Abstract
The altered activity of the fructose transporter GLUT5, an isoform of the facilitated-diffusion glucose transporter family, has been linked to disorders such as type 2 diabetes and obesity. GLUT5 is also overexpressed in certain tumor cells and inhibitors are potential drugs for these conditions. Here, we describe the crystal structure of GLUT5 from Rattus norvegicus and Bos taurus in open outward- and open inward-facing conformations, respectively. GLUT5 has a major facilitator superfamily fold like other homologous monosaccharide transporters. Based on a comparison of the inward-facing structures of GLUT5 and human GLUT1, a ubiquitous glucose transporter, we show that a single point mutation is enough to switch the substrate binding preference of GLUT5 from fructose to glucose. A comparison of the substrate-free structures of GLUT5 with occluded substrate-bound structures of XylE suggests that, besides global rocker-switch like re-orientation of the bundles, local asymmetric rearrangements of C-terminal bundle helices TMs 7 and 10 underlie a “gated-pore” transport mechanism in such monosaccharide transporters.
Introduction
GLUT transporters belong to the solute carrier 2 family (SLC2) and, so far, fourteen different isoforms GLUT1-14 have been identified1,2. Except for GLUT13, GLUT transporters are uniporters, which facilitate the diffusion of monosaccharides like glucose and fructose across the cell membrane in a concentration-dependent manner1,2. Each GLUT transporter shows a distinct pattern of tissue distribution, gene regulation, substrate preference and kinetic properties1,2. For example, GLUT1 is distributed in a wide range of tissues, including the blood-brain barrier and is essential for glucose transport into the brain3, whereas GLUT4 is mostly localized to skeletal muscles and adipose tissue, and is the major insulin-stimulated glucose transporter1,4. GLUT5 is the only member specific to fructose5,6 and together with GLUT2, which transports fructose in addition to glucose, they make up the major fructose transporters in the body 7,8. GLUT5 is primarily expressed in the small intestine, but lower levels are also expressed in brain, adipose tissue, kidney, testes and skeletal muscle 5,9,10. GLUT activity is also associated with various diseases1,11. For instance, increased GLUT5 expression has been linked to several metabolic disorders12,13, and several types of cancers like breast cancer14, because of the higher energy demand of cancer cells stimulating sugar uptake, the so-called Warburg effect15. GLUT transporters belong to the larger major facilitator superfamily (MFS), whose members have a fold consisting of two symmetrical six transmembrane helix (TM) bundles16,17. Within the MFS they belong to a subfamily of sugar porter transporters18,19, whose members are found in all domains of life and are important targets for industrial and biomedical applications20. Recently, an open inward-facing structure of human GLUT1 was reported with a bound sugar from a detergent head-group in the substrate-binding site, and compared to previous structures of the related Escherichia coli D-xylose:H+ symporter XylE in the outward- and inward-occluded conformations, suggesting a “rocker-switch” type transport mechanism 21-23. However, as little is known about the molecular basis of substrate binding and release in GLUT transporters, their alternating-access mechanism is yet to be fully understood.
Open outward and inward GLUT5 structures
Rat and bovine GLUT5 (rGLUT5 and bGLUT5) that share ~81% sequence identity to human GLUT5 were selected and optimised for structural studies using fluorescence-based screening methods (Methods). rGLUT5 was crystallized in complex with an Fv antibody fragment (rGLUT5-Fv, Methods). The rGLUT5-Fv and bGLUT5 structures were solved by molecular replacement (MR) and refined against data extending up to 3.3 Å and 3.2/4.0 Å (anisotropic data), respectively (Extended Data Table 1 and 2, Extended Data Fig 1, and Methods). The GLUT5 structure shows the typical MFS fold, plus five additional helices on the intracellular side, one at the C-terminus (ICH5) and the other four, ICH1-4, located between the N- and C-terminal TM bundles (Fig. 1). bGLUT5 crystallized in an open inward-facing conformation (Fig. 1) and although human GLUT1 (hGLUT1) and bGLUT5 share only 43% sequence identity, their inward-facing structures superimpose well, with an r.m.s.d. of 1.12Å for 364 pairs of Cα atoms (Methods and Extended Data Fig. 2a). The rGLUT5-Fv structure shows an open outward-facing conformation, which is a state that has not been observed previously in any of the related sugar porter structures22-25 (Fig. 1). The open outward-facing conformation is possibly stabilized by the Fv fragment, which binds to the ICHs (Extended Data Fig. 3).
Central fructose-binding site of GLUT5
The GLUT5 substrate-binding site is closely related to those of hGLUT1 and E. coli XylE21,22 (Fig. 2a and Extended Data Fig. 2b). Many of the residues lining the central cavity are conserved between GLUT5 and hGLUT1, and include Ile169, Ile173, Gln166, Gln287, Gln288, Asn324 and Trp419 (Fig. 2a and Extended Data Fig. 4). In GLUT5, Trp419 is the only tryptophan positioned in the substrate-binding site (Fig. 2a and Extended Data Fig. 5a), and it is essential for transport26. Consistent with rGLUT5 transport activity (Extended Data Fig. 6a), strong quenching of tryptophan fluorescence could be observed with the addition of D-fructose, but not with the addition of L-fructose or known GLUT1 substrates like D-glucose, D-galactose or D-mannose (Extended Data Fig. 5). Using this assay, the affinity of rGLUT5 for D-fructose was measured to have a Kd around 6 - 9 mM (Fig. 2b and Extended Data Fig. 6b), which is similar to that reported for human GLUT55,8. Throughout this study tryptophan fluorescence quenching of rGLUT5 was henceforth used to assess substrate binding.
Gln166 is the only conserved residue in the substrate-binding site that is positioned differently between the hGLUT1 and GLUT5 structures (Fig. 2a). In hGLUT1 the equivalent glutamine (Gln161) points away, rather than towards, the central cavity as it has likely re-orientated to accommodate the acyl chain of the bound detergent in the sugar-binding site (Fig. 2a). In XylE the equivalent glutamine (Gln168) is orientated similarly as in GLUT5 (Extended Data Fig. 2b). Other residues that line the binding site, but are not conserved between GLUT5 and hGLUT1 are Tyr31 (Phe26 in hGLUT1), His386 (Phe379), Ala395 (Trp388), His418 (Asn411) and Ser391 (Gly384) (Fig. 2a and Extended Data Fig. 4). Single alanine mutants of each of these residues show strongly reduced D-fructose binding (Fig. 2c). The alanine mutants that show the weakest D-fructose binding are Tyr31 (TM1), Gln287 (TM7), His386 (TM10) and His418 (TM11). Except for Tyr31, these residues belong to the C-terminal TM bundle, indicating an asymmetrical binding mode of the sugar between the N- and C-terminal TM bundles in GLUT5, as seen in the sugar-bound hGLUT1 and XylE structures21,22. The substrate-binding cavity is deeper in GLUT5, because the tryptophan residue found at the bottom of the cavity in hGLUT1 (Trp388) and XylE (Trp392) is replaced with alanine (Ala395) in GLUT5 (Fig. 2a and Extended Data Fig. 6c). Trp388 in hGLUT1 is critical for inhibition by cytochalasin B26, whereas GLUT5 is insensitive to this inhibitor5.
