble ligands bind poorly to αMβ2-expressing cells in suspension but support efficient adhesion when presented to the receptor in an immobilized form.

The recognition specificity of the αMI-domain is remarkably reminiscent of that of molecular chaperones, especially those belonging to the Hsp70 family.28,44 This finding supports the original proposal by Davies4 that αMβ2’s ability to bind unfolded proteins shares similarities with that of chaperones. Molecular chaperones represent one of several biological systems in which promiscuity in ligand binding plays important roles. Chaperones assist in protein folding in the cell by transient association with a large variety of short hydrophobic sequences that are generally accessible only in non-native conformers. Although differences exist with respect to the positioning of basic residues within the hydrophobic patch, the general requirements regarding size, the presence of basic and hydrophobic residues, and the exclusion of negatively charged residues appear to be comparable for the αMI-domain and chaperone sequences. It is noteworthy that NRLLLTG, a classic chaperone peptide45,46 binds the αMI-domain (Table 3) and inhibits αMβ2-mediated cell adhesion. The basis for this activity is likely to be the presence of Arg and adjacent leucines at the +1 and +2 positions. Notably, NRLLLTG closely resembles γ390NRLTIG395, the αMI-domain recognition motif within P2-C,24,34 which has been confirmed as the αMβ2 binding site in fibrinogen by genetic manipulation in mice.47,48 The overlap in recognition specificity between αMβ2 and chaperons is not entirely unexpected because both proteins prefer unfolded conformers as their substrates. However, they are involved in opposite processes: while chaperones recognize peptide sequences to ensure their correct folding, the αMI-domain binds to sequences that are exposed in denatured unfolded conformers.

The characteristics of IRM also explain why many neutrophil cationic proteins, including elastase, myeloperoxidase, and azurocidin, are αMβ2 ligands. As illustrated here for cathepsin G (Figure S4 of the Supporting Information), the side chains of many critical basic and adjacent hydrophobic residues within the αMI-domain binding clusters are exposed on the surface of these proteins, which probably explains why these proteins bind αMβ2 even when presented to the receptor in soluble form. Indeed, free myeloperoxidase released from stimulated neutrophils during inflammation binds neutrophils through an αMβ2-dependent mechanism.49 We propose that other cationic proteins that are normally sequestered in granules of resting neutrophils can also bind αMβ2 after their release upon cell activation.

Our analyses of the αMI-domain binding preferences allowed us to develop an algorithm that predicts the αMI-domain binding sites in αMβ2 ligands with a high degree of accuracy. This information, in conjunction with the crystal structure when available, may be useful for the prediction of sequences that are displayed on the surface of proteins and potentially serve as αMI-domain binding sites. The algorithm also appears to be reliable in predicting the potency of αMI-domain binding peptides. Its application has already uncovered several peptides with affinities for the αMI-domain several-fold higher than that previously reported for fibrinogen peptide P2-C (Table 3). This could be important in the search for antagonists because in vivo modulation of αMβ2 can be effective in limiting inflammatory injury (reviewed in ref 50). Finally, application of the algorithm to search the Antimicrobial Peptide Database51 revealed that numerous mammalian and non-mammalian cationic peptides contain αMI-domain recognition patterns and can potentially bind αMβ2 (Figure 1B). The prediction that one of the host defense peptides, human cathelicidin LL-37, binds αMβ2 was confirmed experimentally.

Previous studies have demonstrated that LL-37 triggers migration of neutrophils and monocytes and induces activation of MAP kinases, production of chemokines, gene expression, and degranulation of mast cells (reviewed in refs 37 and 38). The finding that LL-37 contains multiple αMI-domain binding sites provides new insights into the mechanisms by which LL-37 may elicit numerous immunomodulatory responses. The mechanism by which LL-37 exerts leukocyte-modulating effects has been controversial. Although the direct chemotactic activity of LL-37 was attributed to G-protein-coupled fMLP-like receptor 1,52 many other responses induced by this peptide in monocytes are independent of G-protein-coupled receptors. 38 The finding that migration of U937 monocytic cells in response to LL-37 is blocked by αMβ2 reagents (Figure 6) indicates that αMβ2 is the LL-37 receptor that triggers a migratory signal in these cells.

