Skip to main content
Clinical and Vaccine Immunology: CVI logoLink to Clinical and Vaccine Immunology: CVI
. 2015 Aug 26;22(9):1060–1069. doi: 10.1128/CVI.00271-15

Synthetic Long Peptide Derived from Mycobacterium tuberculosis Latency Antigen Rv1733c Protects against Tuberculosis

Mariateresa Coppola 1, Susan J F van den Eeden 1, Louis Wilson 1, Kees L M C Franken 1, Tom H M Ottenhoff 1, Annemieke Geluk 1,
Editor: D W Pascual
PMCID: PMC4550671  PMID: 26202436

Abstract

Responsible for 9 million new cases of active disease and nearly 2 million deaths each year, tuberculosis (TB) remains a global health threat of overwhelming dimensions. Mycobacterium bovis BCG, the only licensed vaccine available, fails to confer lifelong protection and to prevent reactivation of latent infection. Although 15 new vaccine candidates are now in clinical trials, an effective vaccine against TB remains elusive, and new strategies for vaccination are vital. BCG vaccination fails to induce immunity against Mycobacterium tuberculosis latency antigens. Synthetic long peptides (SLPs) combined with adjuvants have been studied mostly for therapeutic cancer vaccines, yet not for TB, and proved to induce efficient antitumor immunity. This study investigated an SLP derived from Rv1733c, a major M. tuberculosis latency antigen which is highly expressed by “dormant” M. tuberculosis and well recognized by T cells from latently M. tuberculosis-infected individuals. In order to assess its in vivo immunogenicity and protective capacity, Rv1733c SLP in CpG was administered to HLA-DR3 transgenic mice. Immunization with Rv1733c SLP elicited gamma interferon-positive/tumor necrosis factor-positive (IFN-γ+/TNF+) and IFN-γ+ CD4+ T cells and Rv1733c-specific antibodies and led to a significant reduction in the bacterial load in the lungs of M. tuberculosis-challenged mice. This was observed both in a pre- and in a post-M. tuberculosis challenge setting. Moreover, Rv1733c SLP immunization significantly boosted the protective efficacy of BCG, demonstrating the potential of M. tuberculosis latency antigens to improve BCG efficacy. These data suggest a promising role for M. tuberculosis latency antigen Rv1733c-derived SLPs as a novel TB vaccine approach, both in a prophylactic and in a postinfection setting.

INTRODUCTION

Despite the availability of a vaccine and chemotherapeutic agents, tuberculosis (TB) remains the second leading cause of death from an infectious disease worldwide, annually causing around 9 million new cases and almost 2 million deaths (1). The highest burdens are found in low-income regions: Africa harbors about 25% of the world's TB cases and more than half have been counted in Asia (1). Furthermore, surveys with tuberculin skin tests (TST) suggest that one-third of the world's population is latently infected with Mycobacterium tuberculosis, which constitutes a huge reservoir with a 3 to 10% lifetime risk of developing TB (1, 2).

It has long been recognized that the efficacy of vaccination with Mycobacterium bovis BCG, still the only registered TB vaccine, can be enhanced by a booster or replacement vaccine protecting against reactivating TB from latency (3). M. tuberculosis latency antigens (Ags), encoded by the DosR regulon, are upregulated in vitro under conditions that tubercle bacilli are thought to encounter in vivo during persistence in immunocompetent hosts (4) and in mouse models for latent M. tuberculosis infection (LTBI) (5). This discovery caused a change in focus in the search for a novel antigen(s) able to enhance long-term vaccine efficacy. Various human cohort studies showed preferential recognition of DosR-encoded proteins, in particular Rv1733c, Rv2029c, Rv2627c, and Rv2628, by T cells from individuals with LTBI and to a lesser extent by TB patients (69). Also, latency antigens can induce CD4+ and CD8+ T cells in TST-converted individuals who were infected with M. tuberculosis decades ago in the preantibiotic era and yet never developed TB (10, 11).

In mouse models using chronic, low-dose M. tuberculosis infection mimicking human LTBI, the preferential recognition of the DosR regulon in latent infection was further established (5) and provided evidence that BCG fails to induce a significant response to latency antigens despite their presence in the BCG genome. Also, a triple fusion protein, designated H56, including the latency/starvation antigen Rv2660 coupled to the early-stage proteins Ag85B and ESAT-6, provided protection by both pre- and postinfection vaccination in nonhuman primates (12, 13). A similar improvement in long-term protection against M. tuberculosis was observed in mice after intradermal inoculation of recombinant BCG expressing the latency-associated antigens Rv2659c, Rv3407, and Rv1733c (14).

Synthetic long peptides (SLPs), administered with adjuvants, are proven efficient vaccines for tumor therapy (1519). Despite the success of this vaccine strategy, SLPs have not yet been applied to design new TB vaccines. Recognition of cognate antigen presented by either T cells or B cells will lead to an abortive proliferative response and death of the responding T cells.

The immunogenicity of Rv1733c, which was the most commonly recognized latency antigen in M. tuberculosis-exposed household contacts from South Africa, Gambia, and Uganda (9), as well as the improved long-term protection against M. tuberculosis in mice by BCG expressing Rv1733c (14), prompted us to investigate the potential of Rv1733c-derived SLPs as vaccines for TB.

Our previous work has shown that HLA-DRB polymorphism controls human T-cell responsiveness (20). In this respect, HLA-DR3, a major class II allele that is present in 20% of the human population, is associated with strong T-cell activity to mycobacterial Ags, in vitro and in vivo, and with high-responder (tuberculoid) leprosy (21). Since HLA transgenic (tg) mice are efficient models to study HLA-restricted T-cell responses to mycobacteria in vivo (2224), SLP vaccine efficacy was tested in vivo in the context of HLA-DR3. For this purpose, we investigated the potency of an Rv1733c-derived SLP in inducing protection in mice and demonstrate an SLP-based vaccine strategy for TB inducing CD4+ T cells that confer protection against a live M. tuberculosis challenge in mice in a prophylactic as well as a postinfection fashion.

MATERIALS AND METHODS

Recombinant proteins.

M. tuberculosis genes were amplified by PCR from genomic DNA of M. tuberculosis and cloned using the Gateway technology platform (Invitrogen, Carlsbad, CA) with pDEST17 expression vector containing an N-terminal histidine tag (Invitrogen) (25). Sequencing was performed on selected clones to confirm the identities of all cloned DNA fragments. Recombinant proteins were overexpressed in Escherichia coli BL21(DE3) and purified as described previously to remove any traces of endotoxin (25). For production of recombinant Rv1733c, which is composed of a 210-amino-acid (aa) protein, including two predicted transmembrane regions (aa 44 to 66 and aa 164 to 186), the 5′ and 3′ parts of the gene outside the transmembrane region were amplified by PCR using oligonucleotides overlapping the DNA sequence from aa 67 to 163. These PCR products were subsequently used as oligonucleotides to fuse the N-terminal and C-terminal parts with the internal part, resulting in a PCR product without the predicted transmembrane region which was cloned as described above for other recombinant proteins.

Each purified recombinant protein (Fig. 1) was analyzed by 12% SDS-PAGE followed by Coomassie brilliant blue staining and Western blotting with an anti-His antibody (Ab) (Invitrogen) to confirm size and purity. Endotoxin contents were below 50 EU (endotoxin units) per mg recombinant protein as tested using a Limulus amebocyte lysate (LAL) QCL-1000 assay (Lonza Inc., Basel, Switzerland). Recombinant proteins were tested to exclude protein-nonspecific T-cell stimulation and cellular toxicity in gamma interferon (IFN-γ) release assays using peripheral blood mononuclear cells (PBMCs) of in vitro-purified protein derivative (PPD)-negative, healthy Dutch donors recruited at the Blood Bank Sanquin, Leiden, The Netherlands. None of these controls had experienced any known prior contact with TB patients.

FIG 1.

