Skip to main content
Malaria Journal logoLink to Malaria Journal
. 2016 Feb 27;15:123. doi: 10.1186/s12936-016-1146-4

Antibody levels against GLURP R2, MSP1 block 2 hybrid and AS202.11 and the risk of malaria in children living in hyperendemic (Burkina Faso) and hypo-endemic (Ghana) areas

Bright Adu 1,#, Mariama K Cherif 2,3,#, Samuel Bosomprah 4, Amidou Diarra 3, Fareed K N Arthur 5, Emmanuel K Dickson 1, Giampietro Corradin 6, David R Cavanagh 7, Michael Theisen 8, Sodiomon B Sirima 3, Issa Nebie 3,, Daniel Dodoo 1,
PMCID: PMC4769494  PMID: 26921176

Abstract

Background

Differences in parasite transmission intensity influence the process of acquisition of host immunity to Plasmodium falciparum malaria and ultimately, the rate of malaria related morbidity and mortality. Potential vaccines being designed to complement current intervention efforts therefore need to be evaluated against different malaria endemicity backgrounds.

Methods

The associations between antibody responses to the chimeric merozoite surface protein 1 block 2 hybrid (MSP1 hybrid), glutamate-rich protein region 2 (GLURP R2) and the peptide AS202.11, and the risk of malaria were assessed in children living in malaria hyperendemic (Burkina Faso, n = 354) and hypo-endemic (Ghana, n = 209) areas. Using the same reagent lots and standardized protocols for both study sites, immunoglobulin (Ig) M, IgG and IgG sub-class levels to each antigen were measured by ELISA in plasma from the children (aged 6–72 months). Associations between antibody levels and risk of malaria were assessed using Cox regression models adjusting for covariates.

Results

There was a significant association between GLURP R2 IgG3 and reduced risk of malaria after adjusting age of children in both the Burkinabe (hazard ratio 0.82; 95 % CI 0.74–0.91, p < 0.0001) and the Ghanaian (HR 0.48; 95 % CI 0.25–0.91, p = 0.02) cohorts. MSP1 hybrid IgM was associated (HR 0.85; 95 % CI 0.73–0.98, p = 0.02) with reduced risk of malaria in Burkina Faso cohort while IgG against AS202.11 in the Ghanaian children was associated with increased risk of malaria (HR 1.29; 95 % CI 1.01–1.65, p = 0.04).

Conclusion

These findings support further development of GLURP R2 and MSP1 block 2 hybrid, perhaps as a fusion vaccine antigen targeting malaria blood stage that can be deployed in areas of varying transmission intensity.

Electronic supplementary material

The online version of this article (doi:10.1186/s12936-016-1146-4) contains supplementary material, which is available to authorized users.

Keywords: Malaria, Antibodies, GLURP R2, MSP1 block 2 hybrid, AS202.11, Hyperendemic, Hypo-endemic, Transmission intensity

Background

Falciparum malaria remains a significant cause of infant mortality and morbidity in many parts of the world especially in sub-Saharan Africa even though decreasing trends of transmission intensity have been reported [13]. An efficacious blood stage vaccine against malaria that remains potent in different transmission settings would greatly contribute to reducing the disease burden among endemic populations. However, the putative antigenic targets of protective immunity against malaria have remained elusive and several parasite proteins have been implicated, most of which are polymorphic. Antibody responses targeting polymorphic malaria parasite surface proteins have been associated with reduced risk of malaria [46]. This may partly explain the need for repeated infections in the acquisition of natural protective immunity among adults living in endemic populations [7]. While polymorphic antigens may not be the most ‘attractive’ candidates for vaccine design, it is thought that such a vaccine, if successful, could elicit a broad spectrum of immune repertoire particularly in children and other vulnerable groups [8]. The merozoite surface protein (MSP)1 is synthesized in a precursor form as a 195kD protein and proteolytically cleaved into fragments prior to schizont rupture [9]. The carboxy-terminal portion is largely conserved with only a few single nucleotide polymorphisms (SNPs) [10] while the amino-terminal portion has the most polymorphic region, termed block 2 [11, 12]. Antibody responses directed against the block 2 region have been associated with reduced risk of clinical malaria in different populations [5, 13, 14]. A synthetic MSP1 block 2 construct, based on several polymorphic variants found in natural Plasmodium falciparum isolates was designed and fused with the relatively conserved block 1 sequence of MSP1 to form the MSP1 block 2 hybrid [8]. This synthetic protein was immunogenic in experimental animal models and was recognized by sera from Burkinabe and Ghanaian children naturally exposed to the parasite [8]; however, studies assessing anti-MSP1 block 2 hybrid antibodies in relation to the risk of malaria in longitudinal cohorts is currently lacking.

The glutamate rich protein-region 2 (GLURP R2) is from the carboxy-terminal repeat region of GLURP and is the most immunodominant portion of the protein [15]. Compared to the amino terminal GLURP R0 region, which has been extensively studied [16, 17] and forms part of the GMZ2 candidate vaccine [18] presently in phase 2b clinical trials, GLURP R2 has been less studied. GLURP R2 contains at least two B cell epitopes and elicits antibodies capable of inhibiting malaria parasite growth in vitro in cooperation with monocytes [19]. Importantly, anti-GLURP R2 antibodies were associated with reduced risk of symptomatic malaria infection in Burkinabe [20] and Ghanaian [21] children. Alpha (α) helical coiled motifs in malaria antigens, such as MSP3 and MSP6, are important oligomerization sub-units and targets of malaria protective antibodies [22, 23]. When separated from the whole protein, α-helical coiled motifs readily fold into the same stable oligomeric structure [24]. Thus, such motifs could potentially be fused to other antigenic targets of malaria protective antibodies to form chimeric proteins capable of eliciting broader spectrum immune response. The peptide AS202.11 (PF11 0424) (described elsewhere [25]) is an α-helical coiled motif. Antibody responses to this peptide showed a modest association with reduced risk of clinical malaria in children resident in the Kilifi district of Kenya [25]. This study successfully evaluated the associations between antibody responses against GLURP R2, MSP1 block 2 hybrid and the peptide AS202.11 and the risk of malaria in two populations (Burkina Faso and Ghana) with different malaria transmission intensities.

Methods

Ethics statement

The Burkina Faso study was approved by the Ethical Committee for Biomedical Research of the Ministry of Health of Burkina Faso, while in Ghana, the study was approved by the Institutional Review Board of Noguchi Memorial Institute for Medical Research (NMIMR) of the University of Ghana, Accra. At both study sites, written informed consent was given by the parent or guardian of children prior to their enrolment into the study.

Study sites

Burkina Faso: Balonghin–Sapone

The Sapone health district is 50 km southeast of Ouagadougou, the capital city of Burkina Faso. The area has been described elsewhere [26]. The climate in this area is characteristic of the Sudanese savannah, with a dry season from November to May (low transmission season) and a rainy season from June to October (high transmission season). Malaria transmission is markedly seasonal; most transmission occurs during the rainy season. The entomological inoculation rate (EIR) in Balonghin was estimated at 0.3 infective bites per person per month during the dry season and 44.4 infective bites per person per month during the rainy seasons [26]. Plasmodium falciparum is the predominant malaria parasite, accounting for more than 95 % of infections.