GLUT7 is the closest isoform to GLUT5 and transports both D-fructose and D-glucose27. Among the substrate-binding site residues of GLUT5 almost all are identical to those in GLUT7 (Extended Data Fig. 4). The most notable difference is that Gln166 in GLUT5 is replaced in GLUT7 with glutamate (Extended Data Fig. 4). In rGLUT5, the substitution of Gln166 (TM5) with glutamate clearly weakens D-fructose binding (Fig. 2c and 2d). Furthermore, the Q166E mutant now shows robust binding to D-glucose with an apparent affinity (Kd) of ~ 4 mM (Fig. 2d and Fig. 2e). The introduced carboxylate is likely to play a similar role to Glu380 (TM10) in hGLUT1 (Fig. 2a), which is essential for D-glucose transport28.
Salt-bridges stabilize the outward conformation
A common feature observed in recent structures of MFS transporters are inter-TM bundle salt-bridges that break and form near the central cavity during transport16,29,30. In H+-coupled transporters, it is thought that the protonation state of these salt-bridges is coupled to substrate-binding and further to structural transitions16,29,30. In GLUT5, no salt-bridges are observed near the central cavity in either conformation. Instead, inter-TM bundle salt-bridges are observed only in the outward-facing conformation and far from the central cavity, linking the cytoplasmic ends of TMs 3, 4, 5 in the N-terminal TM bundle to those of TMs 9, 10 and 11 in the C-terminal TM bundle (Fig. 3a). Specifically, Glu151 (TM4) forms a salt-bridge to both Arg97 (TM3) and Arg407 (TM11), and similarly Glu400 (TM10) forms a salt-bridge to both Arg158 (TM5) and Arg340 (TM9). Due to their strict conservation these residues make up the well-described sugar porter signatures18,19 and are related by a pseudo two-fold symmetry axis running through the center of the transporter and perpendicular to the membrane plane (Fig. 1a and Fig. 3b and Extended Data Fig. 4). In the inward-facing conformation the inter-TM bundle salt-bridge pairs Glu400-Arg158 and Glu151-Arg407 are separated by some ~7 and 13 Å, respectively (Fig. 3a). In the inward-facing conformation, no inter-TM bundle salt-bridges are formed on the extracellular side, indicating that in the absence of substrate GLUT proteins may favor the outward-facing conformation. Consistently, the substitution of Glu400, Arg407 and Glu336 equivalent residues in GLUT4 to neutral amino acids arrests the transporter in an inward-facing conformation31. Moreover, in the outward-facing conformation Glu336 (TM8) in the C-terminal TM bundle forms a salt-bridge to Arg340, which is connected to the inter-TM bundle Glu400-Arg158 salt-bridge (Fig. 3a). The equivalent glutamate to Glu336 in hGLUT1 (Glu329) was substituted to glutamine to stabilize the inward-facing hGLUT1 structure21. The salt-bridges formed between inter-TM bundles seem to be coupled also to substrate-binding in GLUT5, because substituting Glu151 and Glu400 with alanine shows significantly reduced D-fructose binding (Fig. 3c).
The ICH domain is below this cytoplasmic salt-bridge network, and positioned similarly, with respect to the N- and C-terminal TM bundles, in both outward-open GLUT5 and outward-occluded XylE structures22 (Extended Data Fig. 7a). ICH1, ICH2 and ICH3 are linked together by salt-bridges, as previously shown for XylE and GLUT121,22. In GLUT5, ICH5 lacks charged residues that could interact with ICH1-3 (Extended Data Fig. 7b), as it does in the outward-occluded XylE structure22. Rather, the N-terminal helices ICH1-3 interact with the C-terminal bundle via a salt-bridge formed between Glu252 in ICH3 and Arg407 in TM11; thus linking the ICH domain to a TM involved in the inter-bundle salt-bridge network. In inward-facing GLUT5, these interactions are broken (Extended Data Fig. 7c) and, as observed in the inward-facing hGLUT1 and XylE structures21,23,24, ICH5 could not be built (Extended Data Fig. 2a). Therefore, the role of the ICH domain might be to provide additional stabilization of the outward-facing conformation, as suggested previously21.
TMs 7 and 10 form substrate-induced gates
In GLUT5, the N- and C-terminal TM bundles undergo a small rotation of ~15° between the open outward- and inward-facing conformations (Fig. 1). As observed in other MFS transporter structures16, cavity-closing contacts in GLUT5 form mostly between TMs 1 and 7 on the outside, and between TMs 4 and 10 on the inside (Fig. 1c and Fig. 4a). Among these helices, however, TMs 7 and 10 in the C-terminal TM bundle seem to play the most prominent roles in occluding the substrate-binding site from the outside and inside, respectively (Fig. 4b). Comparisons of the substrate-free open GLUT5 structures with the substrate-occluded XylE structures22,23 highlight the central role of TM7 and TM10 in gating (Extended Data Fig. 8). Inverted-symmetry related TMs 7 and 10 make up highly conserved sugar transporter signatures2, and they also form a large fraction of the substrate-binding site in hGLUT121 and XylE21,22, in agreement with previous functional data28,32,33. Between the outward-open GLUT5 conformation and outward-occluded XylE conformation22, the extracellular half of TM7 shows the largest shift towards the substrate-binding site (Extended Data Fig. 8a). Similarly, from the inward-occluded XylE conformation23 to the inward-open GLUT5 conformation, the intracellular half of TM10 shows the largest shift away from the substrate-binding site (Extended Data Fig. 8b and c); this TM10 movement has also been described previously for XylE 23,24 . In GLUT5, the observed conformational changes in TMs 7 and 10 occur at hinge points that contain glycine residues (Fig. 4b and 4c and Extended Data Fig. 4). Tyr382 in TM10 interacts tightly with TM7 residues Ileu295 and Val292 in the outward-facing state and these interactions do not take place in the inward-facing conformation (Fig. 4c). The interactions between TMs 7 and 10 seem important to coordinate their conformational changes during transport, because mutation of the Ile295 equivalent residue in hGLUT5 to valine or alanine abolishes D-fructose transport34. Consistently, similar interface-perturbing mutations of Ile295 significantly reduce D-fructose binding in rGLUT5 (Extended Data Fig. 6d). Further, in hGLUT1 the equivalent residue to Val292 (Ile287) was substituted to every other amino acid, and each mutant shows markedly different D-glucose affinities and transport kinetics35. Therefore, it suggests that the interactions between TM7 and TM10 are important and tuned with respect to substrate affinity and transport kinetics.