FIG 1

Amino acid sequences of Rv1733c synthetic long peptides (SLPs).

Synthetic peptides.

Rv1733c p63-77 (16-mer; AGTAVQDSRSRHVYAH), Rv1733c p61-80 (20-mer; AAAGTAVQDSRSHVYAHQAQ), the synthetic long peptide (SLP) Rv1733c p57-84 (28-mer; IPFAAAAGTAVQDSRSHVYAHQAQTRHP), Rv1733c SLP1-SLP13 (Fig. 1), Ag85B p131-162 (AMILAAYHPQQFIYAGSLSALLDPSQGMGP), and Ag85B p143-152 (FIYAGSLSAL) were purchased from Peptide 2.0 Inc. (Chantilly, VA, USA). Homogeneity and purity were confirmed by analytical high-pressure liquid chromatography (HPLC) and by mass spectrometry. Purity of all peptides was ≥80%. All impurities consist of shorter versions of the peptides caused by <100% coupling efficiency in each round of synthesis.

HLA-DR3 tg mice.

HLA-DRB1*0301/DRA transgenic (tg), murine class II-deficient (HLA-DR3.Ab0) mice were generated as detailed previously (23, 26). Briefly, cosmids carrying HLA-DRA and HLA-DRB1*0301 genes were coinjected into (C57BL/6 × DBA/2)F1 × C57BL/6 embryos and backcrossed to C57BL/10 mice. The HLA-DR3 specificity was introduced into murine class II-negative mice by mating the H2.Ab0 strain (27) with HLA-DR3.B10.M mice (28), as described for HLA-DQ8.Ab0 mice (29). The HLA-DR3.Ab0 mice used in this study were backcrossed for 10 generations with C57BL/10 mice and eventually intercrossed. The resulting mice therefore are considered C57BL/10 congenic. Mice were bred under specific-pathogen-free conditions at the Leiden University Medical Center (LUMC) animal facility. During breeding, PBMCs of each mouse were typed for expression and segregation of the transgene by flow cytometry for HLA-DR (fluorescein isothiocyanate [FITC]-labeled mouse IgG2 κ anti-HLA-DR clone L243; BD 555811; BD Biosciences, Franklin Lakes, NJ, USA) and murine CD4 (phycoerythrin [PE]-Cy5-labeled rat IgG2a, κ anti-mouse CD4 clone H129.19; BD 553654; BD Biosciences; and PE-labeled mouse [BALB/c] IgG2a κ anti-mouse I-Ab, clone AF6-120.1; BD 553552; BD Biosciences). Littermates lacking HLA-DR expression, designated HLA-DR3neg mice, were used as negative controls.

HLA-DR3.A2 tg mice were generated by mating the HLA-DR3.Ab0 with HLA-A2 tg mice, B6.Cg-Tg (HLA-A/H2-D)Enge/J stock no. 004191; The Jackson Laboratory, Bar Harbor, ME, USA (24, 30).

Immunizations.

Mice (4 to 6 animals per group; 6 weeks old) were injected subcutaneously (s.c.) three times with 50 μg CpG (oligodeoxynucleotide [ODN] 1826, 5′-TCC ATG ACG TTC CTG ACG TT-3′; InvivoGen, San Diego, CA) in 200 μl phosphate-buffered saline (PBS) in the right flank at 2-week intervals in combination with either 25 μg recombinant Rv1733c protein, Rv1733c p63-77 (40 nmol), or Rv1733c p57-84 (40 nmol). Control mice were injected s.c. with 106 CFU of BCG 1331 (M. bovis bacillus Calmette Guérin; Statens Serum Institut, Copenhagen, Denmark) from frozen ampoules. Splenocytes were harvested 7 to 10 days after final injections. Since ODNs containing unmethylated CpG motifs can activate immune cells to produce cytokines (31), we routinely immunized with CpG alone as a (negative) control to assess the antigen specificity of immunization. Since immunization with peptide alone did not cause appreciable responses, mixtures of CpG adjuvant with antigen were routinely used.

Infection with live M. tuberculosis and determination of bacterial burden.

Naive and immunized mice (5 animals per group) were infected with live M. tuberculosis strain H37Rv 2 weeks after the third antigen immunization or 12 weeks after BCG immunization. Mice were anesthetized with isoflurane [2-chloro-2-(difluoromethoxy)-1,1,1-trifluoroethane; Pharmachemie BV, Haarlem, The Netherlands] and intranasally (i.n.) infected with 105 CFU of M. tuberculosis from frozen ampoules. Mice were sacrificed 6 weeks after M. tuberculosis challenge, and spleen and lungs were aseptically removed. The organs were homogenized in sterile PBS, and the number of bacteria was determined by culturing serial dilutions of the homogenates on 7H11 agar plates (BD Biosciences) supplemented with BD BBL Middlebrook oleic acid-albumin-dextrose-catalase (OADC) enrichment (100 ml per bottle; BD Biosciences), PANTA (BD Biosciences; 1 vial per liter containing polymyxin B [6,000 units], amphotericin B [600 μg], nalidixic acid [2,400 μg], trimethoprim [600 μg], azlocillin [600 μg]), and ampicillin (3.4 mg/ml; Vepidan, Denmark). Colonies were counted after 3 weeks of incubation at 37°C. In the case of animals that received M. tuberculosis infection combined with BCG vaccination, 7H11 agar plates containing 2-thiophene carboxylic acid hydrazide (2 μg/ml; Sigma) were used to distinguish BCG colonies from M. tuberculosis colonies. Protective efficacies are expressed as log10 bacterial counts in immunized mice compared to BCG-immunized mice.

In vitro cultures.

Splenocytes were isolated from individual animals by homogenizing spleens through a plastic cell strainer (BD Bioscience), and splenocytes (3 × 106 cells/ml) were resuspended in Iscove's modified Dulbecco's medium (IMDM) (Invitrogen) supplemented with 2 mM l-glutamine (Invitrogen), 100 U/100 μg/ml penicillin-streptomycin solution (Invitrogen), 8% heat-inactivated fetal calf serum (FCS), and 5 × 10−5 M β-mercaptoethanol (Sigma). Cell suspensions (100 μl) were added to 96-well round-bottom microtiter plates (Costar; Corning Incorporated). Cells were incubated in quadruplicate with 100 μl of medium, peptide (1 or 10 μg/ml), or recombinant protein (1 or 10 μg/ml). The mitogen concanavalin A (ConA; 2 μg/ml; Sigma) was used in all experiments as a positive control for cell viability. After 6 days, supernatants were taken from each well and quadruplicates were pooled and frozen at −20°C until performance of enzyme-linked immunosorbent assays (ELISAs).

IFN-γ ELISA.

Before ELISAs were performed on supernatants from M. tuberculosis-infected murine material, supernatants or sera were transferred into 0.2-μm filter plates (Corning, NY, USA) and centrifuged for 3 min at 1,300 rpm. The filtered material was collected in clean 96-well plates and transferred out of the biosafety level 3 (BSL3) lab for further analyses. Detection of IFN-γ in culture supernatants of in vitro-cultured splenocytes was performed by ELISA (BD Biosciences) according to the manufacturer's instructions. Optical density (OD) values were converted into concentrations using Microplate Manager software, version 5.2.1 (Bio-Rad Laboratories, Veenendaal, The Netherlands). The cutoff value to define positive responses was set beforehand at 100 pg/ml. The assay sensitivity level was 20 pg/ml. Values for unstimulated whole-blood cultures were typically <30 pg/ml.

Intracellular cytokine staining.