Ghana: Asutsuare–Damgbe West

The study was conducted in Asutsuare about 120 km northeast of Accra and five neighbouring villages of the Damgbe West district in the southeastern part of Ghana, described elsewhere [27]. Briefly, rainfall is usually continuous throughout the year but highest from June to August and moderate in November and December just before the beginning of the dry season. Thus, there are two seasonal peaks of malaria transmission corresponding to the wet seasons but also relatively minimal transmission throughout the remaining times of the year. Malaria incidence in Asutsuare was 8.9 % in 2009 [27], the year of the present study. However, the incidence rate of clinical malaria was reported as 106.6 per 1000 population in Dodowa a suburb of about 44 km away in 1992 [28]. About 98 % of malaria cases in the area are due to P. falciparum infection while Plasmodium ovale and Plasmodium malariae account for the remaining [29].

Study design, sample collection and follow-up

In Burkina Faso, 525 children aged 6–60 months inclusive were enrolled in the study while the Ghanaian cohort consisted of 600 individuals aged one to 29 years. However, for comparison purposes, the current study excluded the older aged Ghanaians and only included 209 Ghanaian children (aged 12–72 months) and the 354 Burkinabe children who completed the follow-up. At both study sites, participants were enrolled prior to the high malaria transmission season (Fig. 1). During baseline (enrolment) sampling at each site, 5 ml (or about 1 ml for younger children) EDTA-anticoagulated venous blood was collected from each child and centrifuged. Plasma obtained was aliquoted and stored at −20 °C for immunological analyses. Thick and thin film blood slides (TTBS) were obtained for microscopy diagnosis of malaria. The ensuing active case detection during the longitudinal follow-up was either twice weekly (Burkina Faso) or weekly (Ghana). The follow-up duration was 39 weeks for the Burkinabe and 36 weeks for the Ghanaian cohorts, respectively. Axillary temperature was measured on each visit of a child by a trained field assistant and children with fever, defined as axillary temperature >37.5 °C or a history of fever reported within the last 24 h. In Burkina Faso, malaria rapid diagnostic test (RDT) was performed and children with positive results were referred to the nearest health centre for appropriate treatment. In Ghana, children with fever were referred without RDT, to the health centres and TTBS made. Children diagnosed with malaria were treated with artemisinin-based combination therapy which was the standard treatment for malaria in both countries at the time of the study. At both study sites, clinical malaria was defined as axillary temperature ≥37.5 °C (or history of fever in the last 24 h preceding the visit) and parasite density ≥5000/μl with at least one other sign of malaria such as vomiting, diarrhoea or malaise. Parasite density determination by microscopy was determined as previously described [26].

Fig. 1.

Fig. 1

Site-specific transmission seasons and period of cohort enrolment. BF Burkina Faso, GH Ghana

Malaria antigens

The recombinant GLURP R2 (amino acids 705-1178) of the carboxy-terminal repeat region expressed in Escherichia coli [15]. The MSP1 hybrid (described in detail elsewhere, [8]) was from a synthetic gene designed to incorporate sequences derived from one version of the semi-conserved block 1 and all three serotypes of the highly polymorphic block 2 of MSP1. Briefly, the upstream sequence corresponds to the block 1 sequence from K1-type MSP1 and is followed by artificially designed sequences which include the three main variants of the block 2 found in over 150 laboratory and field isolates. The RO33 type contains minimal point mutations only while the other two types (K1 and MAD20) are characterized by unique, serotype-specific flanking sequences, each containing different sets of tripeptide repeats which differ within each serotype by both order and number. The resulting MSP-1 block 2 hybrid construct of 348 amino acids in length (in a pET24a expression vector) was expressed as a 31 kDa untagged protein in the E. coli BLR (DE3) pLysS strain. The synthetic peptide, AS202.11-(QLEEKTKQYNDLQNNMKTIKEQNEHLKNKFQSMGK) used in the study has been described in detail elsewhere [30].

Antigen-specific antibody measurement

Antigen-specific antibody levels were measured using the Afro Immuno Assay (AIA) ELISA protocol [16, 31] with modifications. Briefly, 96-well microtitre ELISA plates (Maxisorp Nunc, Denmark) were coated with antigens at 1.0 μg/ml (GLURP R2 and MSP1 hybrid) or 5.0 μg/ml (AS202.11) in 1X PBS (pH 7.04). Coated plates were kept in a refrigerator at 2–8 °C overnight. Plates were blocked (PBS with 5 % milk powder, 0.1 % Tween-20) and incubated at room temperature (RT) in a humidified chamber for 1 h. Plasma samples diluted at 1:200 in serum dilution buffer (PBS with 2.5 % milk powder, 0.1 % Tween-20 and 0.02 % Na-azide) were added in duplicates and incubated 2 h at RT. To control for inter-assay and day-to-day variations each ELISA plate included a reference curve obtained by a two-fold titration of pool of hyper immune plasma. In addition, each plate included a negative control sample (a pool of plasma sample from Danish blood donors never exposed to malaria), a positive control sample (plasma from clinically semi-immune adults obtained from the Korle-Bu blood bank, Accra) and a buffer blank. The dilutions for the horseradish peroxidase (HRP) conjugated secondary antibodies used in the assays were: goat anti-human IgG (γ) (H10007) (Invitrogen Corporation, CA, USA) (1:80,000) and goat anti-human IgM (μ) (H15007) (Invitrogen) (1:3000). The IgG sub-classes were detected using HRP-conjugated sheep anti-human IgG1 (AP006) (1:5000), IgG2 (AP007) (1:2000), IgG3 (AP008) (1:10,000) and IgG4 (AP009) (1:1000) antibodies (The Binding Site Group Ltd, UK), respectively. These were added at 100 μl/well to respective plates and incubated for 1 h at RT. Plates were washed (PBS with 0.1 % Tween-20 and 0.5 M NaCl) four times between consecutive steps. Bound secondary antibodies were quantified using TMB (3,3′,5,5′-tetramethylbenzidine) substrate (Kem-En-Tec Diagnosis A/S, Taastrup, Denmark) and incubated in the dark for 30 min. Optical density (OD) was read at 450 nm. The OD values for the test samples were converted into antibody units (AU) with the standard reference curves generated for each ELISA plate using a four-parameter curve-fit Microsoft Excel-based application (ADAMSEL b040, Ed Remark© 2009). Samples were re-tested if the coefficient of variation between duplicate absorbance values were higher than 15 % and plates were also re-tested if the R2 value of the standard curve was less than 97 %. The same ELISA protocols, reagents lot and batch of positive and negative control samples were used at both study sites.