Conclusions
Symmetrical substrate binding and rigid-body movements of the N- and C-terminal TM bundles around a centrally located substrate-binding site form the structural basis of the “rocker-switch” mechanism in MFS transporters16,36. However, here we have described asymmetrical rearrangements in the MFS subfamily of sugar porters, consistent with the asymmetrical binding mode of the sugar reported previously in XylE and hGLUT1 structures21,22. Therefore, we conclude that transport in GLUT5 is not only controlled by the rocker-switch type movement21 of the N- and C-terminal TM bundles, but also by a gated-pore mechanism, in the form of local, gating movements by TMs 7 and 10 in the C-terminal TM bundle that are coupled to substrate binding and release (Fig. 5 and Supplementary Videos 1 - 3). TM10 is also part of the inter-TM bundle salt-bridge network, indicating how local gating and global rocker-switch type movements are coupled. Importantly, a deeper understanding of GLUT5 structure and transport mechanism, as described here, should facilitate the structure-based design of novel inhibitors with therapeutic potential.
METHODS
Rattus norvegicus GLUT5 cloned full-length sequence (UniProt accession number: P43427); N50Y deglycosylation mutation is underlined and additional C-terminal residues retained after TEV cleavage are shown in italic (see next section for cloning details).
MEKEDQEKTGKLTLVLALATFLAAFGSSFQYGYNVAAVNSPSEFMQQFYYDTYYDRNK
ENIESFTLTLLWSLTVSMFPFGGFIGSLMVGFLVNNLGRKGALLFNNIFSILPAILMGCSK
IAKSFEIIIASRLLVGICAGISSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQLFGLR
SVLASEEGWPILLGLTGVPAGLQLLLLPFFPESPRYLLIQKKNESAAEKALQTLRGWKD
VDMEMEEIRKEDEAEKAAGFISVWKLFRMQSLRWQLISTIVLMTGQQLSGVNAIYYYA
DQIYLSAGVKSNDVQYVTAGTGAVNVFMTMVTVFVVELWGRRNLLLIGFSTCLTACIVL
TVALALQNTISWMPYVSIVCVIVYVIGHAVGPSPIPALFITEIFLQSSRPSAYMIGGSVHW
LSNFIVGLIFPFIQVGLGPYSFIIFAIICLLTSIYIFMVVPETKGRTFVEINQIFAKKNKVSDV
YPEKEEKELNDLPPATREQENLYFQ
Bos taurus GLUT5 cloned sequence containing 1 to 473 out of 501 residues (UniProt accession number: P58353); N51A deglycosylation mutation is underlined and additional C-terminal residues retained after TEV cleavage are shown in italic (see next section for cloning details).
MEPQDPVKREGRLTPVIVLATLIAAFGSSFQYGYNVAAINSPSEFMKDFYAYTYYDRVG
EYMNEFYLTLLWSVTVSMFPFGGFLGSLMVGPLVNNLGRKGTLLFNNIFSIVPALLMGF
SELAKSFEMIIVARVLVGICAGLSSNVVPMYLGELAPKNWRGALGVVPQLFITIGILVAQI
FGLRSLLANEEGWPILLGLTGIPAVLQLLFLPFFPESPRYLLIQKKDEAAAKSALRRLRG
WHDVDAEIEEILEEDRAEKAVGFISVLKLFKMRSLRWQVISIIVLMAGQQLSGVNAIYYY
ADQIYLSAGVNEDDVQYVTAGTGAVNVLITVCAIFVVELMGRRFLLLLGFSVCFTACCVL
TGALALQDVISWMPYVSIACVISYVIGHALGPSPIPALLVTEIFLQSSRPAAYMVAGTVH
WLSNFTVGLVFPFIQVGLGAYSFVIFAVICLLTTVYIFLIIPETKSKTFIEINRENLYFQ
Fv light chain variable region (VL); additional C-terminal residues, retained after TEV cleavage, are shown in italics
ELDIVLTQSPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNR FSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKTSENLYF Q
Fv heavy chain variable region (VH); additional C-terminal residues retained after TEV cleavage, are shown in italics
LEVNLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAHISSGSRTI DYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAIYYCARGNGYYDALDYWGQGTSVT VSSAKTTPPSVTSENLYFQ
Target identification using fluorescence-based screening methods
GLUT5 homologues were cloned into the GAL1 inducible TEV cleavable GFP-His8 2μ vector pDDGFP2, transformed into the S. cerevisiae strain FGY217 (MATa, ura3–52, lys2Δ201, and pep4Δ)40 and overexpressed as described previously41,42. In brief, 10 ml S. cerevisae FGY217 cell cultures in –URA media and 0.1% glucose were grown at 30°C and expression was induced by the addition of final 2% (v/v) D-galactose at an OD600 of 0.6. After ~22 hrs, cells were harvested, resuspended in 1 × PBS buffer and overexpression levels assessed by whole-cell GFP fluorescence41,42. Fusions with detectable expression levels were re-grown in larger 2-L culture volumes and membranes subsequently isolated. The monodispersity of expressed fusions were screened in crude dodecyl-β-D-maltopyranoside (DDM), decyl-β-D-maltopyranoside (DM), nonyl-β-D-maltopyranoside (NM) and n-dodecyl-N,N-dimthylamine-N-oxide (LDAO) solubilized membranes by fluorescence-detection size exclusion chromatography (FSEC)43 as described previously41. Out of the GLUT5 homologues screened, rat and bovine GLUT5 showed the sharpest monodispersity profiles and was the most stable after purification in detergent44.