For polychromatic flow cytometry, splenocytes (3 × 106 cells/ml) were cultured in vitro with peptide (5 μg/ml). After 6 days, cells were incubated with medium or fresh peptide (5 μg/ml). After 1 h, brefeldin A (Sigma; 5 μg/ml) was added. After 5 h, cells were permeabilized and fixed using Cytofix/Cytoperm (BD Bioscience) and Perm/Wash (BD Bioscience) according to the manufacturer's instructions and stained using phycoerythrin (PE)-conjugated anti-CD8β2 (BD Pharmingen), PE-Cy5-conjugated anti-CD4 (BD Pharmingen), ebioV405-conjugated anti-CD19 (eBioscience), Vivid (Invitrogen), allophycocyanin (APC)-conjugated anti-interleukin-2 (anti-IL-2) (BD Pharmingen), Alexa Fluor 700-conjugated anti-IFN-γ (BD Pharmingen), and PE-Cy7-conjugated anti-tumor necrosis factor (anti-TNF) (BD Pharmingen).

HLA-DR3/Rv1733c p63-77 tetramer staining.

Phycoerythrin (PE)-conjugated HLA-DRB1*03/Rv1733c p63-77 tetrameric complexes (HLA-DR3/p63-77 TM) were purchased from W. Kwok (Benaroya Research Institute, Seattle, WA). Splenocytes were stained for 1 h at room temperature (RT) in PBS-0.1% bovine serum albumin (BSA) with HLA-DR3/p63-77 TM (2 μl/500,000 cells), FITC-conjugated anti-CD4 (BD Pharmingen; 50 μl; 1:100), and propidium iodide (Sigma; 50 μl; 1:2000).

In vivo cytotoxicity assay.

Analysis of immunization-induced in vivo killing was performed as described previously (24, 32): erythrocytes in splenocyte suspensions, derived from unimmunized mice, were lysed with ammonium chloride treatment, and the single-cell suspension was split into two equal fractions. Each fraction was differentially labeled at 37°C for 10 min with carboxyfluorescein succinimidyl ester (CFSE; Invitrogen, Carlsbad, CA) in PBS with 0.1% BSA as target cells (CFSEhigh; 5 μM) or control cells (CFSElow; 0.02 μM). The reaction was stopped by addition of FCS (Invitrogen) to a final concentration of 10% (vol/vol). The target population was pulsed for 2 h with 5 μg/ml Rv1733c p63-77 (in HLA-DR3 tg mice) or Ag85B p143-152 (in HLA-A2 tg mice), and the control population remained unpulsed. Cells were washed four times with PBS before the two populations were mixed at a 1:1 ratio, and a total of 15 × 106 cells was injected intravenously in the tail of M. tuberculosis antigen-immunized mice. After 2 days, spleens were removed and the ratio of CFSElow to CFSEhigh cells was determined by flow cytometry. Specific killing of pulsed CFSEhigh target cells was calculated as follows: [1 − (CFSEhigh/CFSElow)] × 100%.

Ethics statement.

Handling of mice was conducted in compliance with European Community Directive 86/609 for the care and use of laboratory animals and in accordance with the regulations set forward by the LUMC animal care committee.

Welfare monitoring.

Animals were observed daily to fulfill ethics requirements and to monitor any adverse effects possibly related to vaccinations. M. tuberculosis-infected mice were weighed once a week.

Statistical analysis.

GraphPad Prism (version 5) software was used for statistical analysis. Bacterial titers were analyzed by the Mann-Whitney U test. In vitro cytokine levels were compared using Student's t test. P values of ≤0.05 were considered significant.

RESULTS

Rv1733c SLP induces high levels of IFN-γ-producing, Rv1733c-specific CD4+ T cells in vivo.

Previously, the in vivo immunogenicity of the HLA-DR3-restricted 15-mer Rv1733c p63-77 was investigated in the context of a multistage polyepitope (18). Based on the 15-mer Rv1733c p63-77 as well as the presence of strong HLA-DR3 binding motifs (33), we constructed the 28-mer Rv1733c p57-84 (Fig. 1) for application of SLP vaccination in HLA-DR3 tg mice. First, Rv1733c p57-84/CpG immunization was used to assess the immunogenicity of Rv1733c-derived, shorter peptides that still contained the HLA-DR3 peptide binding motif. Analysis of intracellular IFN-γ production by splenocytes in response to 6 h of stimulation with equimolar amounts of Rv1733c p63-77 (15-mer), Rv1733c p61-80 (20-mer), and Rv1733c p57-84 (28-mer) showed intracellular IFN-γ production for all peptides with an optimum for the 15-mer Rv1733c p63-77 (Fig. 2A). Immunization of 12 other overlapping SLPs in CpG (28-mers; Fig. 1) covering Rv1733c did not show any significant responses in HLA-DR3 tg mice (data not shown).

FIG 2.

FIG 2

(A) Rv1733c p57-84/CpG immunization of HLA-DR3 tg mice. Splenocytes derived from mice immunized with SLP Rv1733c p57-84 in CpG were stimulated in vitro with equimolar amounts of Rv1733c p63-77 (15-mer), p61-80 (20-mer), and p57-84 (28-mer) for 6 h. The percentage of CD4+ IFN-γ-producing cells (indicated in each figure) was analyzed by intracellular cytokine staining. (B and C) Rv1733c p57-84/CpG immunization of HLA-DR3 tg mice. Splenocytes derived from mice immunized with Rv1733c p57-84/CpG (B) or with Rv1733c p63-77/CpG (C) were stimulated in vitro with Rv1733c p63-77 (15-mer), p61-80 (20-mer), and p57-84 (28-mer) (0.1-μg/ml or 1.0-μg/ml final concentration). After 6 days, IFN-γ production was analyzed by ELISA. ConA was used as a positive control for in vitro responsiveness, and recombinant protein HPV16 E6 and hsp65 p1-13 (59) were used as negative protein and peptide controls, respectively. (D) Frequency of polyfunctional CD4+ T cells. Percentages of IFN-γ-, IL-2-, and/or TNF-producing CD4+ T cells in splenocytes of HLA-DR3 mice immunized with Rv1733c p57-84/CpG, analyzed without (left panel) or with (right panel) TNF+ cells. Splenocytes were stimulated in vitro with stimuli indicated above each graph. After 6 days, cells were incubated with fresh antigen. After 4 h, brefeldin A was added for overnight (20 h) incubation, after which cells were permeabilized, fixed, stained, and analyzed for intracellular cytokine production. Each symbol represents one mouse. Only CD4+ populations of >5 × 104 events were analyzed. No significant cytokine production was detected in naive mice or in CD8+ T cells of mice immunized with Rv1733c p57-84/CpG (data not shown). P values were calculated by the Mann-Whitney U test. (E) Frequency of HLA-DR3/p63-77 TM+ CD4+ T cells. For determination of Rv1733c p63-77-specific CD4+ T cells, splenocytes of HLA-DR3 mice immunized with CpG alone (−) or Rv1733c p57-84/CpG were stained for 1 h at RT with HLA-DR3/p63-77 TM+ and phycoerythrin-FITC-conjugated anti-CD4. Groups included four mice. All mice were separately analyzed. P values were calculated by the Mann-Whitney U test.

Comparison of IFN-γ production levels after 6-day in vitro cultures of splenocytes from mice immunized either with Rv1733c p57-84 (28-mer) or with Rv1733c p63-77 (15-mer) in CpG showed increased responses after 28-mer (SLP) immunization (Fig. 2B and C), possibly since for SLP vaccines, compared to minimal peptide vaccines, the duration of in vivo epitope presentation in the antigen-draining lymph nodes is increased and subsequently enhances IFN-γ production by effector T cells (34). These data could also indicate the requirement for processing and presentation by professional antigen-presenting cells of the 28-mer, whereas the 15-mer can be presented directly by HLA-DR+ cells, including T cells and B cells, with subsequent futile proliferative response and death of the responding T cells. Alternatively, besides including an HLA-DR3-restricted epitope, the SLP could also harbor a murine class I-restricted epitope and induce a stronger immune response by activating not only CD4+ but also CD8+ T cells to produce IFN-γ.

Induction of polyfunctional T cells in response to Rv1733c p57-84.