Statistical analysis

Individuals were categorized as either responders or non-responders for each antigen based on IgG cut-off value calculated by the mixture model [32]. Mixture models have been reported extensively in characterising individual’s exposure status in infectious diseases [3335] and have been applied in malaria research [3638]. Briefly, normalized (log 10 transformation) IgG AU for each antigen was fitted as the sum of two Gaussian distributions by maximum likelihood methods. The cut-off for responder was defined as mean AU of the narrow distribution (non-responder population) plus three standard deviations. The AS202.11 antigen, IgG sub-class levels were too low in both cohorts during protocol optimization and hence these were not measured in the final ELISA analysis. For each antigen, scatter plot and univariate linear regression analyses were used to assess the relationship between antibody levels and age. Cumulative malaria incidence and 95 % confidence interval estimated by the Kaplan–Meier method were defined as the proportion of children with at least one episode of clinical malaria by the end of surveillance period. Incidence rate was defined as the ratio of the total number of clinical malaria episodes to the total child months at risk. For estimating 95 % confidence interval on the incidence rates, standard errors were calculated using the method described by Stukel et al. [39], which allows for repeated episodes in the same child. This assumes rates are constant over time. Cox regression including all episodes of clinical malaria, and using a robust estimate of the standard error that takes into account the correlation among multiple episodes per person was used to estimate the rate ratio. Antibody level was modelled as continuous variable transformed to log base 10 so that rate ratios indicate the decrease in incidence rate of malaria corresponding to a ten-fold increase in baseline antibody levels. Age, baseline parasitaemia and gender were considered a potential confounder and were adjusted for in the analysis. Age was modelled as a categorical variable with four levels: 6–23, 24–35, 36–47, and 48–72 months. Cases occurring within 14 days of the start of treatment for malaria were assumed to be relapse of the original case and were not counted. The time at risk for each child was calculated based on date of start of follow-up and date of end of the study or until the child was censored. Both site specific and pooled analysis of hazard ratios for the association between antibody levels and clinical malaria were performed. Stata version 10 for Windows (College Station, Texas, USA) and R v3.2.2 [40] were used for the analyses.

Results

Plasmodium falciparum infection in the study cohorts

Altogether, 563 children aged 6–72 months were included in the study. They comprised 354 and 209 children from Burkina Faso and Ghana, respectively, who completed the entire duration of the follow-up at each site. The Burkinabe children (mean age = 34.2 months) were significantly younger than the Ghanaian children (mean age = 51.8 months) (p < 0.0001, Welch Two Sample t-test). No child used insecticide-treated nets (ITN) in the Burkinabe cohort while among the Ghanaian children, ITN usage was 31.6 % but was not associated with clinical malaria (p > 0.05, Pearson’s Chi squared test). Baseline parasite prevalence was higher in the Burkinabe, [61.9 %, (219/354)] than in the Ghanaian [2.9 %, (6/209)] cohort (Table 1). The cumulative incidence of malaria decreased with age of study participants, although this observation was more prominent in the Burkinabe than in the Ghanaian cohort (Table 1). Similarly, cumulative malaria incidence was lower in responders to GLURP R2 and MSP1 hybrid in Burkina Faso but this trend was not seen in the Ghanaian cohort. Malaria incidence among responders and non-responders to AS202.11 did not differ either among Burkinabe or Ghanaian children (Table 1). The proportion of children with at least one episode of clinical malaria at the end of the follow-up period was 70.7 % (95 % CI 65.8–75.3) in Burkina Faso and 8.6 % (95 % CI 5.5–13.3) in Ghana (Table 1). The number of malaria episodes per child ranged from nought to seven in Burkina Faso and nought to two in Ghana (Additional file 1: Table S1). A total of 154 (43.5 %) Burkinabe children experienced at least two malaria episodes while only a single child in Ghana had exactly two episodes (Additional file 1: Table S1).

Table 1.

Characteristics of Burkina Faso and Ghana study populations

Characteristics Burkina Faso Ghana
N Cumulative incidence (95 % CI)a Child-months at risk Malaria cases Rate per 100 child-months (95 % CI)b N Cumulative incidence (95 %CI)a Child-months at risk Malaria cases Rate per 100 child-months (95 % CI)c
Age group (months)
 6–23 99 83.7 % (75.7, 90.2) 1071.2 191 17.8 (15.9, 19.7) 16 43.8 % (23.8, 70.5) 152.7 7 4.6 (2.2, 9.6)
 24–35 87 82.5 % (73.7, 89.7) 947.0 176 18.6 (16.6, 20.6) 54 5.6 % (1.8, 16.2) 509.8 3 0.6 (0.2, 1.8)
 36–47 90 69.7 % (60, 78.8) 982.0 120 12.2 (10, 14.4) 54 5.6 % (1.8, 16.2) 510.8 3 0.6 (0.2, 1.8)
 48–72 78 42.4 % (32.3, 54.2) 851.0 52 6.1 (3.8, 8.4) 85 5.9 % (2.5, 13.6) 802.1 6 0.7 (0.3, 1.7)
Baseline parasitaemia status
 Negative 132 82.6 % (75.7, 88.5) 1432.9 249 17.4 (15.8, 19) 203 8.9 % (5.7, 13.7) 1919.0 19 1.0 (0.6, 1.6)
 Positive 219 63.8 % (57.4, 70.2) 2386.5 288 12.1 (10.6, 13.6) 6 0 % 0 0
GLURP R2 IgG serological status
 Non-responder 230 80 % (74.6, 84.9) 2499.5 404 16.2 (14.9, 17.4) 167 9 % (5.5, 14.5) 1577.0 16 1.0 (0.6, 1.7)
 Responder 124 52.6 % (44, 61.7) 1351.7 135 10 (7.9, 12.1) 42 7 % (2.4, 20.5) 398.3 3 0.8 (0.2, 2.3)
MSP1 hybrid IgG serological status
 Non-responder 272 75.1 % (69.8, 80.2) 2953.8 448 15.2 (13.9, 16.4) 166 8.4 % (5.1, 13.8) 1567.7 15 1.0 (0.6, 1.6)
 Responder 82 56.1 % (45.8, 67) 897.4 91 10.1 (7.7, 12.6) 43 9.3 % (3.6, 22.9) 407.6 4 1.0 (0.4, 2.6)
AS202.11 IgG serological status
 Non-responder 313 71 % (65.9, 75.9) 3406.2 486 14.3 (13.1, 15.5) 184 9.2 % (5.9, 14.4) 1738.5 18 1.0 (0.7, 1.6)
 Responder 41 68.1 % (53.4, 81.9) 444.9 53 11.9 (9, 14.8) 25 4 % (0.6, 25.2) 236.8 1 0.4 (0.1, 3.0)
Total 354 70.7 % (65.8, 75.3) 3851.2 539 14 (12.9, 15.1) 209 8.6 % (5.5, 13.3) 1975.3 19 1.0 (0.6, 1.5)

N number of children

aCumulative incidence and 95 % CI was calculated using Kaplan-Meier method

b95 % CI was calculated using the method by Stukel et al., [32]

c95 % CI was calculated using standard method for rate; there was only one multiple episode

Relationship between antibody levels and age of study participants

The levels of isotype IgG, IgM and IgG sub-classes against all three antigens (GLURP R2, MSP1 hybrid and AS202.11), except IgG1 and IgG4 against MSP1 hybrid, increased significantly (p < 0.05) with age in children from Burkina Faso (Table 2). Among the Ghanaian children, only levels IgG3 against GLURP R2 and IgM against all the antigens increased significantly (p < 0.05) with age. The adjusted R2 values from the univariate linear regression analysis of antibody levels and age was generally low especially for the Ghanaian cohort (adjusted R2 range: Burkina Faso = 0.0013–0.16; Ghana = 0–0.054) (Table 2). Except for anti-AS202.11 IgM antibody levels, children in the Burkinabe cohort always had higher antibody levels against the studied antigens than those in the Ghanaian cohort (Fig. 2a, b).

Table 2.