Large-scale production and purification of rat and bovine GLUT5
For rat GLUT5, cells were harvested from 10 L S. cerevisiae cultures, resuspended in buffer containing 50 mM Tris-HCl pH 7.6, 1 mM EDTA, 0.6 M sorbitol, and lysed by mechanical disruption as described previously42. Membranes were isolated by ultracentrifugation at 195,000 g for 3 h, homogenized in 20 mM Tris-HCl pH 7.5, 0.3 M sucrose, 0.1 mM CaCl2, frozen in liquid nitrogen and stored at −80 °C. Rat GLUT5 membranes were solubilized with 1% DDM in equilibration buffer (EB) consisting of 1 × PBS, 10 mM imidazole, 150 mM NaCl, 10 % glycerol. After ultracentrifugation at 195,000 g for 45 min, the supernatant was incubated with 10 ml of Ni2+-nitrilotriacetate affinity resin (Ni-NTA; Qiagen) for 2 h at 4 °C. The resin was washed with 100 ml of EB containing 0.05% DDM and 30 mM imidazole, and the protein eluted in 25 ml of EB containing 0.05% DDM and 250 mM imidazole. The eluted protein was incubated with TEV-His6 protease to remove the GFP-His8 tag and dialyzed against 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.03% DDM. Dialyzed sample was then loaded onto a 5 ml HisTrap column (GE Healthcare) equilibrated in dialysis buffer, and the flow-through was collected and concentrated. The protein was further purified by size-exclusion chromatography (SEC) using a Superdex 200 column (GE Healthcare) in buffer consisting of 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02 % DDM. All rat GLUT5 mutants were generated with a standard PCR-based strategy and were sub-cloned, overexpressed and purified as described for wildtype.
Protein complexes were prepared by incubation of the HisTrap-purified rat GLUT5 with the SEC-purified Fv fragment (supplemented with 0.02% (w/v) DDM) at a molar ratio of 1:1.5 for 1 h on ice. The complex was subjected to SEC (Superdex 200, GE Healthcare). The SEC step was repeated twice to ensure reproducibility of crystals. Peak fractions containing rat GLUT5-Fv complex were concentrated to ~10 mg/ml by ultrafiltration (Millipore, MWCO 50 kDa), and immediately used for crystallization experiments.
For bovine GLUT5, membranes were isolated from 40 L S. cerevisiae cultures. After membrane solubilization and ultracentrifugation (as described for rat GLUT5), the supernatant was supplemented with 55 mM Imidazole, and incubated with 30 ml of Ni-NTA resin for 2 h at 4 °C. The resin was washed with 600 ml of EB supplemented with 55 mM imidazole and 0.03% DDM, and the protein was eluted using 125 ml of EB containing 250 mM imidazole and 0.03% DDM. After cleavage of GFP-His8 cleavage by TEV-His6 protease the material was re-loaded onto the same 30 ml Ni-NTA resin column (no imidazole), the flow-through was concentrated and passed through a 1 ml Ni-NTA column for further clean up. The untagged protein was further purified by SEC in buffer containing 10 mM Tris-HCl, pH 7.5, 150 mM NaCl, and 0.09 % undecyl-β-maltopyranoside (UDMβ), and then concentrated to ~4 mg/ml for crystallization experiments.
Generation of single-chain Fv (scFv) fragments
Animal experiments conformed to the guidelines outlined in the Guide for the Care and Use of Laboratory Animals of Japan and were approved by the University of Tokyo Animal Care Committee (approval no. RAC07101). Rat GLUT5-specific scFv fragment were generated essentially as previously described45. In brief, purified GLUT5 was reconstituted into liposomes containing chicken egg yolk phosphatidylcholine (egg PC; Avanti) and adjuvant lipid A (Sigma-Aldrich) by detergent removal method. Small unilamellar proteoliposomes were prepared by sonication. MRL/lpr mice were immunized with 0.1 mg of the proteoliposome antigen three times at two-week intervals. Immunized mice were sacrificed, and RNA in their splenocytes was isolated and converted into cDNA via reverse-transcription PCR. The VL and VH repertoire was assembled via an 18 amino acid flexible linker and cloned into the phage-display vector pComb3XSS. Biotinylated proteoliposomes were prepared by reconstituting GLUT5 with a mixture of egg PC and 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-(cap biotinyl) (16:0 biotinyl Cap-PE; Avanti), and used as binding targets for scFv-phage selection. The targets were immobilized onto streptavidin-coated paramagnetic beads (Dynabeads) or streptavidin-coated microplates (Nunc). After four rounds of biopanning, proteoliposome-targeted enzyme-linked immunosorbent assays (“liposome ELISAs”) were performed on periplasmic extracts of individual colonies. Positive clones were collected and evaluated using a Biacore T100 (GE Healthcare).
Expression and purification of Fv fragment
Antibody fragments in the scFv format are undesirable for use as crystallization chaperones because they are able to intermolecularly form domain-swapped dimers, and dimer-monomer equilibrium may increase structural heterogeneity. Therefore, we used Fv fragments for crystallization trials. The Fv fragment were expressed in Brevibacillus choshinensis as a secreted His6-tagged protein and purified from culture medium. The cells were grown at 30 °C with 200 r.p.m. in 2SY medium (soypton 40 g/l, yeast extract 5 g/l, glucose 20 g/l, CalCl2 0.15 g/l) supplemented with 50 mg/l neomycin. The cells expressing the VL and VH were initially grown separately as overnight precultures. The precultures were then combined and diluted in 2SY medium to give OD600 of 0.02 of each strain and grown for further 65-70 h. The cells were removed by centrifugation at 6,000 g for 15 min. The recovered culture supernatant was adjusted to a final ammonium sulfate concentration of 60% saturation, and the precipitate was pelleted, dissolved in TBS buffer (10 mM Tris-HCl, pH 7.5, 150 mM NaCl), and dialyzed overnight against the same buffer. Dialyzed sample was mixed with Ni-NTA resin equilibrated with Fv1 buffer (10 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20 mM imidazole). Bound proteins were eluted with Fv2 buffer (10 mM Tris-HCl, pH 7.5, 150 mM NaCl, 250 mM imidazole), mixed with TEV-His6 and dialyzed overnight against TBS buffer. Cleaved His6 tag and TEV-His6 were removed by binding to a HisTrap column equilibrated with Fv1 buffer. The tag-free Fv fragment was concentrated and loaded onto a HiLoad16/60 Superdex 75 column (GE Healthcare) equilibrated with TBS buffer. Peak fractions were pooled, concentrated, flash frozen in liquid nitrogen, and stored at −80°C.
Transport activity of reconstituted GLUT5
The proteoliposome D-fructose uptake assay was modified from that previously described for human GLUT146. In brief, purified rat GLUT5 was reconstituted by the freeze–thaw/extrusion method. Crude lipids were extracted from bovine liver and sonicated to make unilamellar liposomes. 500 μL of a mixture containing ~10 μg of purified GLUT5 and 20 mg of liposomes in 10 mM TrisSO4 (pH 7.5) was flash frozen and thawed at room temperature. Large, unilamellar proteoliposomes were prepared by extrusion (LiposoFast, Avestin; membrane pore size, 400 nm). For each time point, 10 μl proteoliposomes (0.4 mg lipid; 0.2 μg GLUT5) was added to 10 μl transport buffer containing 10 mM TrisSO4 and 2 mM MgSO4 (pH 7.5) with or without the addition of 0.5 mM HgCl2. Time course of 0.1 mM [14C]-D-fructose transport was measured at 25 °C at indicated time intervals and stopped by the addition of cold buffer containing 10 mM TrisSO4, 2 mM MgSO4 (pH 7.5) and 0.5 mM HgCl2 and immediately filtered. Non-specific uptake was estimated with 0.1 mM [14C]-L-glucose. The radioactivity corresponding to the internalized substrate was measured by scintillation counting. Each experiment was performed in triplicate and data-points shown indicate average values of two technical replicates.