The induction of polyfunctional CD4+ Th1 cells likely correlates with vaccine-induced protection in several models (35, 36), despite contradictory results on their role as biomarkers of protection in M. tuberculosis infection either identifying TNF+ CD4+ T cells as specific for active TB (37) or reporting significantly higher levels of IFN-γ+/IL-2+/TNF+ CD4+ T cells in active TB (38, 39). To estimate the contribution of the frequency of cytokine-producing T cells, polyfunctional T-cell analysis was performed in Rv1733c p57-84-immunized HLA-DR3 mice using different in vitro stimuli (Fig. 2D). Splenocytes of Rv1733c p57-84-immunized HLA-DR3 showed the predominant presence of Rv1733c-specific IFN-γ+ CD4+ T cells (Fig. 2D). Since splenocytes of immunized mice stimulated in vitro with medium already produced significant amounts of TNF (data not shown), the data are depicted without TNF+ cells, demonstrating a significantly increased number of Rv1733c-specific IFN-γ+ CD4+ T cells (Fig. 2D). Spontaneous TNF production has been described in humans as well (40) and thus requires proper attention during the identification of recall T-cell responses responsible for vaccine-induced protection.

Additionally, we assessed the frequency of Rv1733c p63-77-specific, HLA-DR3-restricted CD4+ T cells, using FITC-conjugated tetramers composed of HLA-DRB1*0301 and Rv1733c p63-77 (Fig. 2E). The median of TM+/CD4+ splenocytes induced by adjuvanted Rv1733c p57-84 immunization was 1.1%. No TM+ CD4+ T cells (0.19%) were observed in splenocytes derived from HLA-DR3 mice immunized with CpG alone.

To estimate the effect of multiple SLPs combined in one vaccine, Rv1733c-specific CD4+ T-cell responses were analyzed after immunization of HLA-A2/DR3 double tg mice with a mixture of Rv1733c p57-84 together with the HLA-A2-restricted epitope Ag85B p143-152 (22) in CpG. As observed for single transgenic animals, CD8+ T cells responded only to the class I-restricted Ag85B epitope and not to the class II-restricted Rv1733c p57-84 (Fig. 3), whereas CD4+ T cells recognized only the HLA-DR3-restricted Rv1733c epitope. These data confirm the HLA-DR3 restriction of the Rv1733c SLP-induced IFN-γ response. Since IFN-γ responses to both antigens in the SLP mixture were similar to those induced by immunization with one antigen in single HLA tg mice, these data also show that the distinct SLPs did not inhibit each other's responses in HLA-A2/DR3 double tg mice.

FIG 3.

FIG 3

Intracellular IFN-γ production in immunized double transgenic mice. HLA-A2/DR3 double transgenic mice (n = 6) were immunized with the HLA-A2-restricted epitope Ag85B p143-152 (22) and the HLA-DR3-restricted epitope Rv1733c p57-84 (42) in CpG, and IFN-γ production by CD4+ T cells (upper panel) and CD8+ T cells (lower panel) in splenocytes was analyzed after 6 days of in vitro culture with medium (−) or peptides (5 μg/ml) as indicated on the x axis. Each symbol (^) indicates one mouse. P values were calculated by the Mann-Whitney U test.

Besides producing cytokines, CD4+ T cells are also known to contribute to protection by exerting cytolytic functions. Therefore, similarly immunized HLA-DR3 mice were used to determine whether Rv1733c p57-84 could induce cytotoxic T-lymphocyte (CTL) responses using in vivo cytotoxicity assays (24, 32). For this purpose, mice were immunized with CpG alone or with Rv1733c SLP combined with CpG. Rv1733c SLP immunization induced intermediate cytotoxicity levels (median, 33%) specific for Rv1733c p63-77 15-mer (Fig. 4A). In contrast, the HLA-A2 Ag85B p143-152 showed high in vivo cytotoxicity levels of 95% (Fig. 4B).

FIG 4.

FIG 4

In vivo killing induced by M. tuberculosis Ag-derived SLP. HLA-DR3 tg (A) or HLA-A2 (B) mice were left unimmunized (−) or immunized with Rv1733c p57-84 (Rv1733c SLP) (A) in CpG or Ag85B p131-162 (Ag85B SLP) (B) to determine its ability to induce specific CTLs using in vivo cytotoxicity assays. Splenocytes derived from unimmunized mice were split into two equal fractions. Each fraction was differentially labeled with CFSE (target = CFSEhigh, 5 μM; control = CFSElow, 0.02 μM). The target population was pulsed for 2 h with 5 μg/ml Rv1733c p63-77 (A) or 5 μg/ml Ag85B p143-152 (B), and the control population remained unpulsed. The two fractions were mixed in a 1:1 ratio and intravenously injected into the tails of M. tuberculosis antigen-immunized mice. After 2 days, spleens were removed and the ratio of CFSElow to CFSEhigh cells was determined by flow cytometry. Specific killing of pulsed CFSEhigh target cells was calculated as follows: [1 − (CFSEhigh/CFSElow)] × 100%. Mice immunized with CpG only did not show any in vivo cytotoxic responses (data not shown). P values were calculated by the Mann-Whitney U test.

Immunization with Rv1733c SLP induces antibodies specific for Rv1733c protein.

The paradigm that humoral immunity is not involved in the protection against TB is slowly making space for increasing evidence for antibody-mediated immunity against M. tuberculosis (41). The role of antibody (Ab) responses was previously confirmed by us in in vivo studies using HLA-A2 (24) and HLA-DR3 mice immunized with M. tuberculosis antigens (42, 43). Thus, we next investigated the humoral response induced by the Rv1733c 28-mer. Immunization with Rv1733c SLP/CpG induced high antibody titers to the peptide itself and induced antibodies to only a limited extent to the Rv1733c protein but not to the unrelated human papillomavirus 16 (HPV16) E6 recombinant protein. Mock-immunized mice, on the other hand, did not show any antibody reactivity, indicating that the Rv1733c SLP is capable of inducing cellular as well as humoral immunity (Fig. 5).

FIG 5.

FIG 5

Quantification of serum antibodies. Following immunization of HLA-DR3 tg mice with CpG alone (upper panel) or with Rv1733c p57-84/CpG (lower panel), antibody titers (OD at 450 nm [OD450]) against Rv1733c p57-84, Rv1733c, or HPV16 E6 were determined by ELISA and are shown with standard errors of the means. As a control, affinity for BSA (0.4% in PBS) alone (■) is shown. Serum dilutions are shown on the x axis. All test groups included six mice. All mice were separately analyzed.

Rv1733c SLP induces protection against live M. tuberculosis challenge in HLA-DR3 mice.

Previously, we have shown that splenocytes of M. tuberculosis-infected HLA-DR3 tg mice induced distinct IFN-γ production in response to Rv1733c p63-77, although the level was reduced compared to that obtained by stimulation with the HLA-DR3-restricted epitopes derived from secreted M. tuberculosis antigens such as Ag85B (42). To assess the vaccine potential of the Rv1733c SLP adjuvanted by CpG, its prophylactic protective effect was evaluated in a live M. tuberculosis challenge model in mice, by enumerating the CFU in the lungs (Fig. 6). As expected from the immunogenicity studies described above, Rv1733c SLP/CpG vaccination did not reduce the number of CFU in HLA-DR3neg mice (data not shown), confirming the HLA-DR restriction of the T-cell-mediated protection. Reduction of CFU required Rv1733c, since no responses were observed in mice injected with CpG alone (42).

FIG 6.