Relationship between antibody levels and age

Burkina Faso Ghana
Antibody Antigen Coefficient (95 % CI) p value Adjusted R2 Coefficient (95 % CI) p value Adjusted R2
IgG GLURP R2 6.69 (4.10, 10.91) <0.0001 0.14 2.82 (0.97, 8.23) 0.057 0.013
MSP1-hybrid 9.28 (4.75, 18.13) <0.0001 0.11 1.56 (4.10, 5.93) 0.51 0
AS202.11 2.23 (1.33, 4.28) 0.0037 0.021 0.86 (0.35, 2.14) 0.73 0
IgG1 GLURP R2 5.55 (2.91, 10.60) <0.0001 0.069 3.09 (1.00, 9.61) 0.051 0.014
MSP1-hybrid 2.08 (0.63, 6.83) 0.23 0.0013 0.71 (0.37, 1.36) 0.3 0.0004
IgG2 GLURP R2 10.37 (6.00, 17.94) <0.0001 0.16 2.39 (0.70, 8.12) 0.16 0.0047
MSP1-hybrid 21.88 (6.98, 68.57) <0.0001 0.072 1.00 (0.28, 3.66) 1 0
IgG3 GLURP R2 6.16 (4.02, 9.43) <0.0001 0.16 2.93 (1.20, 7.16) 0.019 0.021
MSP1-hybrid 2.81 (1.85, 4.26) <0.0001 0.061 3.09 (0.90, 1.06) 0.073 0.011
IgG4 GLURP R2 2.76 (1.62, 4.71) 0.00021 0.036 8.81 (0.94, 82.24) 0.056 0.013
MSP1-hybrid 1.88 (0.96, 3.68) 0.064 0.0069 3.42 (0.62, 18.77) 0.16 0.005
IgM GLURP R2 36.64 (14.83, 90.52) <0.0001 0.15 35 (5.01, 248.77) 0.0004 0.054
MSP1-hybrid 8.76 (3.18, 24.12) <0.0001 0.045 7.62 (1.05, 55.45) 0.045 0.015
AS202.11 3.60 (1.75, 7.41) 0.00055 0.031 6.86 (1.20, 3.93) 0.031 0.018

Coefficient, 95 % confidence level (CI), p values and adjusted R2 values were calculated from univariate linear regression models

Fig. 2.

Fig. 2

Isotype IgG and IgM and IgG sub-class levels in relation to age. a Total IgG or IgM levels against the antigens AS202.11 (top), GLURP R2 (middle) and MSP1 hybrid (bottom), respectively. b IgG1, IgG2, IgG3, or IgG4 levels against the antigens GLURP R2 (left) and MSP1 hybrid (right), respectively. Linear regression lines are shown for each antigen specific antibody level for each site

Antigen-specific antibodies in relation to risk of clinical malaria

In the Burkinabe cohort, isotype IgG responses against GLURP R2 (HR 0.84; 95 % CI 0.73–0.97; p = 0.01) and MSP1 hybrid (HR 0.83; 95 % CI 0.70–0.98; p = 0.03) were significantly associated with reduced risk of clinical malaria after adjusting for age (Table 3). Of the IgG sub-class responses, IgG2 and IgG4 against GLURP R2 and IgG3 against both GLURP R2 and MSP1 hybrid were all significantly associated with reduced risk of malaria (p < 0.05) in children from Burkina Faso (Table 3). Isotype IgM responses against both GLURP R2 (HR 0.77; 95 % CI 0.63–0.95; p = 0.01) and MSP1 hybrid (HR 0.82; 95 % CI 0.71–0.94; p = 0.01) were also significantly associated with reduced risk of clinical malaria in the Burkinabe cohort. In the Ghanaian cohort, only IgG3 against GLURP R2 was significantly (HR 0.54; 95 % CI 0.30–0.98; p = 0.04) associated with decreased risk of malaria (Table 3). When the two cohorts were combined, all GLURP R2 antibodies, except IgG1, were significantly associated with reduced risk of malaria as was IgM against MSP1 hybrid (Table 3). In a final model to assess immunological variables independently associated with malaria, IgG3 against GLURP R2 (in both study sites) and IgM against MSP1 hybrid (in Burkina Faso only) were significantly (p < 0.05) associated with reduced risk of malaria (Table 4). On the other hand, IgG against AS202.11 was associated with increased risk of clinical malaria (HR 1.29; 95 % CI 1.01–1.65; p = 0.04) in the Ghanaian cohort (Table 4).

Table 3.

Association between antibody levels and clinical malaria among children from Burkina Faso and Ghana

Antibody Antigens Burkina Faso Ghana Overall
Crude HR (95 % CI) HR adjusted for age (95 % CI)a p value for adjusted HR Crude HR (95 % CI) HR adjusted for age (95 % CI)a p value for adjusted HR Crude HR (95 % CI)b HR adjusted for age (95 % CI)b p value for adjusted HR
IgG GLURP R2 0.75 (0.66, 0.85) 0.84 (0.73, 0.97) 0.01 0.77 (0.44, 1.34) 0.73 (0.41, 1.30) 0.28 0.75 (0.66, 0.85) 0.85 (0.74, 0.97) 0.02
MSP1-hybrid 0.73 (0.61, 0.87) 0.83 (0.70, 0.98) 0.03 1.40 (0.64, 3.08) 1.19 (0.57, 2.50) 0.64 0.75 (0.63, 0.89) 0.85 (0.72, 1.01) 0.06
AS202.11 0.93 (0.82, 1.05) 0.97 (0.87, 1.09) 0.65 1.37 (0.89, 2.11) 1.15 (0.85, 1.56) 0.38 0.93 (0.82, 1.06) 0.98 (0.88, 1.10) 0.76
IgG1 GLURP R2 0.86 (0.73, 1.00) 0.97 (0.82, 1.14) 0.68 0.93 (0.47, 1.85) 0.91 (0.45, 1.86) 0.8 0.86 (0.74, 1.00) 0.97 (0.83, 1.14) 0.69
MSP1-hybrid 0.96 (0.75, 1.23) 0.96 (0.77, 1.21) 0.76 1.22 (0.78, 1.92) 1.03 (0.67, 1.58) 0.91 1.00 (0.80, 1.25) 1.01 (0.82, 1.24) 0.94
IgG2 GLURP R2 0.74 (0.65, 0.83) 0.85 (0.75, 0.96) 0.01 1.45 (0.71, 2.97) 1.24 (0.64, 2.43) 0.52 0.74 (0.66,0.84) 0.86 (0.76, 0.98) 0.02
MSP1-hybrid 0.73 (0.59, 0.91) 0.87 (0.70, 1.08) 0.2 1.19 (0.47, 3.01) 1.17 (0.51, 2.67) 0.72 0.74 (0.60, 0.92) 0.89 (0.72, 1.10) 0.27
IgG3 GLURP R2 0.73 (0.66, 0.81) 0.81 (0.73, 0.90) <0.0001 0.48 (0.25, 0.93) 0.54 (0.30, 0.98) 0.04 0.73 (0.66, 0.81) 0.81 (0.73, 0.90) <0.0001
MSP1-hybrid 0.85 (0.78, 0.93) 0.91 (0.84, 0.99) 0.04 0.82 (0.38, 1.77) 0.83 (0.33, 2.08) 0.69 0.86 (0.78, 0.94) 0.92 (0.84, 1.00) 0.05
IgG4 GLURP R2 0.79 (0.68, 0.92) 0.85 (0.73, 0.98) 0.02 1.18 (0.31, 4.57) 1.30 (0.38, 4.43) 0.68 0.79 (0.68, 0.92) 0.85 (0.73, 0.98) 0.02
MSP1-hybrid 0.95 (0.83, 1.09) 0.97 (0.85, 1.11) 0.65 1.14 (0.32, 4.03) 0.82 (0.29, 2.31) 0.7 0.95 (0.83, 1.09) 0.98 (0.86, 1.11) 0.73
IgM GLURP R2 0.66 (0.55, 0.79) 0.77 (0.63, 0.95) 0.01 0.70 (0.14, 3.57) 1.14 (0.24, 5.40) 0.87 0.66 (0.55, 0.79) 0.78 (0.64, 0.95) 0.02
MSP1-hybrid 0.72 (0.63, 0.84) 0.81 (0.70, 0.94) 0.01 1.42 (0.25, 8.07) 1.68 (0.36, 7.93) 0.51 0.73 (0.63, 0.84) 0.82 (0.70, 0.95) 0.01
AS202.11 0.86 (0.74, 0.99) 0.92 (0.80, 1.05) 0.23 0.58 (0.23, 1.45) 0.70 (0.26, 1.90) 0.49 0.85 (0.74, 0.98) 0.92 (0.80, 1.06) 0.23