Substrate specificity
Unless otherwise stated the rat GLUT5 deglycosylation mutant (N50Y) used for structure determination is referred to as “wild-type like protein (WT)”. Only rat GLUT5 WT and mutants showing a monodisperse peak in DDM during gel filtration were assessed for their ability to bind sugar by tryptophan fluorescence. In all experiments, either purified rat GLUT5 WT or mutants were diluted to 0.06 mg/ml in purification buffer containing 150 mM NaCl2, 20 mM Tris pH 7.5, 0.03% DDM. D-fructose, L-fructose, D-glucose, D-mannose, D-xylose and D-galactose stocks, that were freshly prepared in purification buffer, were added to the diluted protein to reach a final concentration of 40 mM. After each sugar addition the sample was incubated at room temperature for 2 minutes before measuring tryptophan fluorescence. Measurements were performed using a Cary Eclipse Fluorescence Spectrophotometer (Agilent Technologies), with an excitation wavelength of 295 nm and the emission spectra recorded in the range of 300-400nm with a 5 nm excitation slit in a High Precision Cell Quartz Suprasil 10 × 2mm cuvette (Hellma Analytics). The emission peak of 338 nm was taken as an average of the four wavelengths 337.03, 337.96, 339.06 and 340 nm. Each experiment was carried out in triplicate in the absence and presence of the well-known GLUT inhibitor HgCl2 (5 mM)47. To compare mutant binding to D-fructose, nonspecific tryptophan fluorescence quenching of 2.5% (as measured with 40 mM L-fructose) was first subtracted from both wildtype and mutant quenching levels prior to calculating the final percentage of quenching relative to wildtype.
Binding analysis
D-fructose or D-glucose stocks, that were freshly prepared in purification buffer, were sequentially added to the diluted protein to a final concentration of 40 mM. After each sugar addition the sample was incubated at room temperature for 2 minutes prior to measuring. Tryptophan fluorescence measurements were performed as above. Each experiment was carried out in triplicate in the absence and presence of the known GLUT inhibitor HgCl2 (5 mM). The rat GLUT5 curves were fitted by non-linear regression using the software Prism. The bovine GLUT5 construct used for structural studies binds D-fructose with similar affinity as rat GLUT5 with a Kd of 5.5 ± 0.6 mM.
Crystallization
Fv fragment
The structure of the Fv fragment was used as a search model for the molecular replacement. Crystals of the Fv fragment appeared in the well buffer at 20°C containing 0.1 M CAPS-NaOH (pH 10.5), 1.6 M (NH4)2SO4, 0.1 M Li2SO4, 6.5 mM n-nonyl-β-D-glucoside.
Rat GLUT5
Crystals of rGLUT5-Fv complex (in DDM) used for structural determination were grown at 20°C by hanging drop vapor diffusion. A 400-μl reservoir containing 33-35 % PEG 400, 0.12 M CaCl2, 0.1 M Tris-HCl (pH 8.0) was equilibrated against a 2-μl drop containing a 1:1 mixture of the complex and reservoir solution. After 2 to 3 weeks of growth, crystals were dehydrated by stepwise equilibration of the drops against 400 μl reservoirs containing increasing concentration of PEG 400, in steps of 5% and up to a final concentration of 70%. Crystals were then flash-frozen and stored in liquid nitrogen.
Bovine GLUT5
Crystals were grown over the course of 2 to 3 weeks at 4 °C in 2 μl drops (500 μl well) consisting of the well solution 31 to 35% PEG 300, 0.125 M HEPES pH 8.0, 0.125 M NaCl, 0.125 M LiSO4, mixed first with 70 mM HEGA-10 (4:1) and then the protein solution (1:1), and placed over the well solution diluted with water (4:1) before sealing. For freezing in liquid nitrogen, crystals were soaked for one minute in the mother liquor supplemented with ~ 15% PEG 300.
Data collection, structure determination and analysis
For the Fv fragment, diffraction data were collected at 100 K at SPring-8 beamline BL41XU (Japan) and processed using HKL2000 packages48 and the CCP4 suite49. The crystal belonged to the space group C2 with two molecules per asymmetric unit. The structure was determined by molecular replacement with Molrep50 using the Fv portion of an antibody structure (PDB code: 1IGC) as a search model. Refinement were performed till the Rfree value decreased to ~22% with REFMAC5. For rat GLUT5-Fv complex, diffraction data were collected at 100 K at SPring-8 beamline BL41XU (Japan) and processed using HKL2000 packages48 and the CCP4 suite 49. The dataset used for structure determination and refinement was generated by the combination of 4 datasets from 4 independent crystals. The space group was determined to be P21, with two rat GLUT5-Fv complexes per asymmetric unit. The structure was determined by molecular replacement with Molrep50 using two search models (polyalanine of the transmembrane region in the outward-facing conformation of FucP (PDB code: 3O7Q), and the separately determined 1.5 Å structure of the Fv fragment used in this study). Refinement were performed with PHENIX51 followed by manual examination and rebuilding of the refined coordinates using COOT52. Recently determined structures of XylE (PDB code: 4GC0) and human GLUT1 (PDB code: 4PYP) helped with the modeling. The 6 N-terminal residues (Met1-Gln6), 22 C-terminal residues (Ser481-Gln502), and 22 residues (Asn39-Asn60) in molecule A and 12 residues (Met45-Arg56) in molecule B in TM2 are not included in the structure as they did not have interpretable densities. For bovine GLUT5, data were collected on frozen crystals at beamline I02, Diamond Light Source (UK). The dataset used for structure determination and refinement was generated using HKL2000 by processing and scaling together two datasets collected on two different parts of the same crystal, and by correcting for anisotropy (UCLA server, http://services.mbi.ucla.edu/anisoscale/) (Extended Data Table 1 and 2 Extended Data Figure 1). The structure was solved by molecular replacement using the N-terminal and C-terminal bundles of rat GLUT5 as independent search models in PHASER, and refined using REFMAC5 and BUSTER against data up to 3.0 Å resolution after anisotropy correction53, with rounds of re-building in COOT52. Final refinement was performed using PHENIX51 at 3.2 Å resolution (Extended Data Figure 1). Structural alignments were performed using the align command of PYMOL software using C-alpha coordinates.