FIG 6

Determination of CFU in M. tuberculosis-infected HLA-DR3 tg mice. CFU were determined for lungs derived from M. tuberculosis-infected HLA-DR3 tg (●) mice s.c. immunized with Rv1733c p57-84 (SLP). Protective efficacies are expressed as bacterial counts. Immunization methods are indicated on the x axis. “pre” indicates final immunization 6 weeks before M. tuberculosis infection, and mice were sacrificed 6 weeks after infection; “post” indicates immunization 2, 4, and 6 weeks after M. tuberculosis infection, and mice were sacrificed 2 weeks after final immunization. BCG/SLP indicates BCG immunization followed after 6 weeks by the first of three immunizations with Rv1733c p57-84 (SLP). Median values are indicated by horizontal bars. CFU are expressed as log10 bacterial counts, each symbol indicating a single mouse. Data shown are representative for three separate experiments.

Preinfection immunization with Rv1733c recombinant protein and, to a greater extent, Rv1733c p57-84 significantly reduced the number of CFU from 3.6 × 105 to 1.4 × 105 (P = 0.002; 0.41 log) and 0.65 × 105 (P = 0.0003; 0.75 log), respectively. When protein was administered after infection, CFU reduction caused by the Rv1733c protein and SLP was still notable but significant only for the SLP (2.3 × 105 [P = 0.22] and 1.96 × 105 [P = 0.018], respectively). Interestingly, when the SLP was used to boost a prior BCG vaccination, mice boosted with Rv1733c SLP had the highest reduction (0.92 log) in bacterial load in their lungs (from 3.6 × 105 to 0.44 × 105; P = 0.0002) compared to mice vaccinated only with BCG (from 3.6 × 105 to 0.76 × 105 CFU; P = 0.0004; 0.66 log). These data indicate that SLP derived from latency-associated protein Rv1733c may have potential as a booster vaccine for TB.

DISCUSSION

Identification of M. tuberculosis antigens that induce dendritic cell (DC) activation for subsequent priming of protective CD4+ and CD8+ Th1 cell responses is important to the development of new diagnostic tools as well as TB vaccines. Antigen discovery studies have been an essential factor of mycobacterial research for over several decades (44) and were markedly expedited by the availability of the M. tuberculosis genome sequence (45). Besides the secreted antigens in clinical trials (Ag85 and ESAT-6) (3), recent studies show that M. tuberculosis proteins such as PE_PGRS proteins Rv0978c and Rv0754 (46), secreted protein Rv0577 (47), and cell wall proteins Rv3812 (48) and Rv3425 (49) recognize TLR2, induce maturation, and activate human DCs, enhancing their ability to stimulate Th1 cells. In addition, we demonstrated previously that the M. tuberculosis latency antigen Rv1733c was well recognized in diverse human populations, including those in several African regions (9). In addition, recombinant BCG expressing latency antigens showed improved long-term protection against TB in mice (14), and latency antigens can also boost the effect of BCG in nonhuman primates (13).

In the context of therapeutic vaccination, SLPs have been shown to induce better in vivo responses and protection against tumors than short peptides (16, 50). Since short peptides (8 to 11 amino acids in length) can be loaded directly onto HLA class I molecules, their presentation can take place by nonprofessional antigen-presenting cells (such as T cells or B cells) in the absence of costimulatory signals, which may lead to immunological tolerance rather than immunity. On the other hand, the use of SLP ensures that antigen processing will take place by professional antigen-presenting cells such as DCs and that epitopes can be cross presented to T cells in the context of optimal costimulation (50, 51). Furthermore, the use of SLP containing both T helper and a CTL epitope induces epitope presentation to CD4+ T cells and CD8+ T cells simultaneously. This cross presentation not only causes an increased effective immune response by generating IFN-γ from both CD4+ and CD8+ T cells but also works synergistically, as antigen-specific CD4+ T helper cells provide direct help to CD8+ T cells but also trigger DCs to activate CD8+ T cells to become granule-containing CTL effector cells. Moreover, SLPs also prolong the in vivo epitope presentation in the antigen-draining lymph nodes, which increases clonal expansion and cytokine production by effector T cells (26). Thus, conversion of minimal single epitopes to SLPs may provide an approach to increase immunogenicity. Besides these immunological advantages, however, SLPs have not yet been implemented into new TB vaccination strategies. However, vaccines aimed at treatment of established disease require long-lived presentation of epitopes by HLA on appropriately activated antigen-presenting cells, and thus, SLP would be advantageous for latently infected individuals.

HLA-DRB polymorphism plays an important regulatory role in controlling human T-cell reactivity against mycobacteria (20, 21). Previously, we demonstrated that the 15-mer Rv1733c p63-77 epitope was immunogenic in vivo either alone or as part of an HLA-DR3-restricted multistage polyepitope. Immunization with the latter adjuvanted with CpG generated high IgG levels as well as polyfunctional CD4+ T cells producing IFN-γ, TNF, and IL-2, specific for these HLA-DR3-restricted epitopes. Also, this multistage-polyepitope immunization reduced the number of bacilli in the lungs after M. tuberculosis challenge when administered as a prophylactic vaccine (18). Here, we have explored the application of SLP Rv1733c p57-84 as a novel approach in the design of new TB vaccines.

Rv1733c p57-84 conferred better protection against live M. tuberculosis challenge in HLA-DR3 transgenic mice than did the whole recombinant Rv1733c protein in a preventive setting. However, HLA-DR3neg mice showed no protection when immunized with SLP, which underscores the specificity of the protection by SLP. Furthermore, SLP booster vaccination significantly improved the protective efficacy of BCG. Since BCG is known not to induce immune responses to M. tuberculosis latency antigens (52, 53), boosting previous BCG vaccination with M. tuberculosis latency antigens is a promising and rational approach. This is supported by the above-mentioned improved long-term protection induced by recombinant BCG expressing latency antigens in mice (14) or by latency antigens as a BCG booster in nonhuman primates (13). However, since BCG does not induce detectable responses to latency antigens (53), it is conceivable that primary SLP immunization followed by BCG or simultaneous immunization with antigen and BCG (54) generates similar protection.

Since considerable numbers of individuals in developing countries are latently infected with M. tuberculosis, therapeutic vaccines preventing progression from latent to reactivated infection are essential as well. According to mathematical models, the combination of mass preexposure vaccination with postexposure vaccine administered to people with latent TB infection could prevent two-thirds of TB deaths (55). Still, the majority of TB vaccines in current clinical trials are designed for prophylactic use, and only a few studies have reported subunit vaccines in postchallenge animal models (56), including studies on the multistage H56 subunit vaccine in mice and nonhuman primates (12). Furthermore, administration of fragmented M. tuberculosis shortly (4 days) after M. tuberculosis challenge reduced the bacillary load in lungs of mice compared to BCG-vaccinated animals (57), while in a lethal M. tuberculosis challenge mouse model the ID93 vaccine lowered bacterial burden and lung pathology, which allowed shortening of the chemotherapy period (58).

In this study, we show that immunization with Rv1733c SLP p57-84 after M. tuberculosis challenge significantly improves control of already-established infection. Thus, immunization with M. tuberculosis latency antigen SLPs may also offer new tools for therapeutic vaccination against TB. In this respect, it is important to note that SLP production and purification, especially for membrane proteins such as Rv1733c, are much less complicated than those of whole proteins, offering another advantage for vaccination.

Since HLA-DR3 is present in 20% of most populations worldwide, application of SLP vaccine approaches would require expansion of the number of SLPs to accommodate epitopes for multiple HLA alleles when targeting different populations (44). Therefore, it is important to note that simultaneous immunization with two SLPs, derived from Rv1733c and Ag85B, did not affect the response to either SLP in HLA-A2/DR3 double tg mice. Thus, our data suggest that multiple SLPs, with variable HLA specificity, can be accommodated in one vaccine without loss of T-cell immunogenicity.

In view of the currently emerging evidence for a contribution of humoral immunity to M. tuberculosis infection control (41), SLP vaccines may represent a promising strategy since, besides strong T-cell immunity, also robust antigen-specific humoral responses were induced. These data are in line with our previous findings where we observed strong humoral responses against the protective IVE-TB (in vivo-expressed M. tuberculosis) antigen Rv2034 following vaccination (43). Thus, the mechanism by which Rv1733c SLP reduces the number of bacteria in murine lungs could be based on a combination of induction of CD4+ T cells (IFN-γ+/TNF+ and IFN-γ+) and Rv1733c-specific antibodies and potentially even a minor population of cytotoxic CD4+ T cells.