Crude hazard ratios (HR) as well as age-adjusted HR and p values are shown, indicating the ratio of malaria hazard rates associated with a tenfold increase in baseline antibody level

a95 % CI were estimated using Cox regression model with robust standard error to adjust for clustering in children

bStratified estimates (i.e., equal coefficients across sites but with baseline hazard unique to each site)

Table 4.

Adjusted hazard ratios for immunological variables independently associated with malaria risk in the final model

Sites Immunological/age variables Adjusted HR (95 % CI) Wald p value
Burkina Faso GLURP R2 IgG3 (values transformed to log base 10) 0.82 (0.74, 0.91) p < 0.0001
MSP1-hybrid IgM (values transformed to log base 10) 0.85 (0.73, 0.98) p = 0.02
Age group (months)
 6–23 1 p < 0.0001
 24–35 1.12 (0.91, 1.38)
 36–47 0.82 (0.62, 1.07)
 48–60 0.44 (0.31, 0.63)
Ghana GLURP R2 IgG3 (values transformed to log base 10) 0.48 (0.25, 0.91) p = 0.02
AS202.11 IgG (values transformed to log base 10) 1.29 (1.01, 1.65) p = 0.04
Age group (months)
 6–23 1 p < 0.01
 24–35 0.14 (0.04, 0.48)
 36–47 0.14 (0.04, 0.48)
 48–72 0.19 (0.07, 0.55)

Hazard ratios (HR) indicates the ratio of malaria hazard rates associated with a ten-fold increase in baseline antibody level

Discussion

The association between antibody levels against GLURP R2, MSP1 block 2 hybrid and AS202.11 and the risk of clinical malaria was investigated in two independent immune-epidemiological studies conducted in malaria hyperendemic (Burkina Faso) and hypo-endemic (Ghana) populations, respectively, using the same study protocols and reagents lots. Overall, high levels of IgG3 against GLURP R2 was strongly associated with reduced risk of clinical malaria in both Burkinabe and Ghanaian children despite the marked differences in malaria transmission intensity between these two populations. In Burkinabe children, IgM responses against MSP1 hybrid contributed significantly to reducing the risk of clinical malaria while in Ghanaian children, increased levels of IgG against the peptide AS202.11 was associated with about 29 % increased risk of clinical malaria (Table 4). In previous studies, IgG against AS202.11 was found to increase with age and associated with protection from malaria of Kenyan children [25] living in an area of high malaria transmission (EIR ranging from 20 to 100 infective bites per year [41]). Here, malaria incidence in the Burkinabe cohort was very high, and although AS202.11 IgG and IgM antibodies clearly increased with age, none was associated with protection against malaria. In addition, the weak IgG responses to AS202.11 in the malaria hypo-endemic population of Ghana, with its subsequent association with increased malaria risk, suggests it may rather be a marker of exposure in the studied populations.

In most malaria-endemic populations, intensified transmission prevention measures such as use of ITNs, indoor residual spraying and effective therapeutics are rapidly changing the landscape of malaria epidemiology [42, 43]. Malaria incidence in the Burkinabe cohort was more than eight-fold higher than in the Ghanaian cohort possibly due to the lack of ITN usage in the former. It may also be due to the risk of malaria being higher in younger children living in communities where transmission intensity is high [1, 44, 45]. Thus, the Ghanaian cohort consisting of older children living in a malaria hypo-endemic region was already at a much lower risk of getting malaria. In populations with steady and high malaria transmission intensity, acquired immunity to clinical malaria develops rapidly with frequency of exposure to the parasite and age [45, 46]. This may be due to acquisition of a broad spectrum of protective antibodies in such populations early in life. High intensity of transmission may also be necessary for sustaining malaria-specific antibodies at high levels and functionality [45, 47]. Conversely, with a decline in malaria transmission intensity, as was evident in the Ghanaian cohort, prolonged exposure over relatively longer periods may be necessary in building a sufficient repertoire of protective antibodies [45]. This may explain why antibody associations with protection were more distinct in the Burkinabe children than in the Ghanaian children. In the antibody association with age models, the low R2 values observed, particularly for the Ghanaian cohort, suggests in areas of very low malaria transmission, age alone may not adequately explain acquisition of malaria-specific antibodies.

In previous studies, GLURP R2 IgG was associated with protection against malaria in Burkinabe [20] and Myanmar [48] children. The present study supports these finding since high titres of IgG antibodies to GLURP R2 were significantly associated with reduced risk of malaria with IgG3 showing the strongest effect in both cohorts. The association of GLURP R2 IgG2 titres with reduced risk of malaria in the Burkinabe cohort may be due to the observation that IgG2 binds with high affinity to Fc gamma receptor IIA-131H (FcγRIIA-131H) allele on immune cells of individuals expressing this variant [4951]. Although FcγRIIA was not genotyped in the present study, other studies in the same district in Burkina Faso reported FcγRIIA-131H-allele frequency to be 28.6 % in the population [52]. Thus, individuals with this FcγRIIA-131H polymorphism could benefit from GLURP R2 IgG2 mediated cellular effector functions that may afford protection against malaria. MSP1 block 2 epitopes have been shown to be important targets of antibodies associated with protection from clinical malaria [6, 13, 14]. Plasmodium falciparum diversity at the Ghanaian site is unknown, however, the K1 and MAD 20 allelic families of msp1 have been shown to be the most prevalent in Balonghin, Burkina-Faso [53]. Here, the MSP1 hybrid used was specifically designed to incorporate most of the block 2 allelic variants purported to be targets of protective antibodies against malaria [8]. Moreover, the present study is the first to show antibody responses against the MSP1 block 2 hybrid to be associated with reduction in risk of symptomatic P. falciparum infections. Both GLURP R2 and MSP1 block 2 have been shown to elicit antibodies capable of inhibiting parasite growth in vitro in the monocyte-dependent mechanism, antibody-dependent cellular inhibition (ADCI) [19, 54]. This may explain the strong association with protection observed with IgG3 antibodies to these antigens since IgG3 is considered superior to IgG1 in parasite clearance [55]. Antigen-specific IgM antibody responses are usually associated with primary infection and not so commonly with protection from disease. However, previous studies in both Ghana [16] and Burkina Faso [56] have found association with protection and IgM antibodies to MSP1 and GLURP. In the current study, IgM against MSP1 hybrid was associated with reduced risk of malaria in Burkinabe children, supporting the view that the function of IgM may complement IgG in anti-malarial immunity [57]. Although anti-MSP1 hybrid IgM levels were similar in both cohorts, the association with protection was only seen in the Burkina Faso cohort. This may reflect differences in epitope specificity and/or avidity of IgM responses under the different malaria transmission intensities in the two cohorts. The possible mechanism(s) by which IgM could mediate protection in malaria remains unclear and several hypotheses have been proposed [58]. It has been suggested that IgM with its pentameric structure capable of binding ten antigenic sites may play a role in blocking merozoite invasion of erythrocytes through agglutination or may mediate antibody-dependent phagocytic mechanisms [56] or complement-mediated anti-parasitaemic processes [58]. Functional studies investigating the effect of malaria-specific IgM antibodies on parasite growth will be needed to elucidate the possible mechanism by which IgM mediates protection against malaria.