Homology modeling
Models for the outward-occluded and inward-occluded conformations were based on corresponding XylE crystal structures (4GBY and 4JA3, respectively) and were produced using Modeller 9v1254. Multiple alignment of GLUT5 homologs (Homo sapiens, Canis lupus, Rattus norvegicus, Felis catus, Gallus gallus, Anolis carolinensis) and xylE sequences were combined with structural data from the XylE structures and the GLUT5 structures using expresso mode of t-coffee55. The multiple alignment in combination with helical restraints corresponding to the TMs of bovine GLUT5 structure was used as an input for Modeller. For each conformation, 20 models were generated with loop optimization. The DOPE scoring function was used to select the final model. Outward-facing bovine GLUT5 was modeled with the same protocol based on the rat outward-facing GLUT5 structure and alignment of GLUT5 sequences. The four conformations (outward-open, outward-occluded, inward-occluded and inward-open) were morphed and rendered using PyMOL (http://www.pymol.org/).
Extended Data
Extended Data Table 1. Crystallographic data collection and refinement statistics.
rat GLUT5-Fv | bovine GLUT5 # | |
---|---|---|
Data collection | ||
Space group | P21 | P212121 |
Cell dimensions | ||
a, b, c (Å) | 76.78, 151.54, 106.40 | 74.61, 112.15, 139.57 |
α, β, γ (°) | 90.00, 97.25, 90.00 | 90,00, 90.00, 90.00 |
Resolution (Å) | 50-3.27 (3.39-3.27) | 100 - 3.00 (3.11 - 3.01)* |
Rsym or Rmerge | 21.5 (>100) | 10.06 (>100) |
I/σ/ | 11.6 (1.5) | 11.21 (0.86) |
Completeness (%) | 100 (100.0) | 99.4 (93.9) |
Redundancy | 13.0 (13.0) | 10.2 (8.6) |
Refinement | ||
Resolution (Å) | 50-3.27 (3.5-3.27) | 33.3-3.2 (3.31 - 3.20) |
No. reflections (Rfree set) | 38017 (3355) | 13346 (1331) |
Rwork/ Rfree | 24.2/28.8 (35.4/37.5) | 23.6/25.8 (32.8/36.5) |
No. atoms | ||
Protein | 10657 | 3382 |
B-factors | ||
Protein | 157.0 | 149.2 |
R.m.s deviations | ||
Bond lengths (Å) | 0.004 | 0.003 |
Bond angles (°) | 0.97 | 0.90 |
Ramachandran plot (%) | ||
Favored | 98.0 | 94.5 |
Outliers | 0 | 0 |
Data were obtained by scaling together two datasets collected on the same crystal
Highest resolution shell used in the final refinement is shown in parenthesis.
Extended Data Table 2. Completeness of bovine GLUT5 data per resolution shell after correction for anisotropy.
Resolution range (Å) | Completeness (%) |
---|---|
100.0 - 8.10 | 95.5 |
8.10 - 6.43 | 100.0 |
6.43 - 5.62 | 99.9 |
5.62 - 5.10 | 99.9 |
5.10 - 4.74 | 100.0 |
4.74 - 4.46 | 99.7 |
4.46 - 4.24 | 99.6 |
4.24 - 4.05 | 100.0 |
4.05 - 3.90 | 78.4 |
3.90 - 3.76 | 53.4 |
3.76 - 3.64 | 40.6 |
3.64 - 3.54 | 33.4 |
3.54 - 3.45 | 26.3 |
3.45 - 3.36 | 21.2 |
3.36 - 3.29 | 15.4 |
3.29 - 3.22 | 13.1 |
3.22 - 3.15 | 9.4 |
3.15 - 3.09 | 6.0 |
3.09 - 3.04 | 3.5 |
3.04 - 3.00 | 1.7 |
Supplementary Material
Acknowledgements
We are grateful to Dirk Slotboom, Alex Cameron, and Simon Newstead for discussions and comments, and James Mansfield for assistance with large-scale yeast fermentations. Data were collected at the European Synchrotron Radiation Facility, Diamond Light Source, and SPring-8 (Proposal Nos. 2011A1393, 2011B1229, 2012A1184, 2012B1253, 2013A1241, 2013B1237, 2014A1348, and 2014B1407), with excellent assistance from beamline scientists. This work was funded by the Knut and Alice Wallenberg Foundation (D.D), The Royal Society through the University Research Fellow scheme (D.D), the BBSRC (BB/G02325/1 to S.I.), the ERATO Human Receptor Crystallography Project of the Japan Science and Technology Agency (JST) (S.I.), by the Research Acceleration Program of the JST (S.I.), by the Targeted Proteins Research Program of the Ministry of Education, Culture, Sports, Science and Technology (MEXT) of Japan (S.I.), and by Grants-in-Aids for Scientific Research from the MEXT (No. 22570114 to N.N.), and by the Platform for Drug Discovery, Informatics, and Structural Life Science from the MEXT (T.K.). The authors are grateful for the use of the Membrane Protein Laboratory funded by the Wellcome Trust (grant 062164/Z/00/Z) at the Diamond Light Source Limited, and The Centre for Biomembrane Research (CBR), supported by the Swedish Foundation for Strategic Research. H.J.K. was a recipient of a Human Frontiers Postdoctoral fellowship and D.D acknowledges support from EMBO through the Young Investigator Program (YIP).
Footnotes
The coordinates and the structure factors for bovine and rat GLUT5 have been deposited in the Protein Data Bank with entries 4YB9 and 4YBQ, respectively.
The authors declare no competing financial interests.
References
- 1.Mueckler M, Thorens B. The SLC2 (GLUT) family of membrane transporters. Molecular aspects of medicine. 2013;34:121–138. doi: 10.1016/j.mam.2012.07.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Zhao FQ, Keating AF. Functional properties and genomics of glucose transporters. Current genomics. 2007;8:113–128. doi: 10.2174/138920207780368187. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Simpson IA, Vannucci SJ, Maher F. Glucose transporters in mammalian brain. Biochemical Society transactions. 1994;22:671–675. doi: 10.1042/bst0220671. [DOI] [PubMed] [Google Scholar]
- 4.James DE, Strube M, Mueckler M. Molecular cloning and characterization of an insulin-regulatable glucose transporter. Nature. 1989;338:83–87. doi: 10.1038/338083a0. [DOI] [PubMed] [Google Scholar]
- 5.Burant CF, Takeda J, Brot-Laroche E, Bell GI, Davidson NO. Fructose transporter in human spermatozoa and small intestine is GLUT5. The Journal of biological chemistry. 1992;267:14523–14526. [PubMed] [Google Scholar]
- 6.Kayano T, et al. Human facilitative glucose transporters. Isolation, functional characterization, and gene localization of cDNAs encoding an isoform (GLUT5) expressed in small intestine, kidney, muscle, and adipose tissue and an unusual glucose transporter pseudogene-like sequence (GLUT6) The Journal of biological chemistry. 1990;265:13276–13282. [PubMed] [Google Scholar]
- 7.Blakemore SJ, et al. The GLUT5 hexose transporter is also localized to the basolateral membrane of the human jejunum. The Biochemical journal. 1995;309(Pt 1):7–12. doi: 10.1042/bj3090007. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Douard V, Ferraris RP. Regulation of the fructose transporter GLUT5 in health and disease. American journal of physiology. Endocrinology and metabolism. 2008;295:E227–237. doi: 10.1152/ajpendo.90245.2008. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Rand EB, Depaoli AM, Davidson NO, Bell GI, Burant CF. Sequence, tissue distribution, and functional characterization of the rat fructose transporter GLUT5. The American journal of physiology. 1993;264:G1169–1176. doi: 10.1152/ajpgi.1993.264.6.G1169. [DOI] [PubMed] [Google Scholar]
- 10.Shepherd PR, Gibbs EM, Wesslau C, Gould GW, Kahn BB. Human small intestine facilitative fructose/glucose transporter (GLUT5) is also present in insulin-responsive tissues and brain. Investigation of biochemical characteristics and translocation. Diabetes. 1992;41:1360–1365. doi: 10.2337/diab.41.10.1360. [DOI] [PubMed] [Google Scholar]
- 11.Zisman A, et al. Targeted disruption of the glucose transporter 4 selectively in muscle causes insulin resistance and glucose intolerance. Nature medicine. 2000;6:924–928. doi: 10.1038/78693. [DOI] [PubMed] [Google Scholar]
- 12.Barone S, et al. Slc2a5 (Glut5) is essential for the absorption of fructose in the intestine and generation of fructose-induced hypertension. The Journal of biological chemistry. 2009;284:5056–5066. doi: 10.1074/jbc.M808128200. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Douard V, Ferraris RP. The role of fructose transporters in diseases linked to excessive fructose intake. The Journal of physiology. 2013;591:401–414. doi: 10.1113/jphysiol.2011.215731. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Zamora-Leon SP, et al. Expression of the fructose transporter GLUT5 in human breast cancer. Proceedings of the National Academy of Sciences of the United States of America. 1996;93:1847–1852. doi: 10.1073/pnas.93.5.1847. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Warburg O. On respiratory impairment in cancer cells. Science. 1956;124:269–270. [PubMed] [Google Scholar]
- 16.Yan N. Structural advances for the major facilitator superfamily (MFS) transporters. Trends in biochemical sciences. 2013;38:151–159. doi: 10.1016/j.tibs.2013.01.003. [DOI] [PubMed] [Google Scholar]
- 17.Madej MG, Sun L, Yan N, Kaback HR. Functional architecture of MFS D-glucose transporters. Proceedings of the National Academy of Sciences of the United States of America. 2014;111:E719–727. doi: 10.1073/pnas.1400336111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Maiden MC, Davis EO, Baldwin SA, Moore DC, Henderson PJ. Mammalian and bacterial sugar transport proteins are homologous. Nature. 1987;325:641–643. doi: 10.1038/325641a0. [DOI] [PubMed] [Google Scholar]
- 19.Pao SS, Paulsen IT, Saier MH., Jr. Major facilitator superfamily. Microbiology and molecular biology reviews. 1998;62:1–34. doi: 10.1128/mmbr.62.1.1-34.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Farwick A, Bruder S, Schadeweg V, Oreb M, Boles E. Engineering of yeast hexose transporters to transport D-xylose without inhibition by D-glucose. Proceedings of the National Academy of Sciences of the United States of America. 2014;111:5159–5164. doi: 10.1073/pnas.1323464111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Deng D, et al. Crystal structure of the human glucose transporter GLUT1. Nature. 2014;510:121–125. doi: 10.1038/nature13306. [DOI] [PubMed] [Google Scholar]
- 22.Sun L, et al. Crystal structure of a bacterial homologue of glucose transporters GLUT1-4. Nature. 2012;490:361–366. doi: 10.1038/nature11524. [DOI] [PubMed] [Google Scholar]
- 23.Quistgaard EM, Low C, Moberg P, Tresaugues L, Nordlund P. Structural basis for substrate transport in the GLUT-homology family of monosaccharide transporters. Nature structural & molecular biology. 2013;20:766–768. doi: 10.1038/nsmb.2569. [DOI] [PubMed] [Google Scholar]
- 24.Wisedchaisri G, Park MS, Iadanza MG, Zheng H, Gonen T. Proton-coupled sugar transport in the prototypical major facilitator superfamily protein XylE. Nature communications. 2014;5:4521. doi: 10.1038/ncomms5521. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Iancu CV, Zamoon J, Woo SB, Aleshin A, Choe JY. Crystal structure of a glucose/H+ symporter and its mechanism of action. Proceedings of the National Academy of Sciences of the United States of America. 2013;110:17862–17867. doi: 10.1073/pnas.1311485110. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Garcia JC, Strube M, Leingang K, Keller K, Mueckler MM. Amino acid substitutions at tryptophan 388 and tryptophan 412 of the HepG2 (Glut1) glucose transporter inhibit transport activity and targeting to the plasma membrane in Xenopus oocytes. The Journal of biological chemistry. 1992;267:7770–7776. [PubMed] [Google Scholar]
- 27.Li Q, et al. Cloning and functional characterization of the human GLUT7 isoform SLC2A7 from the small intestine. American journal of physiology. Gastrointestinal and liver physiology. 2004;287:G236–242. doi: 10.1152/ajpgi.00396.2003. [DOI] [PubMed] [Google Scholar]
- 28.Mueckler M, Makepeace C. Analysis of transmembrane segment 10 of the Glut1 glucose transporter by cysteine-scanning mutagenesis and substituted cysteine accessibility. The Journal of biological chemistry. 2002;277:3498–3503. doi: 10.1074/jbc.M109157200. [DOI] [PubMed] [Google Scholar]
- 29.Andersson M, et al. Proton-coupled dynamics in lactose permease. Structure. 2012;20:1893–1904. doi: 10.1016/j.str.2012.08.021. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Law CJ, et al. Salt-bridge dynamics control substrate-induced conformational change in the membrane transporter GlpT. Journal of molecular biology. 2008;378:828–839. doi: 10.1016/j.jmb.2008.03.029. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Schurmann A, et al. Role of conserved arginine and glutamate residues on the cytosolic surface of glucose transporters for transporter function. Biochemistry. 1997;36:12897–12902. doi: 10.1021/bi971173c. [DOI] [PubMed] [Google Scholar]
- 32.Seatter MJ, De la Rue SA, Porter LM, Gould GW. QLS motif in transmembrane helix VII of the glucose transporter family interacts with the C-1 position of D-glucose and is involved in substrate selection at the exofacial binding site. Biochemistry. 1998;37:1322–1326. doi: 10.1021/bi972322u. [DOI] [PubMed] [Google Scholar]
- 33.Hruz PW, Mueckler MM. Cysteine-scanning mutagenesis of transmembrane segment 7 of the GLUT1 glucose transporter. The Journal of biological chemistry. 1999;274:36176–36180. doi: 10.1074/jbc.274.51.36176. [DOI] [PubMed] [Google Scholar]
- 34.Manolescu A, Salas-Burgos AM, Fischbarg J, Cheeseman CI. Identification of a hydrophobic residue as a key determinant of fructose transport by the facilitative hexose transporter SLC2A7 (GLUT7) The Journal of biological chemistry. 2005;280:42978–42983. doi: 10.1074/jbc.M508678200. [DOI] [PubMed] [Google Scholar]
- 35.Kasahara T, Maeda M, Boles E, Kasahara M. Identification of a key residue determining substrate affinity in the human glucose transporter GLUT1. Biochimica et biophysica acta. 2009;1788:1051–1055. doi: 10.1016/j.bbamem.2009.01.014. [DOI] [PubMed] [Google Scholar]
- 36.Karpowich NK, Wang DN. Structural biology. Symmetric transporters for asymmetric transport. Science. 2008;321:781–782. doi: 10.1126/science.1161495. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Radestock S, Forrest LR. The alternating-access mechanism of MFS transporters arises from inverted-topology repeats. Journal of molecular biology. 2011;407:698–715. doi: 10.1016/j.jmb.2011.02.008. [DOI] [PubMed] [Google Scholar]
- 38.Solcan N, et al. Alternating access mechanism in the POT family of oligopeptide transporters. The EMBO journal. 2012;31:3411–3421. doi: 10.1038/emboj.2012.157. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Fukuda M, et al. Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK. Nature communications. 2015;6:7097. doi: 10.1038/ncomms8097. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Kota J, Gilstring CF, Ljungdahl PO. Membrane chaperone Shr3 assists in folding amino acid permeases preventing precocious ERAD. The Journal of cell biology. 2007;176:617–628. doi: 10.1083/jcb.200612100. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Newstead S, Kim H, von Heijne G, Iwata S, Drew D. High-throughput fluorescent-based optimization of eukaryotic membrane protein overexpression and purification in Saccharomyces cerevisiae. Proceedings of the National Academy of Sciences of the United States of America. 2007;104:13936–13941. doi: 10.1073/pnas.0704546104. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Drew D, et al. GFP-based optimization scheme for the overexpression and purification of eukaryotic membrane proteins in Saccharomyces cerevisiae. Nature protocols. 2008;3:784–798. doi: 10.1038/nprot.2008.44. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Kawate T, Gouaux E. Fluorescence-detection size-exclusion chromatography for precrystallization screening of integral membrane proteins. Structure. 2006;14:673–681. doi: 10.1016/j.str.2006.01.013. [DOI] [PubMed] [Google Scholar]
- 44.Sonoda Y, et al. Benchmarking membrane protein detergent stability for improving throughput of high-resolution X-ray structures. Structure. 2011;19:17–25. doi: 10.1016/j.str.2010.12.001. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Suharni, et al. Proteoliposome-based selection of a recombinant antibody fragment against the human M2 muscarinic acetylcholine receptor. Monoclonal Antibodies in Immunodiagnosis and Immunotherapy. 2014;33:378–385. doi: 10.1089/mab.2014.0041. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Sonoda Y, et al. Tricks of the trade used to accelerate high-resolution structure determination of membrane proteins. FEBS letters. 2010;584:2539–2547. doi: 10.1016/j.febslet.2010.04.015. [DOI] [PubMed] [Google Scholar]
- 47.Sarkar HK, Thorens B, Lodish HF, Kaback HR. Expression of the human erythrocyte glucose transporter in Escherichia coli. Proceedings of the National Academy of Sciences of the United States of America. 1988;85:5463–5467. doi: 10.1073/pnas.85.15.5463. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Minor Z. O. a. W. Processing of X-ray Diffraction Data Collected in Oscillation Mode. Methods in Enzymology. 1997;276:307–326. doi: 10.1016/S0076-6879(97)76066-X. [DOI] [PubMed] [Google Scholar]
- 49.Collaborative Computational Project, N. The CCP4 suite: programs for protein crystallography. Acta crystallographica. Section D, Biological crystallography. 1994;50:760–763. doi: 10.1107/S0907444994003112. [DOI] [PubMed] [Google Scholar]
- 50.Vagin A, Teplyakov A. Molecular replacement with MOLREP. Acta crystallographica. Section D, Biological crystallography. 2010;66:22–25. doi: 10.1107/S0907444909042589. [DOI] [PubMed] [Google Scholar]
- 51.Adams PD, et al. PHENIX: building new software for automated crystallographic structure determination. Acta crystallographica. Section D, Biological crystallography. 2002;58:1948–1954. doi: 10.1107/s0907444902016657. [DOI] [PubMed] [Google Scholar]
- 52.Emsley P, Cowtan K. Coot: model-building tools for molecular graphics. Acta crystallographica. Section D, Biological crystallography. 2004;60:2126–2132. doi: 10.1107/S0907444904019158. [DOI] [PubMed] [Google Scholar]
- 53.Blanc E, et al. Refinement of severely incomplete structures with maximum likelihood in BUSTER-TNT. Acta crystallographica. Section D, Biological crystallography. 2004;60:2210–2221. doi: 10.1107/S0907444904016427. [DOI] [PubMed] [Google Scholar]
- 54.Eswar N, et al. Comparative protein structure modeling using MODELLER. Current protocols in protein science / editorial board, John E. Coligan … [et al.] 2007 doi: 10.1002/0471140864.ps0209s50. Chapter 2, Unit 2.9. [DOI] [PubMed] [Google Scholar]
- 55.Notredame C, Higgins DG, Heringa J. T-Coffee: A novel method for fast and accurate multiple sequence alignment. Journal of molecular biology. 2000;302:205–217. doi: 10.1006/jmbi.2000.4042. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.