In conclusion, our data support the use of M. tuberculosis latency antigen-based SLP approaches as novel TB vaccination approaches, both in prophylactic and in postinfection/therapeutic settings as well as in boosting BCG.

ACKNOWLEDGMENTS

This study was supported by the Bill and Melinda Gates Foundation Grand Challenges in Global Health (GC6#74), Top Institute Pharma (project D-101-1), the European Commission EC FP7 NEWTBVAC (contract no. HEALTH.F3.2009 241745), EC FP7 ADITEC (contract no. HEALTH.2011.1.4-4 280873), EC ITN FP7 VACTRAIN (contract no. 316655), EC HORIZON2020 TBVAC2020 (contract no. 643381), and EC FP7 EURIPRED (FP7-INFRA-2012-312661).

The text represents the authors' views and does not necessarily represent a position of the Commission, who will not be liable for the use made of such information.

The authors declare themselves to have no financial/commercial conflicts of interests. T.H.M.O. and A.G. are coinventors of an M. tuberculosis latency antigen patent, which is owned by LUMC.

REFERENCES

  • 1.World Health Organization. 2014. Global tuberculosis report 2014. World Health Organization, Geneva, Switzerland. [Google Scholar]
  • 2.Stop TB Partnership. 2011. The global plan to stop TB 2011–2015. Stop TB Partnership, Geneva, Switzerland. [Google Scholar]
  • 3.Ottenhoff TH, Kaufmann SH. 2012. Vaccines against tuberculosis: where are we and where do we need to go? PLoS Pathog 8:e1002607. doi: 10.1371/journal.ppat.1002607. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK. 2003. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J Exp Med 198:705–713. doi: 10.1084/jem.20030205. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Roupie V, Romano M, Zhang L, Korf H, Lin MY, Franken KL, Ottenhoff TH, Klein MR, Huygen K. 2007. Immunogenicity of eight dormancy regulon-encoded proteins of Mycobacterium tuberculosis in DNA-vaccinated and tuberculosis-infected mice. Infect Immun 75:941–949. doi: 10.1128/IAI.01137-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Leyten EM, Lin MY, Franken KL, Friggen AH, Prins C, van Meijgaarden KE, Voskuil MI, Weldingh K, Andersen P, Schoolnik GK, Arend SM, Ottenhoff TH, Klein MR. 2006. Human T-cell responses to 25 novel antigens encoded by genes of the dormancy regulon of Mycobacterium tuberculosis. Microbes Infect 8:2052–2060. doi: 10.1016/j.micinf.2006.03.018. [DOI] [PubMed] [Google Scholar]
  • 7.Esmail H, Barry CE III, Wilkinson RJ. 2012. Understanding latent tuberculosis: the key to improved diagnostic and novel treatment strategies. Drug Discov Today 17:514–521. doi: 10.1016/j.drudis.2011.12.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Lin MY, Ottenhoff TH. 2008. Host-pathogen interactions in latent Mycobacterium tuberculosis infection: identification of new targets for tuberculosis intervention. Endocr Metab Immune Disord Drug Targets 8:15–29. doi: 10.2174/187153008783928398. [DOI] [PubMed] [Google Scholar]
  • 9.Black GF, Thiel BA, Ota MO, Parida SK, Adegbola R, Boom WH, Dockrell HM, Franken KL, Friggen AH, Hill PC, Klein MR, Lalor MK, Mayanja H, Schoolnik G, Stanley K, Weldingh K, Kaufmann SH, Walzl G, Ottenhoff TH. 2009. Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin Vaccine Immunol 16:1203–1212. doi: 10.1128/CVI.00111-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Commandeur S, Lin MY, van Meijgaarden KE, Friggen AH, Franken KL, Drijfhout JW, Korsvold GE, Oftung F, Geluk A, Ottenhoff TH. 2011. Double- and monofunctional CD4 and CD8 T-cell responses to Mycobacterium tuberculosis DosR antigens and peptides in long-term latently infected individuals. Eur J Immunol 41:2925–2936. doi: 10.1002/eji.201141602. [DOI] [PubMed] [Google Scholar]
  • 11.Riano F, Arroyo L, Paris S, Rojas M, Friggen AH, van Meijgaarden KE, Franken KL, Ottenhoff TH, Garcia LF, Barrera LF. 2012. T cell responses to DosR and Rpf proteins in actively and latently infected individuals from Colombia. Tuberculosis (Edinb) 92:148–159. doi: 10.1016/j.tube.2011.12.005. [DOI] [PubMed] [Google Scholar]
  • 12.Aagaard C, Hoang T, Dietrich J, Cardona PJ, Izzo A, Dolganov G, Schoolnik GK, Cassidy JP, Billeskov R, Andersen P. 2011. A multistage tuberculosis vaccine that confers efficient protection before and after exposure. Nat Med 17:189–194. doi: 10.1038/nm.2285. [DOI] [PubMed] [Google Scholar]
  • 13.Lin PL, Dietrich J, Tan E, Abalos RM, Burgos J, Bigbee C, Bigbee M, Milk L, Gideon HP, Rodgers M, Cochran C, Guinn KM, Sherman DR, Klein E, Janssen C, Flynn JL, Andersen P. 2012. The multistage vaccine H56 boosts the effects of BCG to protect cynomolgus macaques against active tuberculosis and reactivation of latent Mycobacterium tuberculosis infection. J Clin Invest 122:303–314. doi: 10.1172/JCI46252. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Reece ST, Nasser-Eddine A, Dietrich J, Stein M, Zedler U, Schommer-Leitner S, Ottenhoff TH, Andersen P, Kaufmann SH. 2011. Improved long-term protection against Mycobacterium tuberculosis Beijing/W in mice after intra-dermal inoculation of recombinant BCG expressing latency associated antigens. Vaccine 29:8740–8744. doi: 10.1016/j.vaccine.2011.07.144. [DOI] [PubMed] [Google Scholar]
  • 15.Welters MJ, Kenter GG, Piersma SJ, Vloon AP, Lowik MJ, Berends-van der Meer DM, Drijfhout JW, Valentijn AR, Wafelman AR, Oostendorp J, Fleuren GJ, Offringa R, Melief CJ, van der Burg SH. 2008. Induction of tumor-specific CD4+ and CD8+ T-cell immunity in cervical cancer patients by a human papillomavirus type 16 E6 and E7 long peptides vaccine. Clin Cancer Res 14:178–187. doi: 10.1158/1078-0432.CCR-07-1880. [DOI] [PubMed] [Google Scholar]
  • 16.Melief CJ, van der Burg SH. 2008. Immunotherapy of established (pre)malignant disease by synthetic long peptide vaccines. Nat Rev Cancer 8:351–360. doi: 10.1038/nrc2373. [DOI] [PubMed] [Google Scholar]
  • 17.Leffers N, Lambeck AJ, Gooden MJ, Hoogeboom BN, Wolf R, Hamming IE, Hepkema BG, Willemse PH, Molmans BH, Hollema H, Drijfhout JW, Sluiter WJ, Valentijn AR, Fathers LM, Oostendorp J, van der Zee AG, Melief CJ, van der Burg SH, Daemen T, Nijman HW. 2009. Immunization with a P53 synthetic long peptide vaccine induces P53-specific immune responses in ovarian cancer patients, a phase II trial. Int J Cancer 125:2104–2113. doi: 10.1002/ijc.24597. [DOI] [PubMed] [Google Scholar]