The αMβ2 binding specificity revealed in this study may have broad biological implications and provides a basis for new investigations into the biology of this integrin. First, because of its central role in neutrophil and macrophage biology and its significance as a validated therapeutic target for inflammatory diseases, αMβ2 is the subject of intensive research. As a result, the list of αMβ2 ligands grows every year and may include many biologically irrelevant molecules. The nature of the αMI-domain recognition motif suggests that the extensive collection of αMβ2 ligands might simply reflect the receptor’s potential to bind sequences exposed by protein denaturation. Immobilization of proteins on plastic surfaces, which represents a standard method for testing a protein’s capacity to serve as a potential integrin’s ligand, inevitably leads to protein unfolding and unmasking of the αMI-domain binding segments that are normally buried inside the protein’s three-dimensional structure. Our findings suggest that some of the ligands that have been identified on the basis of their ability to support αMβ2-mediated adhesion may need to be re-evaluated in terms of their physiological relevance.

Second, the identification of the αMI-domain recognition motif may help to identify new molecules that repel αMβ2 and thus render surfaces antiadhesive for phagocytic leukocytes, an important biomaterial application. Third, because many integrins exhibit promiscuity in ligand binding, it will be interesting to determine whether the principles governing αMβ2 ligand promiscuity are shared by other members of the integrin family. Fourth, the connection between the αMI-domain and chaperones is intriguing. Although the similarities in recognition specificity displayed by both molecules endow them with the ability to recognize diverse ligands, how these recognition principles evolved is unknown.

Finally, the nature of the αMI-domain recognition motif suggests that αMβ2 ligands may serve as alarm/danger signals. It has been proposed that proteins released by damaged or dead cells alarm the immune system.53,54 The original “danger” model postulated that segments of proteins that are initially buried inside the folded molecules, especially their hydrophobic portions, would function as alarm signals upon being exposed.53 Consequently, if a cell is disrupted, the hydrophobic sequences of nascent proteins synthesized on ribosomes, which are normally bound to chaperones, will be exposed. The characteristics of the αMI-domain recognition sequences with their abundance of hydrophobic and positively charged residues, their resemblance to the segments recognized by chaperones, and an enormous diversity of αMI-domain binding sequences are consistent with the idea that αMβ2 is an alarm/danger-sensing molecule, or the so-called “alarmin” receptor. The term alarmin was initially coined to include activities of cathelicidin LL-37, defensins, HMGB 1, and eosinophil-derived neurotoxin (EDN), which, despite their diverse structures, all have chemotactic and activating effects on leukocytes.55 Moreover, the three of these are αMβ2 ligands (Figure 1 and ref 13). As an extension of the “alarm/danger” model, we propose that neutrophil cationic proteins and peptides that are sequestered in granules of resting neutrophils and secreted during the immune-inflammatory response would also qualify as alarmins. Indeed, myeloperoxidase activates neutrophils via αMβ2-dependent MAPK activation,49 and azurocidin induces Ca2+ mobilization in monocytes via β2 integrins, most likely αMβ2.56 Thus, it is reasonable to assume that any intracellular molecule that carries the IRMs and is released from damaged cells during tissue injury might be an alarmin that signals through the αMβ2 receptor. The recently reported HMGN1 (high-mobility nucleosome binding protein 1) is an alarmin57 and also a potential αMβ2 ligand (Figure S5 of the Supporting Information). Although several receptors have been implicated in triggering alarmin responses in leukocytes,55 αMβ2 is the first molecule for which a common recognition pattern present in a large and diverse group of alarmin molecules has been identified.

In summary, we have revealed the molecular basis for the broad ligand specificity exhibited by integrin αMβ2, solving the long-standing puzzle of why ligand binding by this receptor is driven by protein denaturation. Furthermore, the elucidation of recognition specificity of αMβ2 led to several conjectures. The prediction that the host defense peptide LL-37, which harbors several IRMs, triggers immunomodulatory responses via αMβ2 has been confirmed experimentally. Another proposal, based partly on experimental evidence (Figure 1B), predicts that host defense peptides constitute a new class of αMβ2 ligands. The newly solved αMI-domain recognition motif could be used to identify molecules that are induced in injured tissues and might act as alarmins through activation of αMβ2.

Supplementary Material

Figure S1,S2,S3,S4, and S5. Table S1 and S2

Acknowledgments

Funding

This work was supported by National Institutes of Health Grant HL 63199.

We thank Dr. V. Yakubenko and Peter Ryabokon for technical assistance with screening phage libraries and Dr. Xu Wang (Department of Chemistry and Biochemistry, Arizona State University) for help with analyses of protein structures.

Footnotes

Notes

The authors declare no competing financial interest.

Supporting Information

Five supplementary figures and two supplementary tables. This material is available free of charge via the Internet at http://pubs.acs.org.

References

  • 1.Coxon A, Rieu P, Barkalow FJ, Askari S, Sharpe AH, Von Andrian UH, Arnaout MA, Mayadas TN. A novel role for the β2 integrin CD11b/CD18 in neutrophil apoptosis: A homeostatic mechanism in inflammation. Immunity. 1996;5:653–666. doi: 10.1016/s1074-7613(00)80278-2. [DOI] [PubMed] [Google Scholar]
  • 2.Ding ZM, Babensee JE, Simon SI, Lu HF, Perrard JL, Bullard DC, Dai XY, Bromley SK, Dustin ML, Entman ML, Smith CW, Ballantyne CM. Relative contribution of LFA-1 and Mac-1 to neutrophil adhesion and migration. J Immunol. 1999;163:5029–5038. [PubMed] [Google Scholar]
  • 3.Prince JE, Brayton CF, Fosset MC, Durand JA, Kaplan SL, Smith CW, Ballantyne CM. The differential roles of LFA-1 and Mac-1 in host defense against systemic infection with Streptococcus pneumoniae. J Immunol. 2001;166:7362–7369. doi: 10.4049/jimmunol.166.12.7362. [DOI] [PubMed] [Google Scholar]
  • 4.Davis GE. The Mac-1 and p150,95 β2 integrins bind denatured proteins to mediate leukocyte cell-substrate adhesion. Exp Cell Res. 1992;200:242–252. doi: 10.1016/0014-4827(92)90170-d. [DOI] [PubMed] [Google Scholar]
  • 5.Yakubenko VP, Lishko VK, Lam SCT, Ugarova TP. A molecular basis for integrin αMβ2 ligand binding promiscuity. J Biol Chem. 2002;277:48635–48642. doi: 10.1074/jbc.M208877200. [DOI] [PubMed] [Google Scholar]
  • 6.Diamond MS, Staunton DE, de Fougerolles AR, Stacker SA, Garcia-Aguilar J, Hibbs ML, Springer TA. ICAM-1 (CD54): A counter-receptor for Mac-1 (CD11b/CD18) J Cell Biol. 1990;111:3129–3139. doi: 10.1083/jcb.111.6.3129. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Simon DI, Chen ZP, Xu H, Li CQ, Dong JF, McIntire LV, Ballantyne CM, Zhang L, Furman MI, Berndt MC, López JA. Platelet glycoprotein Ibα is a counterreceptor for the leukocyte integrin Mac-1 (CD11b/CD18) J Exp Med. 2000;192:193–204. doi: 10.1084/jem.192.2.193. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Santoso S, Sachs UJ, Kroll H, Linder M, Ruf A, Preissner KT, Chavakis T. The junctional adhesion molecule 3 (JAM-3) on human platelets is a counterreceptor for the leukocyte integrin Mac-1. J Exp Med. 2002;196:679–691. doi: 10.1084/jem.20020267. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Cai TQ, Wright SD. Human leukocyte elastase is an endogenous ligand for the integrin CR3 (CD11b/CD18, Mac-1, αMβ2) and modulates polymorphonuclear leukocyte adhesion. J Exp Med. 1996;184:1213–1223. doi: 10.1084/jem.184.4.1213. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Johansson MW, Patarroyo M, Oberg F, Siegbahn A, Nilsson K. Myeloperoxidase mediates cell adhesion via the αMβ2 integrin (Mac-1, CD11b/CD18) J Cell Sci. 1997;110:1133–1139. doi: 10.1242/jcs.110.9.1133. [DOI] [PubMed] [Google Scholar]
  • 11.Lishko VK, Novokhatny V, Yakubenko VP, Skomorovska-Prokvolit H, Ugarova TP. Characterization of plasminogen as an adhesive ligand for integrins αMβ2(Mac-1) and α5β1(VLA-5) Blood. 2004;104:719–726. doi: 10.1182/blood-2003-09-3016. [DOI] [PubMed] [Google Scholar]
  • 12.Zirlik A, Maier C, Gerdes N, MacFarlane L, Soosairajah J, Bavendiek U, Ahrens I, Ernst S, Bassler N, Missiou A, Patko Z, Aikawa M, Schonbeck U, Bode C, Libby P, Peter K. CD40 ligand mediates inflammation independently of CD40 by interaction with Mac-1. Circulation. 2007;115:1571–1580. doi: 10.1161/CIRCULATIONAHA.106.683201. [DOI] [PubMed] [Google Scholar]
  • 13.Orlova VV, Choi EY, Xie C, Chavakis E, Bierhaus A, Ihanus E, Ballantyne CM, Gahmberg CG, Bianchi ME, Nawroth PP, Chavakis T. A novel pathway of HMGB1-mediated inflammatory cell recruitment that requires Mac-1 integrin. EMBO J. 2007;26:1129–1139. doi: 10.1038/sj.emboj.7601552. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Wang H, Zhang M, Andersson U, Vishnubhakat JM, Ombrellino M, Che J, Frazier A, Yang H, Ivanova S, Borovikova L, Monogue KR, Faist E, Abraham E, Andersson J, Molina PE, Abumrad NN, Sama A, Tracey KJ. HMG-1 as a late mediator of endotoxin lethality in mice. Science. 1999;285:248–251. doi: 10.1126/science.285.5425.248. [DOI] [PubMed] [Google Scholar]
  • 15.Scaffidi P, Misteli T, Bianchi ME. Release of chromatin protein HMGB1 by necrotic cells triggers inflammation. Nature. 2002;418:191–195. doi: 10.1038/nature00858. [DOI] [PubMed] [Google Scholar]
  • 16.Lotze MT, Tracey KJ. High-mobility group box 1 protein (HMGB1): Nuclear weapon in the immune arsenal. Nat Rev Immunol. 2005;5:331–342. doi: 10.1038/nri1594. [DOI] [PubMed] [Google Scholar]
  • 17.Diamond MS, Garcia-Aguilar J, Bickford JK, Corbí AL, Springer TA. The I domain is a major recognition site on the leukocyte integrin Mac-1 (CD11b/CD18) for four distinct adhesion ligands. J Cell Biol. 1993;120:1031–1043. doi: 10.1083/jcb.120.4.1031. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Yalamanchili P, Lu CF, Oxvig C, Springer TA. Folding and function of I domain-deleted Mac-1 and lymphocyte function-associated antigen-1. J Biol Chem. 2000;275:21877–21882. doi: 10.1074/jbc.M908868199. [DOI] [PubMed] [Google Scholar]
  • 19.Zhang L, Plow EF. Identification and reconstruction of the binding pocket within αMβ2 for a specific and high affinity ligand, NIF. J Biol Chem. 1997;272:17558–17564. doi: 10.1074/jbc.272.28.17558. [DOI] [PubMed] [Google Scholar]
  • 20.Zhang L, Plow EF. Amino acid sequences within the α subunit of integrin αMβ2 (Mac-1) critical for specific recognition of C3bi. Biochemistry. 1999;38:8064–8071. doi: 10.1021/bi990141h. [DOI] [PubMed] [Google Scholar]
  • 21.Yakubenko VP, Solovjov DA, Zhang L, Yee VC, Plow EF, Ugarova TP. Identification of the binding site for fibrinogen recognition peptide γ383–395 within the αM I-domain of integrin αMβ2. J Biol Chem. 2001;275:13995–14003. doi: 10.1074/jbc.M010174200. [DOI] [PubMed] [Google Scholar]
  • 22.Schober JM, Chen N, Grzeszkiewicz T, Emeson EE, Ugarova TP, Ye RD, Lau LF, Lam SCT. Identification of integrin αMβ2 as an adhesion receptor on peripheral blood monocytes for Cyr61 and connective tissue growth factor, immediate-early gene products expressed in atherosclerotic lesions. Blood. 2002;99:4457–4465. doi: 10.1182/blood.v99.12.4457. [DOI] [PubMed] [Google Scholar]
  • 23.Altieri DC, Plescia J, Plow EF. The structural motif glycine 190-valine 202 of the fibrinogen γ chain interacts with CD11b/CD18 integrin αMβ2 (Mac-1) and promotes leukocyte adhesion. J Biol Chem. 1993;268:1847–1853. [PubMed] [Google Scholar]
  • 24.Ugarova TP, Solovjov DA, Zhang L, Loukinov DI, Yee VC, Medved LV, Plow EF. Identification of a novel recognition sequence for integrin αMβ2 within the γ-chain of fibrinogen. J Biol Chem. 1998;273:22519–22527. doi: 10.1074/jbc.273.35.22519. [DOI] [PubMed] [Google Scholar]
  • 25.Schober JM, Lau LF, Ugarova TP, Lam SC. Identification of a novel integrin αMβ2 binding site in CCN1 (Cyr61), a matricellular protein expressed in healing wounds and atherosclerotic lesions. J Biol Chem. 2003;278:25808–25815. doi: 10.1074/jbc.M301534200. [DOI] [PubMed] [Google Scholar]
  • 26.Forsyth CB, Solovjov DA, Ugarova TP, Plow EF. Integrin αMβ2-mediated cell migration to fibrinogen and its recognition peptides. J Exp Med. 2001;193:1123–1133. doi: 10.1084/jem.193.10.1123. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Lishko VK, Podolnikova NP, Yakubenko VP, Yakovlev S, Medved L, Yadav SP, Ugarova TP. Multiple binding sites in fibrinogen for integrin αMβ2 (Mac-1) J Biol Chem. 2004;279:44897–44906. doi: 10.1074/jbc.M408012200. [DOI] [PubMed] [Google Scholar]
  • 28.Rudiger S, Germeroth L, Schneider-Mergener J, Bukau B. Substrate specificity of the DnaK chaperone determined by screening cellulose-bound peptide libraries. EMBO J. 1997;16:1501–1507. doi: 10.1093/emboj/16.7.1501. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Kramer A, Keitel T, Winkler K, Stocklein W, Hohne W, Schneider-Mergener J. Molecualr basis for the binding promiscuity of an anti-p24 (HIV-1) monoclonal antibody. Cell. 1997;91:799–809. doi: 10.1016/s0092-8674(00)80468-7. [DOI] [PubMed] [Google Scholar]
  • 30.Knoblauch NTM, Rudiger S, Schonfeld HJ, Driessen AJM, Schneider-Mergener J, Bukau B. Substrate specificity of the SecB chaperone. J Biol Chem. 1999;274:34219–34225. doi: 10.1074/jbc.274.48.34219. [DOI] [PubMed] [Google Scholar]
  • 31.Ugarova TP, Budzynski AZ. Interaction between complementary polymerization sites in the structural D and E domains of human fibrin. J Biol Chem. 1992;267:13687–13693. [PubMed] [Google Scholar]
  • 32.Kramer A, Schneider-Mergener J. Synthesis and screening of peptide libraries on continuous cellulose membrane supports. Methods Mol Biol. 1998;87:25–39. doi: 10.1385/0-89603-392-9:25. [DOI] [PubMed] [Google Scholar]
  • 33.Lishko VK, Yakubenko VP, Ugarova TP. The interplay between Integrins αMβ2 and α5β1 during cell migration to fibronectin. Exp Cell Res. 2003;283:116–126. doi: 10.1016/s0014-4827(02)00024-1. [DOI] [PubMed] [Google Scholar]
  • 34.Ugarova TP, Lishko VK, Podolnikova NP, Okumura N, Merkulov S, Yakubenko VP, Yee VC, Lord ST, Haas TA. Sequence 377–395 (P2), but not γ190–202(P1), is the binding dite for the αMI-domain of integrin αMβ2 in the γC-domain of fibrinogen. Biochemistry. 2003;42:9365–9373. doi: 10.1021/bi034057k. [DOI] [PubMed] [Google Scholar]
  • 35.Zanetti M. The role of cathelicidins in the innate host defenses of mammals. In: Gallo RL, editor. Antimicrobial peptides in human health and disease. Horizon Bioscience; Norfolk, U.K: 2005. pp. 15–50. [Google Scholar]
  • 36.Scott MG, Hancock REW. Cationic antimicrobial peptides and their multifunctional role in the immune system. Crit Rev Immunol. 2000;20:407–431. [PubMed] [Google Scholar]
  • 37.Finlay BB, Hancock REW. Can innate immunity be enhanced to treat microbial infections? Nat Rev Microbiol. 2004;2:497–504. doi: 10.1038/nrmicro908. [DOI] [PubMed] [Google Scholar]
  • 38.Mookherjee N, Hancock REW. Cationic host defense peptides: Innate immune regulatory peptides as a novel approach for treating infections. Cell Mol Life Sci. 2007;64:922–933. doi: 10.1007/s00018-007-6475-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Oxvig C, Lu C, Springer TA. Conformational changes in tertiary structure near the ligand binding site of an integrin I domain. Proc Natl Acad Sci USA. 1999;96:2215–2220. doi: 10.1073/pnas.96.5.2215. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Mesri M, Plescia J, Altieri DC. Dual regulation of ligand binding by CD11b I domain. Inhibition of intercellular adhesion and monocyte procoagulant activity by a factor X-derived peptide. J Biol Chem. 1998;273:744–748. doi: 10.1074/jbc.273.2.744. [DOI] [PubMed] [Google Scholar]
  • 41.Koivunen E, Ranta TM, Annaila A, Taube S, Uppala A, Jokinen M, van Willigen G, Gahmberg CG. Inhibition of β2 integrin-mediated leukocyte adhesion by leucine-leucine-glycine motif-containing peptides. J Cell Biol. 2001;153:905–915. doi: 10.1083/jcb.153.5.905. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Lishko VK, Kudryk B, Yakubenko VP, Yee VC, Ugarova TP. Regulated unmasking of the cryptic binding site for integrin αMβ2 in the γC-domain of fibrinogen. Biochemistry. 2002;41:12942–12951. doi: 10.1021/bi026324c. [DOI] [PubMed] [Google Scholar]
  • 43.Scott EA, Elbert DL. Mass spectrometric mapping of fibrinogen conformations at poly(ethylene terephtalate) interfaces. Biomaterials. 2008;28:3904–3917. doi: 10.1016/j.biomaterials.2007.05.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Rudiger S, Schneider-Mergener J, Bukau B. Its substrate specificity characterizes the DNA co-chaperone as a scanning factor for the DnaK chaperone. EMBO J. 2001;20:1042–1050. doi: 10.1093/emboj/20.5.1042. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Gragerov A, Zeng L, Zhao X, Burkholder W, Gottesman ME. Specificity of DnaK-peptide binding. J Mol Biol. 1994;235:848–854. doi: 10.1006/jmbi.1994.1043. [DOI] [PubMed] [Google Scholar]
  • 46.Rudiger S, Buchberger A, Bukau B. Interaction of Hsp70 chaperones with substrates. Nat Struct Biol. 1997;4:342–349. doi: 10.1038/nsb0597-342. [DOI] [PubMed] [Google Scholar]
  • 47.Flick MJ, Du X, Witte DP, Jirouskova M, Soloviev DA, Plow EF, Degen JL. Leukocyte engagement of fibrin(ogen) via the integrin receptor αMβ2/Mac-1 is critical for host inflammatory response in vivo. J Clin Invest. 2004;113:1596–1606. doi: 10.1172/JCI20741. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Flick MJ, LaJeunesse CM, Talmage KE, Witte DP, Palumbo JS, Pinkerton MD, Thornton S, Degen JL. Fibrin(ogen) exacerbates inflammatory join disease through a mechanism linked to the integrin αMβ2 binding motif. J Clin Invest. 2007;117:3224–3235. doi: 10.1172/JCI30134. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Lau D, Mollnau H, Eiserich J, Freeman BA, Daiber A, Gehling UM, Brummer J, Rudolph V, Munzel T, Heitzer T, Meinertz T, Baldus S. Myeloperoxidase mediates neutrophil activation by association with CD11b/CD18 integrins. Proc Natl Acad Sci USA. 2005;102:431–436. doi: 10.1073/pnas.0405193102. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Park JY, Arnaout MA, Gupta V. A simple, no wash cell adhesion-based high-throughput assay for the discovery of small-molecule regulators of the integrin CD11b/CD18. J Biomol Screening. 2007;12:406–417. doi: 10.1177/1087057106299162. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Antimicrobial Peptide Database. ( http://aps.unmc.edu/AP/main.html)
  • 52.Yang D, Chen Q, Schmidt AP, Anderson GM, Wang JM, Wooters J, Oppenheim JJ, Chertov O. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J Exp Med. 2000;192:1069–1074. doi: 10.1084/jem.192.7.1069. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Matzinger P. The danger model: A renewed sense of self. Science. 2002;296:301–305. doi: 10.1126/science.1071059. [DOI] [PubMed] [Google Scholar]
  • 54.Seong SY, Matzinger P. Hydrophobicity: An ancient damage-associated molecular pattern that initiates innate immune responses. Nat Rev Immunol. 2004;4:469–478. doi: 10.1038/nri1372. [DOI] [PubMed] [Google Scholar]
  • 55.Oppenheim JJ, Yang D. Alarmins: Chemotactic activators of immune responses. Curr Opin Immunol. 2005;17:359–365. doi: 10.1016/j.coi.2005.06.002. [DOI] [PubMed] [Google Scholar]
  • 56.Soehnlein O, Xie X, Ulbrich H, Kenne E, Rotzius P, Flodgaard H, Eriksson EE, Lindbom L. Neutrophil-derived heparin-binidng protein (HBP/CAP37) deposited on endothelium enhances monocyte arrest under flow conditions. J Immunol. 2005;174:6399–6405. doi: 10.4049/jimmunol.174.10.6399. [DOI] [PubMed] [Google Scholar]
  • 57.Yang D, Postnikov YV, Li Y, Tewary P, de la Rosa G, Wei F, Klinman D, Giovanni T, Weiss JP, Furusawa T, Bustin M, Oppenheim JJ. High-mobility group nucleosome-bindign protein 1 acts as an alarmin and is critical for lipopolysaccharide-induced immune responses. J Exp Med. 2012;209:157–171. doi: 10.1084/jem.20101354. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Klapper MH. The independent distribution of amino acid near neighbor pairs into polypeptides. Biochem Biophys Res Commun. 1977;78:1018–1024. doi: 10.1016/0006-291x(77)90523-x. [DOI] [PubMed] [Google Scholar]
  • 59.Coeytaux K, Poupon A. Prediction of unfolded segments in a protein sequence based on amino acid composition. Bioinformatics. 2005;21:1891–1900. doi: 10.1093/bioinformatics/bti266. [DOI] [PubMed] [Google Scholar]
  • 60.Diamond MS, Staunton DE, Marlin SD, Springer TA. Binding of the integrin Mac-1 (CD11b/CD18) to the third immunoglobulin-like domain of ICAM-1 (CD54) and its regulation by glycosylation. Cell. 1991;65:961–971. doi: 10.1016/0092-8674(91)90548-d. [DOI] [PubMed] [Google Scholar]
  • 61.Cai TQ, Wright SD. Human leukocyte elastase is an endogenous ligand for the integrin CRR3 (CD11b/CD18, Mac-1, αMβ2) and modulates polymorphonuclear leukocyte adhesion. J Exp Med. 1996;184:1213–1223. doi: 10.1084/jem.184.4.1213. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Scott MG, Dullaghan E, Mookherjee N, Glavas N, Waldbrook M, Thompson A, Wang A, Lee K, Doria S, Hamill P, Yu JJ, Li Y, Donini O, Guarna MM, Finlay BB, North JR, Hancock REW. An anti-infective peptide that selectively modulates the innate immune response. Nat Biotechnol. 2007;25:465–472. doi: 10.1038/nbt1288. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Figure S1,S2,S3,S4, and S5. Table S1 and S2

RESOURCES