Conclusion

This study corroborates findings from previous studies associating GLURP R2 as an important target for protective antibodies against malaria. The results show for the first time, that antibodies against the chimeric MSP1 block 2 hybrid are associated with reduced risk of malaria in a hyperendemic population. The findings support the further development of both GLURP R2 and MSP1 block 2 hybrid as important blood stage vaccine candidates that may be deployed in children living in areas of different malaria endemicity. These may be most effective as a single fused vaccine antigen rather than as individual sub-unit vaccines.

Authors’ contributions

BA, MKC, IN and DD conceived the study. BA, MKC, SB, IN, and EKD carried out field studies, laboratory work and statistical analysis. SB, AD, FKN, GC, DRC, MT, and SBS contributed reagents and analysis tools. BA and DD wrote the manuscript. All authors read and approved the final manuscript.

Acknowledgements

The study was funded by grants from the European and Developing Countries Clinical Trials Partnership (TA.2007.40200.012), the African Malaria Network Trust (008/2008AIA) and Projet de Développement de Vaccins Antipaludiques in Burkina Faso. We would like to thank the children, their parents and guardians from all the study sites in Burkina Faso and Ghana who participated in the study. The entire Afro Immuno Assay 2 (AIA2) field assistants, the medical teams and technicians at both study sites and participating research centres (CNRFP-Burkina Faso and NMIMR-Ghana) are acknowledged for their immense support during the studies. We thank Dr. Edmond J Remarque for providing ADAMSEL b040.

Competing interests

The authors declare that they have no competing interests.

Abbreviations

GLURP R2

glutamate rich protein region 2

MSP1

merozoite surface protein 1

FcγRIIA

Fc gamma receptor IIA

ITN

insecticide-treated bed net

SNP

single nucleotide polymorphism

EIR

entomological inoculation rate

TTBS

thick and thin film blood slides

Hb

haemoglobin

RT

room temperature

HRP

horseradish peroxidase

OD

optical density

AU

antibody unit

ADCI

antibody dependent cellular inhibition

Additional file

12936_2016_1146_MOESM1_ESM.doc (35KB, doc)

10.1186/s12936-016-1146-4 Malaria episodes in Burkinabe and Ghanaian children in the cohorts.

Footnotes

Bright Adu and Mariama K. Cherif contributed equally to this work

Contributor Information

Bright Adu, Email: badu@noguchi.ug.edu.gh.

Mariama K. Cherif, Email: Cherif.mariama@yahoo.fr

Samuel Bosomprah, Email: sbosomprah@gmail.com.

Amidou Diarra, Email: a.diarra.cnrfp@fasonet.bf.

Fareed K. N. Arthur, Email: fareedarthur@yahoo.com

Emmanuel K. Dickson, Email: EDickson@noguchi.ug.edu.gh

Giampietro Corradin, Email: giampietro.corradin@unil.ch.

David R. Cavanagh, Email: David.Cavanagh@ed.ac.uk

Michael Theisen, Email: mth@ssi.dk.

Sodiomon B. Sirima, Email: s.sirima.cnlp@fasonet.bf

Issa Nebie, Email: issanebie.cnlp@fasonet.bf.

Daniel Dodoo, Email: DDodoo@noguchi.ug.edu.gh.

References

  • 1.WHO . World malaria report 2014. Geneva: World Health Organization; 2014. [Google Scholar]
  • 2.Ceesay SJ, Casals-Pascual C, Erskine J, Anya SE, Duah NO, Fulford AJ, et al. Changes in malaria indices between 1999 and 2007 in The Gambia: a retrospective analysis. Lancet. 2008;372:1545–1554. doi: 10.1016/S0140-6736(08)61654-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.O’Meara WP, Bejon P, Mwangi TW, Okiro EA, Peshu N, Snow RW, et al. Effect of a fall in malaria transmission on morbidity and mortality in Kilifi, Kenya. Lancet. 2008;372:1555–1562. doi: 10.1016/S0140-6736(08)61655-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Osier FH, Fegan G, Polley SD, Murungi L, Verra F, Tetteh KK, et al. Breadth and magnitude of antibody responses to multiple Plasmodium falciparum merozoite antigens are associated with protection from clinical malaria. Infect Immun. 2008;76:2240–2248. doi: 10.1128/IAI.01585-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Stanisic DI, Richards JS, McCallum FJ, Michon P, King CL, Schoepflin S, et al. Immunoglobulin G subclass-specific responses against Plasmodium falciparum merozoite antigens are associated with control of parasitemia and protection from symptomatic illness. Infect Immun. 2009;77:1165–1174. doi: 10.1128/IAI.01129-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Polley SD, Tetteh KK, Cavanagh DR, Pearce RJ, Lloyd JM, Bojang KA, et al. Repeat sequences in block 2 of Plasmodium falciparum merozoite surface protein 1 are targets of antibodies associated with protection from malaria. Infect Immun. 2003;71:1833–1842. doi: 10.1128/IAI.71.4.1833-1842.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Weiss GE, Traore B, Kayentao K, Ongoiba A, Doumbo S, Doumtabe D, et al. The Plasmodium falciparum-specific human memory B cell compartment expands gradually with repeated malaria infections. PLoS Pathog. 2010;6:e1000912. doi: 10.1371/journal.ppat.1000912. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Cowan GJ, Creasey AM, Dhanasarnsombut K, Thomas AW, Remarque EJ, Cavanagh DR. A malaria vaccine based on the polymorphic block 2 region of MSP-1 that elicits a broad serotype-spanning immune response. PLoS One. 2011;6:e26616. doi: 10.1371/journal.pone.0026616. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Holder AA. Proteins on the surface of the malaria parasite and cell invasion. Parasitology. 1994;108(Suppl):S5–S18. doi: 10.1017/S0031182000075673. [DOI] [PubMed] [Google Scholar]
  • 10.Takala SL, Smith DL, Thera MA, Coulibaly D, Doumbo OK, Plowe CV. Rare Plasmodium falciparum merozoite surface protein 1 19-kda (msp-1(19)) haplotypes identified in Mali using high-throughput genotyping methods. Am J Trop Med Hyg. 2007;76:855–859. [PMC free article] [PubMed] [Google Scholar]
  • 11.Jiang G, Daubenberger C, Huber W, Matile H, Tanner M, Pluschke G. Sequence diversity of the merozoite surface protein 1 of Plasmodium falciparum in clinical isolates from the Kilombero District, Tanzania. Acta Trop. 2000;74:51–61. doi: 10.1016/S0001-706X(99)00045-5. [DOI] [PubMed] [Google Scholar]
  • 12.Miller LH, Roberts T, Shahabuddin M, McCutchan TF. Analysis of sequence diversity in the Plasmodium falciparum merozoite surface protein-1 (MSP-1) Mol Biochem Parasitol. 1993;59:1–14. doi: 10.1016/0166-6851(93)90002-F. [DOI] [PubMed] [Google Scholar]
  • 13.Conway DJ, Cavanagh DR, Tanabe K, Roper C, Mikes ZS, Sakihama N, et al. A principal target of human immunity to malaria identified by molecular population genetic and immunological analyses. Nat Med. 2000;6:689–692. doi: 10.1038/76272. [DOI] [PubMed] [Google Scholar]
  • 14.Cavanagh DR, Dodoo D, Hviid L, Kurtzhals JA, Theander TG, Akanmori BD, et al. Antibodies to the N-terminal block 2 of Plasmodium falciparum merozoite surface protein 1 are associated with protection against clinical malaria. Infect Immun. 2004;72:6492–6502. doi: 10.1128/IAI.72.11.6492-6502.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Theisen M, Vuust J, Gottschau A, Jepsen S, Hogh B. Antigenicity and immunogenicity of recombinant glutamate-rich protein of Plasmodium falciparum expressed in Escherichia coli. Clin Diagn Lab Immunol. 1995;2:30–34. doi: 10.1128/cdli.2.1.30-34.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Dodoo D, Aikins A, Kusi KA, Lamptey H, Remarque E, Milligan P, et al. Cohort study of the association of antibody levels to AMA1, MSP119, MSP3 and GLURP with protection from clinical malaria in Ghanaian children. Malar J. 2008;7:142. doi: 10.1186/1475-2875-7-142. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Dodoo D, Theisen M, Kurtzhals JA, Akanmori BD, Koram KA, Jepsen S, et al. Naturally acquired antibodies to the glutamate-rich protein are associated with protection against Plasmodium falciparum malaria. J Infect Dis. 2000;181:1202–1205. doi: 10.1086/315341. [DOI] [PubMed] [Google Scholar]
  • 18.Theisen M, Soe S, Brunstedt K, Follmann F, Bredmose L, Israelsen H, et al. A Plasmodium falciparum GLURP-MSP3 chimeric protein; expression in Lactococcus lactis, immunogenicity and induction of biologically active antibodies. Vaccine. 2004;22:1188–1198. doi: 10.1016/j.vaccine.2003.09.017. [DOI] [PubMed] [Google Scholar]
  • 19.Theisen M, Soe S, Oeuvray C, Thomas AW, Vuust J, Danielsen S, et al. The glutamate-rich protein (GLURP) of Plasmodium falciparum is a target for antibody-dependent monocyte-mediated inhibition of parasite growth in vitro. Infect Immun. 1998;66:11–17. doi: 10.1128/iai.66.1.11-17.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Meraldi V, Nebie I, Tiono AB, Diallo D, Sanogo E, Theisen M, et al. Natural antibody response to Plasmodium falciparum Exp-1, MSP-3 and GLURP long synthetic peptides and association with protection. Parasite Immunol. 2004;26:265–272. doi: 10.1111/j.0141-9838.2004.00705.x. [DOI] [PubMed] [Google Scholar]
  • 21.Adu B, Jepsen MP, Gerds TA, Kyei-Baafour E, Christiansen M, Dodoo D, et al. Fc gamma receptor 3B (FCGR3B-c.233C > A-rs5030738) polymorphism modifies the protective effect of malaria specific antibodies in Ghanaian children. J Infect Dis. 2014;209:285–289. doi: 10.1093/infdis/jit422. [DOI] [PubMed] [Google Scholar]
  • 22.Singh S, Soe S, Mejia JP, Roussilhon C, Theisen M, Corradin G, et al. Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design. J Infect Dis. 2004;190:1010–1018. doi: 10.1086/423208. [DOI] [PubMed] [Google Scholar]
  • 23.Singh S, Soe S, Roussilhon C, Corradin G, Druilhe P. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasite killing. Infect Immun. 2005;73:1235–1238. doi: 10.1128/IAI.73.2.1235-1238.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Hodges R. Boehringer Mannheim award lecture 1995. La conference Boehringer Mannheim, De novo design of alpha-helical proteins: basic research to medical applications. Biochem Cell Biol. 1996;74:133–154. doi: 10.1139/o96-015. [DOI] [PubMed] [Google Scholar]
  • 25.Agak GW, Bejon P, Fegan G, Gicheru N, Villard V, Kajava AV, et al. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya. Vaccine. 2008;26:1963–1971. doi: 10.1016/j.vaccine.2008.02.020. [DOI] [PubMed] [Google Scholar]
  • 26.Nebie I, Tiono AB, Diallo DA, Samandoulougou S, Diarra A, Konate AT, et al. Do antibody responses to malaria vaccine candidates influenced by the level of malaria transmission protect from malaria? Trop Med Int Health. 2008;13:229–237. doi: 10.1111/j.1365-3156.2007.01994.x. [DOI] [PubMed] [Google Scholar]
  • 27.Adu B, Dodoo D, Adukpo S, Hedley PL, Arthur FK, Gerds TA, et al. Fc gamma receptor IIIB (FcgammaRIIIB) polymorphisms are associated with clinical malaria in Ghanaian children. PLoS One. 2012;7:e46197. doi: 10.1371/journal.pone.0046197. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Afari EA, Appawu M, Dunyo S, Baffoe-Wilmot A, Nkrumah FK. Malaria infection, morbidity and transmission in two ecological zones Southern Ghana. Afr J Health Sci. 1995;2:312–315. [PubMed] [Google Scholar]
  • 29.Ministry of Health . Malaria Action Plan 1993–1997. Accra: Epidemiology Division Ministry of Health, Ghana, Accra; 1992. [Google Scholar]
  • 30.Villard V, Agak GW, Frank G, Jafarshad A, Servis C, Nebie I, et al. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif. PLoS One. 2007;2:e645. doi: 10.1371/journal.pone.0000645. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Nebie I, Diarra A, Ouedraogo A, Soulama I, Bougouma EC, Tiono AB, et al. Humoral responses to Plasmodium falciparum blood-stage antigens and association with incidence of clinical malaria in children living in an area of seasonal malaria transmission in Burkina Faso, West Africa. Infect Immun. 2008;76:759–766. doi: 10.1128/IAI.01147-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Corran PH, Cook J, Lynch C, Leendertse H, Manjurano A, Griffin J, et al. Dried blood spots as a source of anti-malarial antibodies for epidemiological studies. Malar J. 2008;7:195. doi: 10.1186/1475-2875-7-195. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Gay NJ. Analysis of serological surveys using mixture models: application to a survey of parvovirus B19. Stat Med. 1996;15:1567–1573. doi: 10.1002/(SICI)1097-0258(19960730)15:14<1567::AID-SIM289>3.0.CO;2-G. [DOI] [PubMed] [Google Scholar]
  • 34.Gay NJ, Vyse AJ, Enquselassie F, Nigatu W, Nokes DJ. Improving sensitivity of oral fluid testing in IgG prevalence studies: application of mixture models to a rubella antibody survey. Epidemiol Infect. 2003;130:285–291. doi: 10.1017/S0950268802008051. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Vyse AJ, Gay NJ, Hesketh LM, Pebody R, Morgan-Capner P, Miller E. Interpreting serological surveys using mixture models: the seroepidemiology of measles, mumps and rubella in England and Wales at the beginning of the 21st century. Epidemiol Infect. 2006;134:1303–1312. doi: 10.1017/S0950268806006340. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Cook J, Kleinschmidt I, Schwabe C, Nseng G, Bousema T, Corran PH, et al. Serological markers suggest heterogeneity of effectiveness of malaria control interventions on Bioko Island, equatorial Guinea. PLoS One. 2011;6:e25137. doi: 10.1371/journal.pone.0025137. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Kusi KA, Bosomprah S, Dodoo D, Kyei-Baafour E, Dickson EK, Mensah D, et al. Anti-sporozoite antibodies as alternative markers for malaria transmission intensity estimation. Malar J. 2014;13:103. doi: 10.1186/1475-2875-13-103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Stewart L, Gosling R, Griffin J, Gesase S, Campo J, Hashim R, et al. Rapid assessment of malaria transmission using age-specific sero-conversion rates. PLoS One. 2009;4:e6083. doi: 10.1371/journal.pone.0006083. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Stukel TA, Glynn RJ, Fisher ES, Sharp SM, Lu-Yao G, Wennberg JS. Standardized rates of recurrent outcomes. Stat Med. 1994;13:1781–1791. doi: 10.1002/sim.4780131709. [DOI] [PubMed] [Google Scholar]
  • 40.R Core Team. R: a language and environment for statistical computing. R Foundation for Statistical Computing, Vienna, Austria. Website (https://www.R-project.org/). 2015.
  • 41.Aribot G, Rogier C, Sarthou JL, Trape JF, Balde AT, Druilhe P, et al. Pattern of immunoglobulin isotype response to Plasmodium falciparum blood-stage antigens in individuals living in a holoendemic area of Senegal (Dielmo, west Africa) Am J Trop Med Hyg. 1996;54:449–457. doi: 10.4269/ajtmh.1996.54.449. [DOI] [PubMed] [Google Scholar]
  • 42.Fegan GW, Noor AM, Akhwale WS, Cousens S, Snow RW. Effect of expanded insecticide-treated bednet coverage on child survival in rural Kenya: a longitudinal study. Lancet. 2007;370:1035–1039. doi: 10.1016/S0140-6736(07)61477-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Okiro EA, Hay SI, Gikandi PW, Sharif SK, Noor AM, Peshu N, et al. The decline in paediatric malaria admissions on the coast of Kenya. Malar J. 2007;6:151. doi: 10.1186/1475-2875-6-151. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Rono J, Farnert A, Murungi L, Ojal J, Kamuyu G, Guleid F, et al. Multiple clinical episodes of Plasmodium falciparum malaria in a low transmission intensity setting: exposure versus immunity. BMC Med. 2015;13:114. doi: 10.1186/s12916-015-0354-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Doolan DL, Dobano C, Baird JK. Acquired immunity to malaria. Clin Microbiol Rev. 2009;22:13–36. doi: 10.1128/CMR.00025-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Marsh K, Snow RW. Malaria transmission and morbidity. Parassitologia. 1999;41:241–246. [PubMed] [Google Scholar]
  • 47.Vestergaard LS, Lusingu JP, Nielsen MA, Mmbando BP, Dodoo D, Akanmori BD, et al. Differences in human antibody reactivity to Plasmodium falciparum variant surface antigens are dependent on age and malaria transmission intensity in northeastern Tanzania. Infect Immun. 2008;76:2706–2714. doi: 10.1128/IAI.01401-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Soe S, Theisen M, Roussilhon C, Aye KS, Druilhe P. Association between protection against clinical malaria and antibodies to merozoite surface antigens in an area of hyperendemicity in Myanmar: complementarity between responses to merozoite surface protein 3 and the 220-kilodalton glutamate-rich protein. Infect Immun. 2004;72:247–252. doi: 10.1128/IAI.72.1.247-252.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Nasr A, Iriemenam NC, Troye-Blomberg M, Giha HA, Balogun HA, Osman OF, et al. Fc gamma receptor IIa (CD32) polymorphism and antibody responses to asexual blood-stage antigens of Plasmodium falciparum malaria in Sudanese patients. Scand J Immunol. 2007;66:87–96. doi: 10.1111/j.1365-3083.2007.01947.x. [DOI] [PubMed] [Google Scholar]
  • 50.Salmon JE, Edberg JC, Brogle NL, Kimberly RP. Allelic polymorphisms of human Fc gamma receptor IIA and Fc gamma receptor IIIB. Independent mechanisms for differences in human phagocyte function. J Clin Invest. 1992;89:1274–1281. doi: 10.1172/JCI115712. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Braga EM, Scopel KK, Komatsu NT, Silva-Nunes M, Ferreira MU. Polymorphism of the Fcgamma receptor IIA and malaria morbidity. J Mol Genet Med. 2005;1:5–10. doi: 10.4172/1747-0862.1000004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Cherif MK, Sanou GS, Bougouma EC, Diarra A, Ouedraogo A, Dolo A, et al. Is Fc gamma receptor IIA (FcgammaRIIA) polymorphism associated with clinical malaria and Plasmodium falciparum specific antibody levels in children from Burkina Faso? Acta Trop. 2015;142:41–46. doi: 10.1016/j.actatropica.2014.09.019. [DOI] [PubMed] [Google Scholar]
  • 53.Soulama I, Nebie I, Ouedraogo A, Gansane A, Diarra A, Tiono AB, et al. Plasmodium falciparum genotypes diversity in symptomatic malaria of children living in an urban and a rural setting in Burkina Faso. Malar J. 2009;8:135. doi: 10.1186/1475-2875-8-135. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Galamo CD, Jafarshad A, Blanc C, Druilhe P. Anti-MSP1 block 2 antibodies are effective at parasite killing in an allele-specific manner by monocyte-mediated antibody-dependent cellular inhibition. J Infect Dis. 2009;199:1151–1154. doi: 10.1086/597426. [DOI] [PubMed] [Google Scholar]
  • 55.Redpath S, Michaelsen TE, Sandlie I, Clark MR. The influence of the hinge region length in binding of human IgG to human Fc gamma receptors. Hum Immunol. 1998;59:720–727. doi: 10.1016/S0198-8859(98)00075-5. [DOI] [PubMed] [Google Scholar]
  • 56.Boudin C, Chumpitazi B, Dziegiel M, Peyron F, Picot S, Hogh B, et al. Possible role of specific immunoglobulin M antibodies to Plasmodium falciparum antigens in immunoprotection of humans living in a hyperendemic area, Burkina Faso. J Clin Microbiol. 1993;31:636–641. doi: 10.1128/jcm.31.3.636-641.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Cohen S, Butcher GA. Properties of protective malarial antibody. Immunology. 1970;19:369–383. [PMC free article] [PubMed] [Google Scholar]
  • 58.Pleass RJ, Moore SC, Stevenson L, Hviid L. Immunoglobulin M: restrainer of inflammation and mediator of immune evasion by Plasmodium falciparum malaria. Trends Parasitol. 2016;32:108–119. doi: 10.1016/j.pt.2015.09.007. [DOI] [PubMed] [Google Scholar]

Articles from Malaria Journal are provided here courtesy of BMC

RESOURCES