  • 18.Kenter GG, Welters MJ, Valentijn AR, Lowik MJ, Berends-van der Meer DM, Vloon AP, Drijfhout JW, Wafelman AR, Oostendorp J, Fleuren GJ, Offringa R, van der Burg SH, Melief CJ. 2008. Phase I immunotherapeutic trial with long peptides spanning the E6 and E7 sequences of high-risk human papillomavirus 16 in end-stage cervical cancer patients shows low toxicity and robust immunogenicity. Clin Cancer Res 14:169–177. doi: 10.1158/1078-0432.CCR-07-1881. [DOI] [PubMed] [Google Scholar]
  • 19.Rosalia RA, Quakkelaar ED, Redeker A, Khan S, Camps M, Drijfhout JW, Silva AL, Jiskoot W, van Hall T, van Veelen PA, Janssen G, Franken K, Cruz LJ, Tromp A, Oostendorp J, van der Burg SH, Ossendorp F, Melief CJ. 2013. Dendritic cells process synthetic long peptides better than whole protein, improving antigen presentation and T-cell activation. Eur J Immunol 43:2554–2565. doi: 10.1002/eji.201343324. [DOI] [PubMed] [Google Scholar]
  • 20.Ottenhoff TH, Elferink DG, Hermans J, de Vries RR. 1985. HLA class II restriction repertoire of antigen-specific T cells. I. The main restriction determinants for antigen presentation are associated with HLA-D/DR and not with DP and DQ. Hum Immunol 13:105–116. [DOI] [PubMed] [Google Scholar]
  • 21.Ottenhoff TH, Haanen JB, Geluk A, Mutis T, Ab BK, Thole JE, van Schooten WC, van den Elsen PJ, de Vries RR. 1991. Regulation of mycobacterial heat-shock protein-reactive T cells by HLA class II molecules: lessons from leprosy. Immunol Rev 121:171–191. doi: 10.1111/j.1600-065X.1991.tb00828.x. [DOI] [PubMed] [Google Scholar]
  • 22.Geluk A, van Meijgaarden KE, Franken KL, Drijfhout JW, D'Souza S, Necker A, Huygen K, Ottenhoff TH. 2000. Identification of major epitopes of Mycobacterium tuberculosis AG85B that are recognized by HLA-A*0201-restricted CD8+ T cells in HLA-transgenic mice and humans. J Immunol 165:6463–6471. doi: 10.4049/jimmunol.165.11.6463. [DOI] [PubMed] [Google Scholar]
  • 23.Geluk A, Taneja V, van Meijgaarden KE, Zanelli E, Abou-Zeid C, Thole JE, de Vries RR, David CS, Ottenhoff TH. 1998. Identification of HLA class II-restricted determinants of Mycobacterium tuberculosis-derived proteins by using HLA-transgenic, class II-deficient mice. Proc Natl Acad Sci U S A 95:10797–10802. doi: 10.1073/pnas.95.18.10797. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Geluk A, van den Eeden SJ, Dijkman K, Wilson L, Kim HJ, Franken KL, Spencer JS, Pessolani MC, Pereira GM, Ottenhoff TH. 2011. ML1419c peptide immunization induces Mycobacterium leprae-specific HLA-A*0201-restricted CTL in vivo with potential to kill live mycobacteria. J Immunol 187:1393–1402. doi: 10.4049/jimmunol.1100980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Franken KL, Hiemstra HS, van Meijgaarden KE, Subronto Y, den Hartigh J, Ottenhoff TH, Drijfhout JW. 2000. Purification of his-tagged proteins by immobilized chelate affinity chromatography: the benefits from the use of organic solvent. Protein Expr Purif 18:95–99. doi: 10.1006/prep.1999.1162. [DOI] [PubMed] [Google Scholar]
  • 26.Strauss G, Vignali DA, Schonrich G, Hammerling GJ. 1994. Negative and positive selection by HLA-DR3(DRw17) molecules in transgenic mice. Immunogenetics 40:104–108. [PubMed] [Google Scholar]
  • 27.Cosgrove D, Gray D, Dierich A, Kaufman J, Lemeur M, Benoist C, Mathis D. 1991. Mice lacking MHC class II molecules. Cell 66:1051–1066. doi: 10.1016/0092-8674(91)90448-8. [DOI] [PubMed] [Google Scholar]
  • 28.Kong YC, Lomo LC, Motte RW, Giraldo AA, Baisch J, Strauss G, Hammerling GJ, David CS. 1996. HLA-DRB1 polymorphism determines susceptibility to autoimmune thyroiditis in transgenic mice: definitive association with HLA-DRB1*0301 (DR3) gene. J Exp Med 184:1167–1172. doi: 10.1084/jem.184.3.1167. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Nabozny GH, Baisch JM, Cheng S, Cosgrove D, Griffiths MM, Luthra HS, David CS. 1996. HLA-DQ8 transgenic mice are highly susceptible to collagen-induced arthritis: a novel model for human polyarthritis. J Exp Med 183:27–37. doi: 10.1084/jem.183.1.27. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Newberg MH, Smith DH, Haertel SB, Vining DR, Lacy E, Engelhard VH. 1996. Importance of MHC class 1 alpha2 and alpha3 domains in the recognition of self and non-self MHC molecules. J Immunol 156:2473–2480. [PubMed] [Google Scholar]
  • 31.Juffermans NP, Leemans JC, Florquin S, Verbon A, Kolk AH, Speelman P, van Deventer SJ, van der Poll T. 2002. CpG oligodeoxynucleotides enhance host defense during murine tuberculosis. Infect Immun 70:147–152. doi: 10.1128/IAI.70.1.147-152.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Billeskov R, Vingsbo-Lundberg C, Andersen P, Dietrich J. 2007. Induction of CD8 T cells against a novel epitope in TB10.4: correlation with mycobacterial virulence and the presence of a functional region of difference-1. J Immunol 179:3973–3981. doi: 10.4049/jimmunol.179.6.3973. [DOI] [PubMed] [Google Scholar]
  • 33.Geluk A, van Meijgaarden KE, de Vries RR, Sette A, Ottenhoff TH. 1997. A DR17-restricted T cell epitope from a secreted Mycobacterium tuberculosis antigen only binds to DR17 molecules at neutral pH. Eur J Immunol 27:842–847. doi: 10.1002/eji.1830270406. [DOI] [PubMed] [Google Scholar]
  • 34.Obst R, van Santen HM, Melamed R, Kamphorst AO, Benoist C, Mathis D. 2007. Sustained antigen presentation can promote an immunogenic T cell response, like dendritic cell activation. Proc Natl Acad Sci U S A 104:15460–15465. doi: 10.1073/pnas.0707331104. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Darrah PA, Patel DT, De Luca PM, Lindsay RW, Davey DF, Flynn BJ, Hoff ST, Andersen P, Reed SG, Morris SL, Roederer M, Seder RA. 2007. Multifunctional TH1 cells define a correlate of vaccine-mediated protection against Leishmania major. Nat Med 13:843–850. doi: 10.1038/nm1592. [DOI] [PubMed] [Google Scholar]
  • 36.Lindenstrom T, Knudsen NP, Agger EM, Andersen P. 2013. Control of chronic mycobacterium tuberculosis infection by CD4 KLRG1-IL-2-secreting central memory cells. J Immunol 190:6311–6319. doi: 10.4049/jimmunol.1300248. [DOI] [PubMed] [Google Scholar]
  • 37.Harari A, Rozot V, Enders FB, Perreau M, Stalder JM, Nicod LP, Cavassini M, Calandra T, Blanchet CL, Jaton K, Faouzi M, Day CL, Hanekom WA, Bart PA, Pantaleo G. 2011. Dominant TNF-alpha(+) Mycobacterium tuberculosis-specific CD4(+) T cell responses discriminate between latent infection and active disease. Nat Med 17:372–376. doi: 10.1038/nm.2299. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Caccamo N, Guggino G, Joosten SA, Gelsomino G, Di Carlo P, Titone L, Galati D, Bocchino M, Matarese A, Salerno A, Sanduzzi A, Franken WP, Ottenhoff TH, Dieli F. 2010. Multifunctional CD4(+) T cells correlate with active Mycobacterium tuberculosis infection. Eur J Immunol 40:2211–2220. doi: 10.1002/eji.201040455. [DOI] [PubMed] [Google Scholar]
  • 39.Sutherland JS, Adetifa IM, Hill PC, Adegbola RA, Ota MO. 2009. Pattern and diversity of cytokine production differentiates between Mycobacterium tuberculosis infection and disease. Eur J Immunol 39:723–729. doi: 10.1002/eji.200838693. [DOI] [PubMed] [Google Scholar]
  • 40.Walker D, Jason J, Wallace K, Slaughter J, Whatley V, Han A, Nwanyanwu OC, Kazembe PN, Dobbie H, Archibald L, Jarvis WR. 2002. Spontaneous cytokine production and its effect on induced production. Clin Diagn Lab Immunol 9:1049–1056. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Achkar JM, Casadevall A. 2013. Antibody-mediated immunity against tuberculosis: implications for vaccine development. Cell Host Microbe 13:250–262. doi: 10.1016/j.chom.2013.02.009. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Geluk A, van den Eeden SJ, van Meijgaarden KE, Dijkman K, Franken KL, Ottenhoff TH. 2012. A multistage-polyepitope vaccine protects against Mycobacterium tuberculosis infection in HLA-DR3 transgenic mice. Vaccine 30:7513–7521. doi: 10.1016/j.vaccine.2012.10.045. [DOI] [PubMed] [Google Scholar]
  • 43.Commandeur S, van den Eeden SJ, Dijkman K, Clark SO, van Meijgaarden KE, Wilson L, Franken KL, Williams A, Christensen D, Ottenhoff TH, Geluk A. 2014. The in vivo expressed Mycobacterium tuberculosis (IVE-TB) antigen Rv2034 induces CD4(+) T-cells that protect against pulmonary infection in HLA-DR transgenic mice and guinea pigs. Vaccine 32:3580–3588. doi: 10.1016/j.vaccine.2014.05.005. [DOI] [PubMed] [Google Scholar]
  • 44.Geluk A, van Meijgaarden KE, Joosten SA, Commandeur S, Ottenhoff TH. 2014. Innovative strategies to identify M. tuberculosis antigens and epitopes using genome-wide analyses. Front Immunol 5:256. doi: 10.3389/fimmu.2014.00256. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE III, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG. 1998. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature 393:537–544. doi: 10.1038/31159. [DOI] [PubMed] [Google Scholar]
  • 46.Bansal K, Elluru SR, Narayana Y, Chaturvedi R, Patil SA, Kaveri SV, Bayry J, Balaji KN. 2010. PE_PGRS antigens of Mycobacterium tuberculosis induce maturation and activation of human dendritic cells. J Immunol 184:3495–3504. doi: 10.4049/jimmunol.0903299. [DOI] [PubMed] [Google Scholar]
  • 47.Byun EH, Kim WS, Kim JS, Jung ID, Park YM, Kim HJ, Cho SN, Shin SJ. 2012. Mycobacterium tuberculosis Rv0577, a novel TLR2 agonist, induces maturation of dendritic cells and drives Th1 immune response. FASEB J 26:2695–2711. doi: 10.1096/fj.11-199588. [DOI] [PubMed] [Google Scholar]
  • 48.Vani J, Shaila MS, Trinath J, Balaji KN, Kaveri SV, Bayry J. 2013. Mycobacterium tuberculosis cell wall-associated Rv3812 protein induces strong dendritic cell-mediated interferon gamma responses and exhibits vaccine potential. J Infect Dis 208:1034–1036. doi: 10.1093/infdis/jit281. [DOI] [PubMed] [Google Scholar]
  • 49.Xu Y, Yang E, Huang Q, Ni W, Kong C, Liu G, Li G, Su H, Wang H. 2015. PPE57 induces activation of macrophages and drives Th1-type immune responses through TLR2. J Mol Med (Berl) 93:645–662. doi: 10.1007/s00109-014-1243-1. [DOI] [PubMed] [Google Scholar]
  • 50.Quakkelaar ED, Melief CJ. 2012. Experience with synthetic vaccines for cancer and persistent virus infections in nonhuman primates and patients. Adv Immunol 114:77–106. doi: 10.1016/B978-0-12-396548-6.00004-4. [DOI] [PubMed] [Google Scholar]
  • 51.Gowthaman U, Singh V, Zeng W, Jain S, Siddiqui KF, Chodisetti SB, Gurram RK, Parihar P, Gupta P, Gupta UD, Jackson DC, Agrewala JN. 2011. Promiscuous peptide of 16 kDa antigen linked to Pam2Cys protects against Mycobacterium tuberculosis by evoking enduring memory T-cell response. J Infect Dis 204:1328–1338. doi: 10.1093/infdis/jir548. [DOI] [PubMed] [Google Scholar]
  • 52.Lin MY, Geluk A, Smith SG, Stewart AL, Friggen AH, Franken KL, Verduyn MJ, van Meijgaarden KE, Voskuil MI, Dockrell HM, Huygen K, Ottenhoff TH, Klein MR. 2007. Lack of immune responses to Mycobacterium tuberculosis DosR regulon proteins following Mycobacterium bovis BCG vaccination. Infect Immun 75:3523–3530. doi: 10.1128/IAI.01999-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Geluk A, Lin MY, van Meijgaarden KE, Leyten EM, Franken KL, Ottenhoff TH, Klein MR. 2007. T-cell recognition of the HspX protein of Mycobacterium tuberculosis correlates with latent M. tuberculosis infection but not with M. bovis BCG vaccination. Infect Immun 75:2914–2921. doi: 10.1128/IAI.01990-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Tchilian EZ, Ronan EO, de Lara C, Lee LN, Franken KL, Vordermeier MH, Ottenhoff TH, Beverley PC. 2011. Simultaneous immunization against tuberculosis. PLoS One 6:e27477. doi: 10.1371/journal.pone.0027477. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Abu-Raddad LJ, Sabatelli L, Achterberg JT, Sugimoto JD, Longini IM Jr, Dye C, Halloran ME. 2009. Epidemiological benefits of more-effective tuberculosis vaccines, drugs, and diagnostics. Proc Natl Acad Sci U S A 106:13980–13985. doi: 10.1073/pnas.0901720106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Lowrie DB, Tascon RE, Bonato VL, Lima VM, Faccioli LH, Stavropoulos E, Colston MJ, Hewinson RG, Moelling K, Silva CL. 1999. Therapy of tuberculosis in mice by DNA vaccination. Nature 400:269–271. doi: 10.1038/22326. [DOI] [PubMed] [Google Scholar]
  • 57.Vilaplana C, Gil O, Caceres N, Pinto S, Diaz J, Cardona PJ. 2011. Prophylactic effect of a therapeutic vaccine against TB based on fragments of Mycobacterium tuberculosis. PLoS One 6:e20404. doi: 10.1371/journal.pone.0020404. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Coler RN, Bertholet S, Pine SO, Orr MT, Reese V, Windish HP, Davis C, Kahn M, Baldwin SL, Reed SG. 2013. Therapeutic immunization against Mycobacterium tuberculosis is an effective adjunct to antibiotic treatment. J Infect Dis 207:1242–1252. doi: 10.1093/infdis/jis425. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Geluk A, van Meijgaarden KE, Janson AA, Drijfhout JW, Meloen RH, de Vries RR, Ottenhoff TH. 1992. Functional analysis of DR17(DR3)-restricted mycobacterial T cell epitopes reveals DR17-binding motif and enables the design of allele-specific competitor peptides. J Immunol 149:2864–2871. [PubMed] [Google Scholar]

Articles from Clinical and Vaccine Immunology : CVI are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES