Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2016 Mar 15.
Published in final edited form as: Hum Immunol. 2014 Feb 12;75(5):440–451. doi: 10.1016/j.humimm.2014.02.013

Substantial gaps in knowledge of Bordetella pertussis antibody and T cell epitopes relevant for natural immunity and vaccine efficacy

Kerrie Vaughan 1,*, Emily Seymour 1, Bjoern Peters 1, Alessandro Sette 1
PMCID: PMC4792526  NIHMSID: NIHMS763467  PMID: 24530743

Abstract

The recent increase in whooping cough in vaccinated populations has been attributed to waning immunity associated with the acellular vaccine. The Immune Epitope Database (IEDB) is a repository of immune epitope data from the published literature and includes T cell and antibody epitopes for human pathogens. The IEDB conducted a review of the epitope literature, which revealed 300 Bordetella pertussis-related epitopes from 39 references. Epitope data are currently available for six virulence factors of B. pertussis: pertussis toxin, pertactin, fimbrial 2, fimbrial 3, adenylate cyclase and filamentous hemagglutinin. The majority of epitopes were defined for antibody reactivity; fewer T cell determinants were reported. Analysis of available protective correlates data revealed a number of candidate epitopes; however few are defined in humans and few have been shown to be protective. Moreover, there are a limited number of studies defining epitopes from natural infection versus whole cell or acellular/subunit vaccines. The relationship between epitope location and structural features, as well as antigenic drift (SNP analysis) was also investigated. We conclude that the cumulative data is yet insufficient to address many fundamental questions related to vaccine failure and this underscores the need for further investigation of B. pertussis immunity at the molecular level.

1. Introduction

Bordetella pertussis, the causative agent of whooping cough, has been a health concern since the Middles Ages when it was first described [1]. Before widespread vaccination, whooping cough was a universal disease, associated with significant morbidity and mortality [2]. Starting in the 1950s, wide use of the whole cell inactivated vaccine (wP) greatly reduced disease incidence in the U.S. However, mainly due to adverse effects associated with wP vaccination, starting in the 1990s [3], wP was widely substituted with the safer acellular (aP) subunit vaccine. Recently, the incidence of whooping cough in the U.S. has steadily increased, despite widespread vaccination coverage [4].

This increase has been attributed to several factors, including waning/insufficient immunity associated with the aP vaccine [5– 11], changes in the organism at the genomic level (antigenic drift) [12–19], and increase surveillance and detection [20,21]. It is possible that each of these factors may play a role, though to what extent is not clear from the current literature. The epidemiological evidence suggests that the increased incidence correlates with the switch from wP to aP in the mid 1990’s [22], suggesting a significant role for waning immunity.

It is possible that the aP composition and/or formulation provides lower quality immunity of shorter duration than the whole cell vaccine (wP) or natural B. pertussis infection. Indeed, the wP vaccine consists of >3400 ORFs, whereas the aP vaccine formulations contain a small subset of antigens: 1–5 pertussis proteins. In addition, the pertussis toxin (PT) component of the aP vaccine is chemically detoxified, thus potentially altering proteins, affecting quality of immunity and therefore vaccine outcome [23,24]. This underscores the need for a more thorough investigation of human immunity at the antigen level, and more specifically to characterize the antigenic determinants that correlate with protection (T cell or antibody). While defining correlates of protection in human disease at the antigen level has been challenging (e.g. there is no clear serological correlate of protection defined) [11], identifying epitopes associated with protection and/or toxin neutralization/inhibition in human and animal studies may help highlight candidate antigenic regions for more in depth analysis. To date, no group has investigated the issue of waning immunity at the epitope level. Numerous studies have shown the importance of PT in protection [25–29] and have defined multiple antigenic determinants and/or regions of T and B cell recognition, but even this prominent antigen has not been characterized sufficiently at the molecular level (e.g., epitope mapping for all subunits in humans).

The Immune Epitope Database and Analysis Resource (IEDB) is a repository for immune epitope data for infectious disease, allergy, autoimmunity, as well as transplant-related disease. The IEDB captures T cell and B cell/antibody epitopes defined in humans, as well as animal models, in the context of the specific assays used to define them. Thus, it is possible to selectively query the data related to natural infection (by disease) versus immunization with a particular immunogen, or by host. It is also possible to search for data associated with specific assays, such as ELISA versus functional assays that define in vitro correlates of protection (neutralization or CTL).

We surveyed all epitope data related to B. pertussis to determine whether adequate data existed to address the leading hypotheses linked to waning vaccine efficacy, namely those related to breadth and quality of the immune response to active immunization, including epitope coverage per antigen, the distribution of response phenotypes, the balance of data among different host species (humans versus animal models), as well as a structure-function analysis of epitope location, and further explored whether the available data could be used to assess the contribution of pathogen escape (antigenic drift at the epitope level) on waning immunity.

2. Methods

2.1. Script used to search PubMed

The following script was used to query PubMed for all epitope-references related to pertussis: ((epitope[TW] OR epitopes[TW] OR “epitopes”[MeSH Terms] OR mimotope[TW] OR ((MHC[tw] OR major histocompatibility complex[tw] OR HLA[tw]) AND (peptide[tw] OR peptides[tw])) OR TCR recognition[tw] OR (Class[tw] AND I mo-tif[tw]) OR supermotif[tw] OR (peptide-based[tw] AND CTL[tw]) OR phage displa*[tw] OR antibody binding[tw] OR protective immune response[tw] OR antibody recog*[tw] OR cytotoxicity as-say[tw] OR new monoclonal[tw] OR novel antibody[tw] OR ((monoclonal antibod*[tw]) AND binding site[tw]) OR ((KA[tw] OR KD[tw]) AND (monoclonal[tw] OR mAb[tw])) OR neutralizing antibod*[tw] OR peptide vaccine[tw] OR peptide conjugate vac-cin/[tw] OR ((CD8[tw] OR CD4[tw]) AND T cell*[tw] AND (pep-tide[tw] OR peptides[tw])) OR antigenic repertoire[tw] OR ((peptide[tw] OR peptides[tw]) AND antibody reactivity[tw]) OR (Class II[tw] AND (binding [tw] OR bound[tw] OR peptide[tw] OR peptides[tw])) OR “immunogenic peptide”[tw] or hapten[TW] or haptens[TW] OR ((antigenic*[tw] OR immunogenic*[tw]) AND determinant*[tw]) or (monoclonal antibod*[tw] and peptide*[tw]) or (T cell*[tw] and peptide*[tw])) AND (hasabstract[text] AND English[Lang] AND (“1900”[PDat]:“2013/12/31”[PDat])) NOT (Re-view[PT] OR Editorial[PT] OR meta-Analysis[PT] OR Comment[PT] OR pmcbook[All Fields] or pubstatusaheadofprint[ALL])) AND pertussis[Title/Abstract].

2.2. IEDB data inclusion criteria

This analysis includes antibody and T cell epitopes associated with B. pertussis associated antigens. We followed the process of Davies et al. [30] to identify B. pertussis related data derived from peer-reviewed literature contained in PubMed. Epitope definitions (length and mass restrictions) and IEDB inclusion criteria can be found at (http://tools.immuneepitope.org/wiki/index.php/Curation_Manual2.0#Prevailing_Rules). For the purpose of this report, epitopes represent the specific molecular structures experimentally shown to react with a B cell or T cell receptor (the database only curates experimental data and does not include predictions).

2.3. Mapping epitopes onto 3D structures

The epitope data for PT S1 and S4 were first filtered for prominent regions using the Immunome Browser available on the Results Summary page for each query. Epitopes with the highest RFscores were selected and the sequences of these were mapped using the Homology mapping tool housed on the IEDB.

3. Results

3.1. Scope and limitations of the analysis

This study was designed to critically review the available data and as such does not provide new data on immunity to B. pertussis and vaccination. This work represents an analysis of epitope mapping studies that have been reported in the published literature and are captured in the IEDB. The study surveys the data from this database to determine whether the available data is sufficient to characterize adaptive immune response to B. pertussis. The T and B cell/antibody epitopes that have been mapped are for the most part reflective of targeted studies, but we have found that few if any studies tackle the question of comprehensive T or B cell repertoires (e.g by using overlapping peptides covering the entire proteins). Therefore the lack of defined T cell or antibody epitopes for any particular antigen reflects most likely the fact that a more complete mapping has not been performed, and not that these determinants do not exist.

A number of studies exist in the literature that provides data describing antibody recognition of rather large domains or fragments >50 amino acids in length. For this reason, they do not meet the inclusion criteria of the IEDB. There are also numerous papers that identify and characterize the functional capabilities of monoclonal antibodies (mAbs) or T cell clones, but do not report their sequence specificity (epitope). These data are also not included in the IEDB. The IEDB cannot capture data for which the epitope structure or sequence has not been defined or reported.

To ascertain whether any pertussis-related papers may have been missed and are therefore not included in the IEDB, we conducted a targeted survey of the published literature for any additional relevant pertussis papers. All resultant PubMed IDs (PMID) were compared to those currently in the IEDB reference tracking system. This survey identified seven outstanding papers which have now been incorporated in the IEDB. All additional B. pertussis papers were reassessed against the IEDB’s inclusion criteria, and determined to have been excluded based on size criteria and/or lack of identified sequence (e.g. only aa positions reported). However, because this latter subset of references represents data relevant to the current analysis, a table of their respective details has been provided (Supplementary Table 1). This includes seminal papers related to PT, FHA and AC, monoclonal antibody or T cell clones shown to neutralize/inhibit and/or to protect in animal models of infection. The specificity of most clones (BCR or TCR) were broadly defined as regions (>50aa), N-versus C-termini or entire subunits (e.g. PT S1).

3.2. High level summary of B. pertussis immune epitope data

We surveyed B. pertussis epitope data captured in the IEDB as of 2013, enumerating the total number of pertussis-related references, and total number of epitopes, including positive and negative peptides. There are currently 300 epitopes reported from 39 different pertussis-related references. These data represent epitopes (molecular structures ≤50 amino acids) defined in the context of T cell responses (CD8+/class I and CD4+/class II), antibody responses (linear and conformational), as well as MHC binding, and include negative data (126 peptides for which only negative assays results have been reported). To date, few antigens have been investigated at the epitope level. These include: pertussis toxin (PT), adenylate cyclase (AC), pertactin (PRN), fimbrals 2 and 3 (fim2, fim3), and filamentous hemagglutinin (FHA). The majority of epitopes (~60%) are derived from PT, and more specifically from PT subunits 1 and 4. Anti-body/B cell epitopes (249) far outnumber T cell epitopes (47) and MHC binding peptides (43). Only one of the reported antibody epitopes is conformational in nature (mouse mAb against fim3). The majority of data were generated in murine hosts rather than human; of 27 monoclonal antibodies for which the epitope recognized was reported, none was derived from humans. Table 1 provides a summary of the B. pertussis epitope data.

Table 1.

B. Pertussis antigens with defined epitope data.

Antigen name T cell Antibody MHC binders Total epitopes References
Pertussis toxin (PT)* 43 147 2 156 27
Adenylate cyclase (AC)† 0 1 40 41 2
Pertactin (PRN)* 0 38 0 38 4
Filamentous hemagglutinin (FHA)* 0 23 0 23 2
Fimbrial 2 (Fim2)* 0 18 0 18 2
Fimbrial 3 (Fim3)* 0 18 0 18 2

Note: Protein nomenclature is that of the NCBI Protein database; the IEDB links directly to this database for the purpose of providing the source of the epitope sequence. When the accession number or GenBank ID is not provided by the authors, a representative antigen is chosen with 100% homology. Nomenclature is therefore not assigned by the IEDB. The proteins names listed above represent, in some cases, numerous different GenBank IDs.

*

A component of the aP vaccine formulations. Three additional B. pertussis antigens are present in the IEDB: cyaE [accession 117799], fhaE [accession 462083] and the putative autotransporter [accession 3411270] proteins, however, these represent only MHC binding data not related to disease characterization. Queries were performed using Source Antigen Molecular Finder and the Immune Recognition Context selections provided on the IEDB search interface (www.iedb.org).

†

294/254 Negative T cell and MHC binding epitopes reported for this antigen, respectively.

An analysis of the IEDB data with respect to host is shown in Tables 2a and b. At the high level we found that mice (39%), rabbits (32%), and humans (29%) make up the bulk of the data. Further, T cell epitopes have been defined in both humans and murine models, with the majority of these being CD4+/class II. Antibody responses have been defined in humans, mice, rabbits and goats, with the human data (65) considerably less than that from mice (98) and rabbits (99). When these data are considered in the context of aP vaccine-specific antigen components, the epitopes defined in humans were derived fairly equally among the four vaccine-specific pertussis proteins (18% fim2, 16% fim3, 44% PT and 22% PRN), in mouse and rabbit models the vast majority of epitope were derived from PT (76 and 73%, respectively) and far fewer epitopes were defined in other vaccine-specific antigens (Fig. 1). Somewhat surprising was the lack of defined epitopes for humans against FHA; most reactivity defined to date is limited to large regions of this antigen (Supplementary Table 1).

Table 2.

a
Host distribution for T cell epitopese.
Epitopes Class I Class II
All hosts 47 1 35
    Human 26 1 14
    Mouse 36 0 25
b
Host distribution for antibody epitopes.
Epitopes Linear Discontinuous
All hosts 248 247 1
    Human 65 65 0
    Mouse 98 97 1
    Rabbit 99 99 0
    Goat 1 1 0

Queries to enumerate epitopes by host were performed using the Source organism Finder to select “Bordetella pertussis,” the Host Organism Finder to select human, mouse, rabbit, etc., the Immune Recognition Context to select ‘B cell Response’ or ‘T cell Response,’ the MHC class pull-down for class I versus class II and the ‘Discontinuous peptide’ radio button under Epitope Structure within the IEDB search interface (www.iedb.org). Note: The total number of epitopes reported for each individual host may be greater than the total number of epitopes for all hosts as some peptides (identical molecular structures) are positive in more than one host.

Fig. 1.

Fig. 1

Epitope distribution by protein of prominent hosts. The distributions of epitopes from each of the main B. pertussis antigens are shown for each host species in which they were defined. These data were generated using the IEDB Search interface (www.iedb.org) by individual queries to the Epitope Source Molecule Finder for each antigen along with the Host Organism Finder to filter on human, mouse or rabbit data.

3.3. Assessment of epitope data in the context of potential correlates of protection, vaccine-related issues and MHC restriction

Next we sought to analyze the cumulative data in the context of the vaccine-related issues, namely what data are currently available at the epitope level with respect to assays related to immunity (protection and correlates of protection), and further, to what extent these data can be used to evaluate differences in epitope reactivity between natural infection and immunization (aP and wP). First we focused on those data that were generated with assays considered potential in vitro correlates of protection. With respect to “in vitro correlates,” there are several different toxin neutralization/inhibition assays that exist, each with its own advantages and limitations. These include the CHO cell clustering assay, leukocytosis-promoting (LP) activity, islet-activating (IA) activity, permeability-increasing (PI) activity, hemagglutinating activities and ADP-ribosyltransferase activity [31,32]. For T cell responses, the current epitope data has been generated using a small number of standard assays: proliferation assays (3H), radioimmunoassay (RIA), ELISPOT and ELISA assays to measure cytokine responses (IL-2 and IFNγ) and cytotoxicity assays (51Cr). We selected cytotoxicity and IFNγ assays as potential correlates of protection for this analysis, as proliferation and IL-2 production are less often used as in vitro correlates of protection. Table 3 provides details for all in vitro T cell and antibody assays captured to date for B. pertussis epitopes. These represent assays that demonstrate functional capacity for the epitope-specific effector cell, distinguishing these from all other assays that do not provide any insight in the functionality of responses (such as ELISA, WB, proliferation, etc.). In general, a relatively small portion (10%) of the overall data was found to define epitopes in the context of protective responses (in vitro correlates).

Table 3.

Assays defining epitopes with in vitro correlates of protection.

Response type Epitope Assay PMID
mAb E251, mouse PT S2 (134–147) TATRLLSSTNSRLC CHO cell clustering 1718872
pAb, rabbit PT S3 (37– 51) PKALFTQQGGAYGRC CHO cell clustering 1383153
pAb, rabbit PT S3 (29–51) VAPGIVIPPKALFTQQGGAYGRC CHO cell clustering 1383153
pAb, rabbit PT S3 (46–69) GAYGRCPNGTRALTVAELRGNAEL CHO cell clustering 1383153
pAb, rabbit PT S3 (65–92) GNAELQTYLRQITPGWSIYGLYDGTYLG CHO cell clustering 1383153
pAb, rabbit PT S3 (88–115) GTYLGQAYGGIIKDAPPGAGFIYRETFC CHO cell clustering 1383153
pAb, rabbit PT S3 (115–136) CITTIYKTGQPAADHYYSKVTA CHO cell clustering 1383153
pAb, rabbit PT S2 (105–125) GAFDLKTTFCIMTTRNTGQPA CHO cell clustering 1383153
pAb, rabbit PT S3 (131–155) YSKVTATBLLASTNSRLCAVFVRDG CHO cell clustering 1383153
pAb, rabbit PT S3 (151–182) FVRDGQSVIGACASPYEGRYRDLYDALRRLLY CHO cell clustering 1383153
pAb, rabbit PT S3 (177–204) LRRLLYMIYMSGLAVRVHVSKEEQYYDY CHO cell clustering 1383153
pAb, rabbit PT S3 (106–136) AGFIYRETFCITTIYKTGQPAADHYYSKVTA CHO cell clustering 1383153
pAb, rabbit PT S1 (1–18) DDPPATVYRYDSRPPEDV CHO cell clustering 2017195
pAb, rabbit PT S1 (121–138) GALATYQSEYLAHRRIPP CHO cell clustering 2017195
pAb, rabbit PT S1 (201–235) CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF CHO cell clustering 2017195
pAb, rabbit PT S1 (1–15) DDPPATVYRYDSRPP CHO cell clustering 2017195
pAb, rabbit PT S1 (124–138) ATYQSEYLAHRRIPP CHO cell clustering 2017195
pAb, rabbit PT S3 (29–40) VAPGIVIPPKAL HA assay 1706321
pAb, rabbit PT S3 (40–51) LFTQQGGAYGRC HA assay 1706321
pAb, rabbit PT S3 (42–57) TQQGGAYGRCPNGTRA HA assay 1706321
pAb, rabbit PT S3 (64–79) RGNAELQTYLRQITPG HA assay 1706321
pAb, mouse PTS1 (1–17) DDPPATVYRYDSRPPED CHO cell clustering 2480389
pAb, mouse PT S1 (70–82) EAVEAERAGRGTG CHO cell clustering 2480389
pAb, mouse PT S1 (189–199) GTLVRMAPVIG CHO cell clustering 2480389
mAbs 2/1:9F, 2/2:5D, 5/1:4C FHA (2001–2015) RGHTLESAEGRKIFG HA assay 9180182
T cell clones* PT S1 (212–235) MAAWSERAGEAMVLVYYESIAYSF Cytotoxicity, RIA IFNγ 1716614
T cell clones* PT S1 (30–41) DNVLDHLTGRSC Cytotoxicity, RIA IFNγ 1716614
T cell clones* PT S1 (27–39) GNNDNVLDHLTGR Cytotoxicity 1716614
T cell clones* PT S1 (180–194) SRRSVASIVGTLVRM RIA IFNγ 1716614

The query was performed using the Advanced Search interface on the IEDB home page (B cell and T cell Searches done separately) to select ‘Bordetella pertussis’ from the Epitope Organism Finder and then: all “neutralization/inhibition of antigen activity” assays from the Assay Finder for antibody responses and “cytotoxicity” and “cytokine release IFNg” for all T cell responses; only positive data were considered.

*

T cell clones were generated from the peripheral blood of a donor who had suffered from B. pertussis as a child and who had exhibited significant humoral and cellular responses and was therefore considered immune; Polyclonal sera (pAb); Hemagglutination assay (HA assays).

In terms of epitopes defined in the context of in vivo protection (challenge and survival assays), a mere five antibody epitopes were shown to be protective against challenge in vivo, all derived from PT subunit 1 and all in mouse models of lethal shock syndrome using toxin challenge (Table 4). When these same sequences were used to query the human data, we found that all were also recognized by human T cells and/or B cells. Overall, 60% of the epitopes associated with in vitro correlates, as well as those protective in vivo (Tables 3 and 4) were shown to be recognized by human subjects, as either the same exact sequence or a closely related one.

Table 4.

Epitopes reported to be protective in vivo.

Response Immunogen Immunization/challenge Assessment %
Protected
PMID
Ab/B cell PT S1 (1–17)
DDPPATVYRYDSRPPED*
BALB/c, 4–5 weeks, 2 doses 5ug i.p. at days 1 and 10.
Challenged: lethal shock syndrome; 100 ng of PT given i.v.
on days 0 and 2
Protection correlated with the ability of
these peptides to elicit high anti-PT titers
54 2480389
PT1 S1 (53–64)
TSSSRRYTEVYL*
50
PT S1 (70–82)
EAVEAERAGRGTG*
65
PT S1 (99–112)
GAASSYFEYVDTYG*
80
PT S1 (189–199)
GTLVRMAPVIG*
50
*

Also recognized by sera from two infants vaccinated with pertussis vaccine. This IEDB data can be quickly accessed using the PMID in the ‘Identifier search’ located on the Advanced Search pull-down menu on the IEDB home page or by pasting the epitope sequence into the linear peptide field (exact match) under Epitope Structure (www.iedb.org). The query was performed using the Advanced Search interface on the IEDB home page (B cell and T cell Searches done separately) to select ‘Bordetella pertussis’ from the Epitope Organism Finder and all “challenge assays” from the Assay Finder; only positive data were considered.

We then examined potential difference among epitopes recognized following immunization versus natural infection in humans, since antibody and T cell response patterns of natural infection and the wP or aP subunit/vaccines may differ qualitatively. Table 5a provides a breakdown of the human data by these three categories for antibody and T cell epitope records. The vast majority of the human epitopes have been defined in the context of natural infection, most of this reflecting antibody reactivity, followed closely by epitope derived from wP-vaccinated subjects. Fewer data are available for those immunized with aP or other subunit formulations, and none of the acellular vaccine data reported to date used aP vaccines licensed for use in the U.S. (Daptacel, Infanrix, Tripedia, etc.), though one study did utilized the Swedish vaccine, JNIH-3 (contains PT and FHA). Moreover, there is a relative imbalance in epitope mapping (overall coverage) for the antigens comparable between natural infection and the vaccine formulations (Table 5b). For example, in the case of natural infection, fimbrial and pertactin-specific data far outnumbered PT-specific data. The important role of anti-fimbrial antibodies in immunity has been well-established [34–36]. However, while PRN and Fim are components of the aP vaccine (e.g. Sanofi Pasteur), they are not present in all formulations, whereas PT is universally included, and considered to contain major protective epitopes.

Table 5.

a
Human data for vaccination versus natural infection.
Immunization Immunogen # Assays # Epitopes
B cell epitopes
Natural infection (whooping cough) B. pertussis 52 50
Whole cell vaccine B. pertussis (inactive) 29 27
Acellular/subunit formulation Pertussis toxin (PT) 14 13
T cell epitopes
Natural infection (whooping cough) B. pertussis 6 4
Whole cell vaccine B. Pertussis (inactive) 9 9
Acellular/subunit formulation PT and FHA 12 12
b
Overall antigen coverage for human antibody response data.
Immunization Fim2/3 PRN PT S1 PT S2 PT S3
Natural infection 29 18 3 0 0
Whole cell vaccine 20 2 5 0 0
Acellular vaccine 0 0 10 1 2

These data were generated by performing a query using the Epitope Source Organism Finder to select ‘Bordetella pertussis’ and then the Host Organism Finder to select ‘Human.’ All T cell and B cell Response data were then downloaded in Excel format (full) and combined into one workbook. The data were then parsed by filtering on columns ‘1st In Vivo Process Type’ for ‘Occurrence of infectious’ disease versus ‘Administration in vivo,’ and then all 1st Immunogen fields to assess the type of immunogen. The total number of assays and epitopes was tallied following removal of redundant data (Advanced filter, unique records only).

Finally, the database was specifically queried to identify all cases in which the MHC restriction of T cell epitopes was defined, either by in vivo/in vitro assay or by MHC binding. This information can be useful for the development of tetramer staining reagents to further characterize T cell responses to B. pertussis. Table 6 lists the number of epitopes restricted by various class I and II alleles reported to date. These include human HLA-A2 (A/02:01), HLA-DR (DRB1/01:01 and DRB1/11:01) and HLA-DQ, as well as murine H-2-IAd, H-2-Db and H-2-Kb. To date, very minimal data are available defining restriction in the context of disease or immunization, and, to the best of our knowledge, no tetramers have been reported thus far.

Table 6.

MHC restrictions defined.

Epitope restriction defined in T cell assays
Mouse class II H-2-IAd 1
Human class II HLA-DQ 1
HLA-DR 2
HLA-DR1 4
Epitope restriction defined in MHC binding assays
Mouse class I H-2-Db 4
H-2-Kb 36
Human class I HLA-A*02:01 1
Human class II DR1 1
DRB1*01:01 1
DRB1*11:01 1

These data were generated by performing a query using the Epitope Source Organism Finder to select ‘Bordetella pertussis.’ All T cell Response and MHC binding assay data were then downloaded in Excel format (full) and combined into one workbook. The data were then parsed by filtering on the column ‘MHC Allele Name.’ The total number of assays and epitopes was tallied following removal of redundant data (Advanced filter, unique records only).

3.4. Structure and functional analysis with respect to epitope location

All of the antigens for which epitopes have been defined to date represent major virulence factors of B. pertussis pathogenesis and can be separated into two functional categories, exotoxins (PT and AC) and adhesins (fim2, fim3 PRN, and FHA). An analysis of epitope location with respect to the structure and function of these antigens may be of interest as it relates to the extent to which protective or immunodominant antibody and T cell reactivity is directed towards key regions responsible for attachment or enzymatic activity. Studies to date have identified critical regions on adhesins, such as heparin binding domains (HBD), RGD motifs and the carbohydrate recognition (CRD), that function in the attachment of the pathogen to host cells within the respiratory epithelium [37]. For the A–B exotoxins like PT and AC, critical function sites include the catalytic site on the A subunit and the receptor binding domains on the B subunit. Upon release in the infected host, subunit A of PT is activated and catalyzes the ADP-ribosylation of the alpha subunit of G protein on cells within the respiratory tract (macrophages and DCs), increasing intracellular cAMP and thereby interfering with signal transduction and hampering immune responsiveness [38–40]. The B domain binds the whole toxin to host cells prior to invasion.

To analyze the relationship between structural or functional features and epitope location we utilized the Immunome Browser (IB) accessible through the IEDB query interface. The IB is a tool developed to plot response frequency scores [RFscores] (# respondents/# tested) along the length of an antigen per amino acid residue. In this way, the IB maps the epitope data onto the antigen allowing visualization of T cell and antibody response patterns and the RFscores serve to provide insight into the relative prominence of any epitope/region in a quantifiable manner. We therefore generated response frequency data for both antibody and T cell responses to all 5 antigens. We then identified all functional sites based on amino acid position corresponding to these epitopes/epitopic regions. Eighty-two antibody and T cells epitope were found to have residues that corresponded to functional domains. These included catalytic sites, cleavage sites, heparin binding domains, carbohydrate recognition domains, immune evasion, bacterial adherence, membrane insertion, NAD glycohydrolase activity, ATP-binding sites and toxin secretion. Table 7 provides details for each epitope, highlighting the residues involved in the functional site/region.

Table 7.

Structure-function.

Epitope
ID
Antigen Epitope Sequence Position Resp
Freq
RFscore Response
type
Structure Function Putative activity Reference
7850 PT S1 DDPPATVYRYDSRPPED 35–51 10/11 0.62
(0.29)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523,
2902632
1416 PT S1 AFVSTSSSRRYTEVY 83–97 5/5 0.55
(0.45)
B A subunit CD Toxin secretion 10678938
9573 PT S1 DNVLDHLTGRSCQ 64–76 4/4 0.50
(0.50)
T A subunit CD NAD glycohydrolase
activity/catalytic
8119996,
21740523
66442 PT S1 TSSSRRYTEVYL 87–98 6/10 0.36
(0.24)
T (B) A subunit CD Toxin secretion 10678938
7851 PT S1 DDPPATVYRYDSRPPEDV 35–52 2/2 0.29
(0.71)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
72154 PT S1 VYRYDSRPPEDV 41–52 2/2 0.29
(0.71)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
22756 PT S1 GTLVRMAPVIG 223–233 5/10 0.28
(0.22)
T (B) A subunit CD ADP-
ribosyltransferase
activity
8168972
9571 PT S1 DNVLDHLTGRSC 64–75 5/10 0.28
(0.22)
T (B) A subunit CD NAD glycohydrolase
activity/catalytic
8119996,
21740523
7850 PT S1 DDPPATVYRYDSRPPED 35–51 3/5 0.25
(0.35)
T A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
3053 PT S1 AMAAWSERAGEA 245–256 NA 0.00
(1.00)
B A subunit CD Catalytic/cleavage
site
15691377
78112 PT S1 CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF 235–269 NA 0.00
(1.00)
B A subunit CD Catalytic/cleavage
site
15691377
78113 PT S1 CQVGSSNSAFVSTSSSRRYTEVYL 75–98 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity
8119996,
21740523
7849 PT S1 DDPPATVYRYD 35–45 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
78115 PT S1 DDPPATVYRYDSRPP 35–49 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
94492 PT S1 DSRPPEDVFQNGFTAWG 45–61 0/1 0.00
(0.00)
T A subunit CD NAD binding
10594 PT S1 DVFQNGFTAWGNND 51–64 NA 0.00
(1.00)
B A subunit CD NAD binding 8119996,
21740523
78159 PT S1 GALATYQSEYLAHRRIPP 155–172 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/catalytic
8119996,
21740523
21476 PT S1 GNNDNVLDHLTGR 61–73 NA 0.00
(0.50)
T A subunit CD NAD glycohydrolase
activity/catalytic
8119996,
21740523
22516 PT S1 GSSNSAFVSTSSSRR 78–92 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity
8119996,
21740523
78205 PT S1 MAAWSERAGEAMVLVYYESIAYSF 246–269 NA 0.00
(1.00)
B A subunit CD Catalytic/cleavage
site
15691377
94607 PT S1 MARQAESSE 236–244 0/1 0.00
(0.00)
T A subunit CD Cleavage site 15691377
78213 PT S1 MVLVYYESIAYSF 257–269 NA 0.00
(1.00)
B A subunit CD Subunit B binding
domain
8168972
78223 PT S1 PATVYRYDSRPPEDV 38–52 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
48751 PT S1 PPATVYRYDSRPPE 37–50 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
55389 PT S1 RQAESSEAMAAWSERAGEA 238–256 NA 0.00
(1.00)
B A subunit CD Catalytic/cleavage
site
15691377
56519 PT S1 RYDSRPPEDVF 43–53 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
61920 PT S1 STSSSRRYTEVY 86–97 NA 0.00
(1.00)
B A subunit CD Toxin secretion 10678938
94726 PT S1 TVYRYDSRPPED 40–51 0/1 0.00
(0.00)
T A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740523
72153 PT S1 VYRYDSRP 41–48 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity site/NAD
binding
8119996,
21740524
75548 PT S1 YQSEYLAHRR 160–169 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/catalytic
8119996,
21740525
75686 PT S1 YRYDSRPP 42–49 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740526
125327 PT S1 YRYDSRPPEDV 42–52 NA 0.00
(1.00)
B A subunit CD NAD glycohydrolase
activity/NAD binding
8119996,
21740527
188005 PT S1 Y8, R9, Y10, D11, S12, R13, E16, R39, R79, T81,
H83, Y148, N150, T153
discn NA NA B A subunit CD Binding of mAb 1B7
keep A-B linked
19899804
18572 PT S2 GAFDLKTTFCIMTTRNTGQPA 105–125 2/5 0.12
(0.28)
B (T) B subunit RBD CRD 1353482
39107 PT S2 LRGSGDLQEYLRHVTR 62–77 NA 0.00
(1.00)
B B subunit RBD CRD 1729677
66072 PT S2 TRNTGQPATDHYYSNVa 118–133 NA 0.00
(1.00)
B B subunit RBD CBD 21740523,
1353482
1508 PT S3 AGFIYRETFCITTIYKTGQPAADHYYSKVTAa 106–136 2/5 0.12
(0.28)
B (T) B subunit RBD CBD 21740523
6459 PT S3 CITTIYKTGQPAADHYYSKVTAa 115–136 NA 0.00
(1.00)
T, B B subunit RBD CBD 21740523
80772 PT S3 CPNGTRALTV 51–60 0/1 0.00
(0.00)
B B subunit RBD CRD 1353482
18843 PT S3 GAYGRCPNGTRALTVAELRGNAEL 46–69 NA 0.00
(1.00)
T, B B subunit RBD CRD 1729677
21374 PT S3 GNAELQTYLRQITPGWSIYGLYDGTYLG 65–92 NA 0.00
(1.00)
T, B B subunit RBD CRD 1729677
82843 PT S3 GQPAADHYYSKVT 123–135 NA 0.00
(1.00)
B B subunit RBD CBD 21740523
87884 PT S3 RGNAELQTYLRQITPG 64–79 NA 0.00
(1.00)
B B subunit RBD CRD 1729677
79761 PT S4 ASSPDAHVPFCFGKDLKRPGSSPME 83–107 6/12 0.30
(0.20)
T (B) B subunit RBD ATP bindning site 8500874
79771 PT S4 CGIAAKLGAAASSPDAHVPFCFGKD 73–97 6/12 0.30
(0.20)
T (B) B subunit RBD ATP bindning site 8500874
79769 PT S4 CFGKDLKRPGSSPMEVMLRAVFMQQ 93–117 4/12 0.17
(0.17)
T (B) B subunit RBD ATP bindning site 8500874
79768 PT S4 CFGKDLKRPGSS 93–104 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
6225 PT S4 CFGKDLKRPGSSPMEV 93–108 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79760 PT S4 ASSPDAHVPFCF 83–94 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79773 PT S4 DAHVPFCFGKDL 87–98 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79781 PT S4 DLKRPGSSPMEV 97–108 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79839 PT S4 GKDLKRPGSSPM 95–106 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79840 PT S4 GKDLKRPGSSPME 95–107 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79854 PT S4 HVPFCFGKDLKR 89–100 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
79960 PT S4 PFCFGKDLKRPG 91–102 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
80031 PT S4 SPDAHVPFCFGK 85–96 NA 0.00
(1.00)
B B subunit RBD ATP bindning site 8500874
26839 fim2 IKLKDCP 83–89 12/12 0.71
(0.29)
B pili Attach HBD 9573115
21713 fim2 GPNHTKV 52–58 12/12 0.71
(0.29)
B pili Attach HBD 9573115
70651 fim2 VQTGGTSRTVTMRYLAS 170–186 12/12 0.71
(0.29)
B pili Attach HBD 9573115
34243 fim2 KVVQLPKISKNALKANG 57–73 12/12 0.71
(0.29)
B pili Attach HBD 9573115
73808 fim2 YFEPGPT 99–105 8/12 0.43
(0.24)
B pili Attach HBD 9573115
78434 fim2 KNGDVEASAITTYVGFSVVYP 190–210 NA 0.00
(1.00)
B pili Attach HBD 9573115
78392 fim2 GDLRAYKMVYATNPQTQLSN 111–130 NA 0.00
(1.00)
B pili Attach HBD 9573115
34244 fim3 KVVQLPKISKNALRNDG 53–69 12/12 0.71
(0.29)
B pili Attach HBD 9573115
4856 fim3 ASYVKKPKEDVD 178–189 11/12 0.64
(0.28)
B pili Attach HBD 9573115
31932 fim3 KLKECPQ 80–86 7/12 0.36
(0.22)
B pili Attach HBD 9573115
78437 fim3 KVTNGSKSYTLRYLASYVK 164–182 NA 0.00
(1.00)
B pili Attach HBD 9573115
78490 fim3 QALGALKLYFEPGITTNYDTGDLIAYKQTYNASGN 86–120 NA 0.00
(1.00)
B pili Attach HBD 9573115
78375 fim3 EPGITTNYDT 96–105 NA 0.00
(1.00)
B pili Attach HBD 9573115
49057 PRN PQPGPQPPQPPQPQPEAPAPQPPAG 579–603 3/37 0.03
(0.05)
B OMP Attach PQP motif5 17597264
19684 PRN GGAVPGGAVPGGAVPGGFGPGGFGP 266–290 2/37 0.02
(0.04)
B OMP Attach GGXXP motifd 8609998
98699 PRN APKPAPQPGPQPPQP 574–588 NA 0.00
(1.00)
B OMP Attach PQP motifee 17597264
3757 PRN APQPGPQPPQPPQPQPEAPAPQ 578–599 NA 0.00
(1.00)
B OMP Attach PQP motife 17597264
98741 PRN EAPAPQPPAGRELSA 594–608 NA 0.00
(1.00)
B OMP Attach PQP motife 17597264
98788 PRN GDAPAGGAVP 261–270 NA 0.00
(1.00)
B OMP Attach GGXXP motifd 8609998
98798 PRN GGFGPGGFGP 281–290 NA 0.00
(1.00)
B OMP Attach GGXXP motifd 8609998
98799 PRN GGFGPVLDGW 286–295 NA 0.00
(1.00)
B OMP Attach GGXXP motifd 8609998
98940 PRN PQPGPQPPQPPQPQP 579–593 NA 0.00
(1.00)
B OMP Attach PQP motife 17597264
98687 PRN AKAPPAPKPAPQPGP 569–583 NA 0.00
(1.00)
B OMP Attach PQP motife 17597264
98698 PRN APKPAPQPGP 574–583 NA 0.00
(1.00)
B OMP Attach PQP motife 17597264
187658 FHA GPIVVEAGELVSHAGG 1229–
1244
NA NA B HA Attach CRDb 8514379
22921 AC GVATKGLGVHAKSSDWG 54–70 NA 0.00
(1.00)
B A subunit CD Membrane insertionc 2224147,
11348687

OMP, outer membrane protein; CD, catalytic domain; RBD, receptor-binding domain; attch, attachment; CRD, carbohydrate recognition domain, HBD, heparin-binding domain; The number in parentheses is the standard deviation; discn, discontinuous; NA, not available

a

YYSN or YYSK, the K and N considered mitogenic sites.s

b

constitutes a CRD critical for bacterial adherence.

c

crucial for membrane insertion and translocation of the catalytic domain of CyaA.

d

mediates interaction with epithelial cells.

e

immune evasion; highlighted residues = functional sites.

The highest RFscores for antibody responses were generated against PT subunit 1 (PT S1) which represents the catalytic A domain of the toxin and the fimbrials (fim2/3). Interestingly, while notable RFscore were also noted for T cell responses against PT S1, high T cell associated RFscores were observed for subunit 4 (S4) as well. S4 is part of the B domain of PT and is the receptor-binding domain (RBD) of the toxin. Here we observed that S4 epitope residues corresponded with the ATP-binding domain within the RBD. To further visualize their location relative to the overall structure, epitopes with high RFscores were mapped onto the 3D structure of PT, as shown in Figs. 2 and 3. To date, 3D structures have not been reported for B. pertussis fimbrials (no Protein database ID), therefore we were unable to map these epitopes.

Fig. 2.

Fig. 2

3D Mapping of prominent epitopes for PT S1 catalytic domain. These data were generated using the Immunome Browser feature accessible through the results summary page. Prominence was given to any epitope with RFscore >0.30. The data for each epitope is accessible using the Epitope ID through the Identifier Search (Advanced Search menu). RFscores are calculated as # respondents-square root of respondents/# tested. The square root is a correction factor, approximating one standard deviation for the number of responding donors. This gives a higher score to epitopes studied with larger sample sizes. Bold sequence indicates residues overlapping among epitopes from protection studies shown in Table 6. 3D mapping was accomplished using Homology Mapping (FASTA of antigens from Tohama I) available through the IEDB Epitope Analysis Tools. Blue color indicates residues involved in epitopes. (For interpretation of color in Fig. 2, the reader is referred to the web version of this book).

Fig. 3.

Fig. 3

3D Mapping of prominent epitopes for PT S4 receptor binding domain Refer to previous Fig. 2 legend for details.

The targeting of these regions by T cell and antibody responses may therefore provide an advantage to the host either by neutralization/inhibition, steric interference, the promotion of opsonization, cytolysis of infected cells and/or the production of cytokines that promote clearance. The 3D location of observed antibody epitopes reflects targeting of the more surface exposed regions of the toxin; whereas the T cell responses appear to be directed at sites more internal and likely accessible to TCRs following class I/II processing. Data are as yet insufficient for AC, PRN and FHA to provide similar mappings.

3.5. Antigenic drift as a cause of vaccine failure

As indicated above, antigenic drift has also been investigated as a potential contributing factor for increased disease incidence. Antigenic drift occurs as a result of genomic variations between circulating B. pertussis strains and those incorporated within licensed vaccines arise over time. This sequence variation could affect antibody and cellular recognition and/or memory responses in the host (vaccinated or immune) population. Indeed, vaccine-induced antigenic shifts associated with clinical breakthrough, as well as vaccine-induced pathogen adaptation have been documented [41,42].

While B. pertussis is known to be fairly monomorphic [14,17,43], allelic variation has been documented in several well-known virulence genes: ptx (PT promoter and A subunit), fim (fimbrials 2 and 3), and prn (pertactin). Genomic analysis has identified single nucleotide polymorphisms (SNPs), as well as insertions and deletions (in prn; though less frequent) leading to the occurrence of multiple allelic forms globally [12,15,17,19,44]. While these studies have suggested that these variations may play a role in adaptation following immunization [15,45–48], the extent to which these variations fall within epitopic regions was not addressed.

Using the data provided in the studies, we examined the relationship between SNPs identified to date and reported antibody and T cell epitope locations. It was found that of the 12 unique SNPs previously identified, 10 (83%) are present within antibody and T cells epitopes, which includes those specificities captured in the IEDB, as well as those within larger regions recognized by certain monoclonal antibodies and T cell clones. Table 8 provides details of the SNPs analyzed and the corresponding epitope(s). However these results are not statistically significant, because the inclusion of the larger regions greatly reduces the resolution of the analysis, and results in the sequences of those antigens being very extensively covered. Taken together, these results suggest that a more stringent definition of the actual epitopes recognized in humans following vaccination is required, to conclusively address this issue.

Table 8.

Polymorphisms identified in B. pertussis strains and corresponding reported human epitopes.

Antigen
variant
Sequence(s) Epitope
ID
Epitope sequence Response details PMID
Fim2–1 TSRTV 70651 VQTGGTSRTVTMRYLAS (141–157) Recognized by 12/12 adult WC patients in UK; 4/4 wP
vaccinated children; + IgG and IgA response in adults
8731026
Fim2–2 K
Fim3–1 PQALG 50304 QALGALK (64–70) Recognized by 12/12 adult WC patients in UK; 3/4 wP
vaccinated children; + IgG and IgA response in adults
8731026
Fim3–2 E
Fim3–3 E
Fim3–1 SATKA 60914 SSATK (105–109) Recognized by 11/12 adult WC patients in UK; 4/4 wP
vaccinated children; + IgG and IgA response in adults
8731026
Fim3–2 T
Fim3–3 A
PTxA1 VLDHL 9568 DNVLDHLTGR (30–39) T cell clone RR215 proliferation WC; HLA-DR1 7693460
PTxA4 E 9571 DNVLDHLTGRSC (64–75) Ex vivo T cell proliferation 5/9 WC; HLA-DQ 2460578
PTxA5 E 9573 DNVLDHLTGRSCQ (64–76) T cell clone proliferation 3/3 subjects vaccination with genetically 1313575
21476 GNNDNVLDHLTGR (61–73) detoxified PT mutant PT9 K/129G; 1/1 ex vivo response WC patient;
HLA-DR1
T cell clones S232, T215, T226 proliferation WC patient; HLA-DR1
2469760
PTxA1 EYSNA 20455 GITGETTTTEYSNARYV (185–201) Recognized by 5/5 JNIH-7 (PT only) vaccinated infants and 5/5 infants
vaccinated with wP; IgG
2450153
PTxA5 P
PTxA1 LVRIAPVIGAC 22756 GTLVRMAPVIG (223–233) Ex vivo T cell proliferation 4/9 adults immunized with wP; Serum Ab of
infant immunized with aP
2460578
PTxA2 M
PTxA4 MV 65995 TRANPNPYTSRRSVASIVGTLVRM
(205–228)
T cell clones S105, S201, T209 and T217 from WC proliferated; HLA-DR1
PTxA5 MM 2469760
PTxA8 M
Prn1–13 Repeat region 19684 GGAVPGGAVPGGAVPGGFGPGGFGP
(266–290)
2/37 subjects vaccinated or WC; IgG
Recognized by sera from children vaccinated (aP) or exposed
17926203
Variations: 98796 GGAVP (266–270) 15213111
GGAVP
GGFGP
GGGVP
fhaB Q831 NA Region aa390–874 (HBD) Neutralizing scFv; reduces colonization in respir tract 17724067*
cya V892 NA Region aa888–1006 Part of region recognized by mAbs 2B12 and 4H2 10225859*
prn L532 NA None reported NA 21070624*
ptxB G44 NA None reported NA 21070624*

Antigen variant data sourced from [12] [PMID: 23406868], [19] [PMID:9453625] and [17] [21070624]. The sequence identified as part of the polymorphism is shown in bold in the epitope. WC = subject who had whooping cough. PTx = pertussis toxin; fim = fimrial; prn = pertactin. Epitope ID and PMID are searchable parameters on the IEDB search interface.

*

not on IEDB webpage. Cya = adenylate cyclase; fhaB = filamentous hemagglutinin; ptx = pertussis toxin; prn = pertactin; fim = fimbrial.

4. Discussion/conclusions

The resurgence of B. pertussis infections has received considerable attention in recent years. Several hypotheses have been formulated in terms of apparent waning of vaccine efficacy. First, it is possible that the breadth of responses induced by aP is significantly less comprehensive than the one induced by wP, and immunity against crucial antigens is not elicited by the aP vaccine (breadth of immunity). Second, it has been hypothesized that the quality of responses, in terms of phenotypes of responding T cells/neutralizing capacity of antibodies, or duration of responses, induced by aP is markedly different from the one induced by wP or natural infection (quality of immunity). Lastly it is also possible that new B. pertussis strains might be evolving, and lacking the antigens targeted by the vaccine, or carry mutations in key epitopes (pathogen escape). All three of the above hypotheses can be at least partially addressed by immunological data. Here we present a comprehensive review of immune epitope data related to B. pertussis to investigate whether the available data are sufficient to address these issues.

Our review and analysis of the epitope data reveals that the characterization of B. pertussis immunity is limited. In terms of the breadth of the responses induced by natural infection versus the different vaccine constructs, epitope data were defined from a relatively small number of B. pertussis antigens (6 of >3400). The majority of epitopes were defined for PT, and far fewer were reported for antigens incorporated within currently licensed aP vaccines, and also associated with vaccine-induced immunity and in immunity to natural infection [11,49–51]. Thus a meaningful assessment of how the epitope breadth elicited by natural infection versus aP and wP vaccination could not be undertaken. However, this analysis was able to present interesting insights into structural and functional relationships with respect to epitope location and to examine the association between epitope location and sites of antigenic diversification (SNP analysis). Taken together these findings underscore the need for a more comprehensive epitope mapping of B. pertussis antigens in the context of human disease and active immunization.

The consensus in the literature is that vaccine-induced protection is largely antibody-mediated [52–56]. And indeed, antibody epitopes represent the majority of those reported herein (>80%), however, relatively few antibody epitopes were associated with human subjects (<30%). Furthermore, our analysis revealed a surprising lack of discontinuous B cell determinants given the overwhelming focus on humoral responses. There were a relatively small number of monoclonal antibodies (all murine) and few reports defining specific isotypes or subtypes other than IgG. Further mapping in this context may provide additional insight for protective responses, as work to date has shown that IgG2a, which facilitates opsonization and complement fixation has been associated with protection [55,57], and IgA isolated from convalescent human sera has been shown to inhibit adherence of bacteria to ciliated epithelial cells [58]. Indeed, both the wP and aP vaccines induce high levels of specific antibodies. However different isotypes predominate resulting in functional differences [55,57,59] and these have not been investigated at this level to any extent.

T cell epitopes represent a mere 16% of the total data. Numerous studies published to date have demonstrated a role for T cells/cell-mediated immunity following immunization and natural infection [11,49,50,60–62]. Despite this, very little of the T cell epitope data were characterized phenotypically. While the majority of reported T cell epitopes were defined for CD4+/class II T cells, these represent mostly proliferation data. Few cytokine data were described (minimal IFNc and IL-2). Studies to date have implicated certain cytokine reactivity in protection thereby making this an area for future focus [33,50,60,63,64]. Similarly, while the wP vaccine has been associated with a Th1/Th17 type response, the aP formulations tend to induce Th2 cytokines [50,65]. Thus far there is little or no characterization of CD8+ T cell epitopes, despite some evidence of their role in natural infection and following immunization [49,61]. Lastly, MHC restriction data was limited. Moreover, tetramer reagents, which can provide powerful tools for characterization of T cell responses in disease, and following different vaccination strategies, were absent, thus highlighting another area for future work.

To date, few epitopes were defined in the context of functional assays, and thereby little data are available to ascertain correlates of protection. Thus, at the level of response quality the available data does not provide clear association of epitope reactivity with different antibody type and T cell phenotypes, functional activities or correlates of protection. Similarly, since not all relevant epitopes for aP vaccine components are known, it is not possible to comprehensively assess how they may differ from those epitopes recognize following natural infection. Lastly, in terms of evaluating the possible role of pathogen escape in relation with waning vaccine efficacy, it is apparent from what is presented above that only a small subset of the relevant antibody and T cell epitopes is known. While some evidence is emerging that shows antigenic variants in circulating strains of B. pertussis [12,17], whether this is as a result of natural host-pathogen evolution, selective pressure exerted by vaccines containing few antigens, or a combination thereof, it not yet known. A more comprehensive epitope mapping of critical vaccine-related epitopes is therefore necessary to ascertain whether mutations are occurring within the key epitopes or not.

In conclusion, taking into consideration the overall impact of this pathogen on human health, the characterization of B. pertussis at the molecular level is surprisingly minimal. Perhaps one unexpected and positive outcome of this recent resurgence of disease will be renewed efforts to more fully characterize the immunobiology of this important pathogen, including definition of human reactivity at the molecular level.

Assuming that more epitope knowledge will become available in the coming years, it may be possible to use this knowledge to a better vaccine design or understanding of the current aP vaccine’s role in the dramatic increase in observed pertussis cases. For example, knowledge of the crucial epitopes induced by natural infection and vaccination would indicate whether they are modified by fixation, and might suggest different inactivation strategies. Epitope definition on a genome-wide basis, as recently shown in the case of TB [66], would allow for a more accurate measure of responses to a wide variety of antigen, and compare responses resulting from natural infection, and vaccination with whole cell and cellular vaccines. Further important issues that await clarification are which epitopes are important for protection and which are non-protective, and where are they located on the toxin.

Supplementary Material

Supp Refs
Supp Table 1

Acknowledgments

We gratefully acknowledge Drs Mark Sawyer, Rino Rappuoli and Alison Deckhut for their contributions in reviewing this manuscript. This work is supported by the National Institute of Allergy and Infectious Diseases (NIAID), under the Immune Epitope Data-base and Analysis Resource: contract number HHSN272201200010C.

Footnotes

Appendix A. Supplementary data

Supplementary data associated with this article can be found, in the online version, at http://dx.doi.org/10.1016/j.humimm.2014.02.013.

References

  • 1.Holmes WH. Whooping cough, or pertussis. In: Holmes WH, editor. Bacillary and rickettsial infections: acute and chronic, black death to white plague. New York: Macmillan; 1940. pp. 395–414. [Google Scholar]
  • 2.Marconi GP, Ross LA, Nager AL. A resurgence in pertussis: epidemiology and trends. Pediatr Emerg Care. 2012;28(3):215–219. doi: 10.1097/PEC.0b013e318248b0cd. [DOI] [PubMed] [Google Scholar]
  • 3.Committee to review adverse effects of vaccines, institute of medicine. Adverse effects of vaccines: evidence and causality. Washington, DC: The National Academies Press; 2012. “10 Diphtheria toxoid, tetanus toxoid, and acellular pertussiscontaining vaccines”. [PubMed] [Google Scholar]
  • 4.CDC. www.cdc.gov/pertussis/fast-facts.html.
  • 5.Poland G. Pertussis outbreaks and pertussis vaccine: new insights, new concerns, new recommendations? Vaccine. 2012;30:6957–6959. doi: 10.1016/j.vaccine.2012.09.084. [DOI] [PubMed] [Google Scholar]
  • 6.Witt MA, Katz PH, Witt DJ. Unexpectedly limited durability of immunity following acellular pertussis vaccination in preadolescents in a North American outbreak. Clin Infect Dis. 2012;54:1730–1735. doi: 10.1093/cid/cis287. [DOI] [PubMed] [Google Scholar]
  • 7.Klein NP, Bartlett J, Rowhani-Rahbar A, Fireman B, Baxter R. Waning protection after fifth dose of acellular pertussis vaccine in children. N Engl J Med. 2012;367:1012–1019. doi: 10.1056/NEJMoa1200850. [DOI] [PubMed] [Google Scholar]
  • 8.Sheridan SL, Ware RS, Grimwood K, Lambert SB. Number and order of whole cell pertussis vaccines in infancy and disease protection. J Am Med Assoc. 2012;308(5):454–456. doi: 10.1001/jama.2012.6364. [DOI] [PubMed] [Google Scholar]
  • 9.Rowe J, Macaubas C, Monger TM, Holt BJ, Harvey J, Poolman JT, et al. Antigen-specific responses to diphtheria-tetanus-acellular pertussis vaccine in human infants are initially Th2 polarized. Infect Immun. 2000;68:3873–3877. doi: 10.1128/iai.68.7.3873-3877.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Mascart F, Hainaut M, Peltier A, Verscheure V, Levy J, Locht C. Modulation of the infant immune responses by the first pertussis vaccine administrations. Vaccine. 2007;25:391–398. doi: 10.1016/j.vaccine.2006.06.046. [DOI] [PubMed] [Google Scholar]
  • 11.Mills KH. Immunity to Bordetella pertussis. Microbes Infect. 2001;3:655–677. doi: 10.1016/s1286-4579(01)01421-6. [DOI] [PubMed] [Google Scholar]
  • 12.Mooi FR, van der Maas NA, De Melker HE. Pertussis resurgence: waning immunity and pathogen adaptation - two sides of the same coin. Epidemiol Infect. 2013;13:1–10. doi: 10.1017/S0950268813000071. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Octavia S, Sintchenko V, Gilbert GL, Lawrence A, Keil AD, Hogg G, et al. Newly emerging clones of Bordetella pertussis carrying prn2 and ptxP3 alleles implicated in Australian pertussis epidemic in 2008–2010. J Infect Dis. 2012;205:1220–1224. doi: 10.1093/infdis/jis178. [DOI] [PubMed] [Google Scholar]
  • 14.Octavia S, Maharjan RP, Sintchenko V, Stevenson G, Reeves PR, Gilbert GL, et al. Insight into evolution of Bordetella pertussis from comparative genomic analysis: evidence of vaccine-driven selection. Mol Biol Evol. 2011;28:707–715. doi: 10.1093/molbev/msq245. [DOI] [PubMed] [Google Scholar]
  • 15.Mooi FR. Bordetella pertussis and vaccination: the persistence of a genetically monomorphic pathogen. Infect Genet Evol. 2010;10:36–49. doi: 10.1016/j.meegid.2009.10.007. [DOI] [PubMed] [Google Scholar]
  • 16.Kurniawan J, Maharjan RP, Chan WF, Reeves PR, Sintchenko V, Gilbert GL, et al. Bordetella pertussis clones identified by multilocus variablenumber tandem-repeat analysis. Emerg Infect Dis. 2010;16:297–300. doi: 10.3201/eid1602.081707. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Bart MJ, van Gent M, van der Heide H, Boekhorst J, Hermans P, Parkhill J, et al. Comparative genomics of prevaccination and modern Bordetella pertussis strains. BMC Genomics. 2010;11:627. doi: 10.1186/1471-2164-11-627. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Mooi FR, van Loo IH, van GM, He Q, Bart MJ, Heuvelman KJ, et al. Bordetella pertussis strains with increased toxin production associated with pertussis resurgence. Emerg Infect Dis. 2009;15:1206–1213. doi: 10.3201/eid1508.081511. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Mooi FR, van OH, Heuvelman K, van der Heide HG, Gaastra W, Willems RJ. Polymorphism in the Bordetella pertussis virulence factors P.69/pertactin and pertussis toxin in The Netherlands: temporal trends and evidence for vaccine-driven evolution. Infect Immun. 1998;66:670–675. doi: 10.1128/iai.66.2.670-675.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Shapiro ED. Acellular vaccines and resurgence of pertussis. JAMA. 2012;308:2149–2150. doi: 10.1001/jama.2012.65031. [DOI] [PubMed] [Google Scholar]
  • 21.Nitsch-Osuch A, Korzeniewski K, Kuchar E, Zielonka T, Zycińska K, Wardyn K. Epidemiological and immunological reasons for pertussis vaccination in adolescents and adults. Respir Physiol Neurobiol. 2013;187(1):99–103. doi: 10.1016/j.resp.2013.02.007. [DOI] [PubMed] [Google Scholar]
  • 22.CDC. www.cdc.gov/nchs/data/hestat/pertussis/pertussis.htm.
  • 23.Barkoff A, Grondahl-Yli-Hannuksela K, Vuononvirta J, Mertsola J, Kallonen T, He Q. Differences in avidity of IgG antibodies to pertussis toxin after acellular pertussis booster vaccination and natural infection. Vaccine. 2012;30:6897–6902. doi: 10.1016/j.vaccine.2012.09.003. [DOI] [PubMed] [Google Scholar]
  • 24.Murphy BR, Walsh EE. Formalin-inactivated respiratory syncytial virus vaccine induces antibodies to the fusion glycoprotein that are deficient in fusioninhibiting activity. J Clin Microbiol. 1988;26(8):1595–1597. doi: 10.1128/jcm.26.8.1595-1597.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Robbins JB, Schneerson R, Trollfors B, Sato H, Sato Y, Rappuoli R, et al. The diphtheria and pertussis components of diphtheria-tetanus toxoids-pertussis vaccine should be genetically inactivated mutant toxins. J Infect Dis. 2005;191(1):81–88. doi: 10.1086/426454. [DOI] [PubMed] [Google Scholar]
  • 26.Taranger J, et al. Mass vaccination of children with pertussis toxoid-decreased incidence in both vaccinated and nonvaccinated persons. Clin Infect Dis. 2001;33:1004–1010. doi: 10.1086/322639. [DOI] [PubMed] [Google Scholar]
  • 27.Cherry JD. Comparative efficacy of acellular pertussis vaccines: an analysis of recent trials. Pediatr Infect Dis J. 1997;16(Suppl. 4):S90–s96. doi: 10.1097/00006454-199704001-00004. [DOI] [PubMed] [Google Scholar]
  • 28.Trollfors B, Taranger J, Lagergård T, Lind L, Sundh V, Zackrisson G, et al. A placebo-controlled trial of a pertussis-toxoid vaccine. N Engl J Med. 1995;333(16):1045–1050. doi: 10.1056/NEJM199510193331604. [DOI] [PubMed] [Google Scholar]
  • 29.De Magistris MT, Romano M, Bartoloni A, Rappuoli R, Tagliabue A. Human T cell clones define S1 subunit as the most immunogenic moiety of pertussis toxin and determine its epitope map. J Exp Med. 1989;169(5):1519–1532. doi: 10.1084/jem.169.5.1519. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Davies V, Vaughan K, Damle R, Peters B, Sette A. Classification of the universe of immune epitope literature: representation and knowledge gaps. PLoS One. 2009;4(11):e8084. doi: 10.1371/journal.pone.0006948. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Sato H, Sato Y, Ito A, Ohishi I. Effect of monoclonal antibody to pertussis toxin on toxin activity. Infect Immun. 1987;55:909–915. doi: 10.1128/iai.55.4.909-915.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Olin P, Hallander HO, Gustafsson L, Reizenstein E, Storsaeter J. Clin Infect Dis. 2001;33(Suppl. 4):S288291. doi: 10.1086/322564. [DOI] [PubMed] [Google Scholar]
  • 33.Coleman MM, Finlay CM, Moran B, Keane J, Dunne PJ, Mills KH. The immunoregulatory role of CD4+ FoxP3+ CD25 regulatory T cells in lungs of mice infected with Bordetella pertussis. FEMS Immunol Med Microbiol. 2012;64:413–424. doi: 10.1111/j.1574-695X.2011.00927.x. [DOI] [PubMed] [Google Scholar]
  • 34.Alexander F, Matheson M, Fry NK, Labram B, Gorringe AR. Antibody responses to individual Bordetella pertussis fimbrial antigen Fim2 or Fim3 following immunization with the five component acellular pertussis vaccine or to pertussis disease. Clin Vaccine Immunol. 2012;19(11):1776–1783. doi: 10.1128/CVI.00355-12. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Gorringe AR, Ashworth LAE, Irons LI, Robinson A. Effect of monoclonal antibodies on the adherence of Bordetella pertussis to Vero cells. FEMS Microbiol Lett. 1985;26:5–9. [Google Scholar]
  • 36.Rodríguez ME, Hellwig SM, Pérez Vidakovics ML, Berbers GA, van de Winkel GJ. Bordetella pertussis attachment to respiratory epithelial cells can be impaired by fimbriae-specific antibodies. FEMS Immunol Med Microbiol. 2006;46:39–47. doi: 10.1111/j.1574-695X.2005.00001.x. [DOI] [PubMed] [Google Scholar]
  • 37.Smith AM, Guzmán CA, Walker MJ. The virulence factors of Bordetella pertussis: a matter of control. FEMS Microbiol Rev. 2001;25(3):309–333. doi: 10.1111/j.1574-6976.2001.tb00580.x. [DOI] [PubMed] [Google Scholar]
  • 38.Bagley KC, Abdelwahab SF, Tuskan RG, Fouts TR, Lewis GK. Pertussis toxin and the adenylate cyclase toxin from Bordetella pertussis activate human monocyte-derived dendritic cells and dominantly inhibit cytokine production through a cAMP-dependent pathway. J Leukoc Biol. 2002;72(5):962–969. [PubMed] [Google Scholar]
  • 39.Burns DL. Subunit structure and enzymic activity of pertussis toxin. Microbiol Sci. 1988;5(9):285–287. [PubMed] [Google Scholar]
  • 40.Carbonetti NH. Pertussis toxin and adenylate cyclase toxin: key virulence factors of Bordetella pertussis and cell biology tools. Future Microbiol. 2010;5(3):455–694. doi: 10.2217/fmb.09.133. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Poolman JT, Hallander HO. Acellular pertussis vaccines and the role of pertactin and fimbriae. Expert Rev Vaccines. 2007;6(1):47–56. doi: 10.1586/14760584.6.1.47. [DOI] [PubMed] [Google Scholar]
  • 42.van Gent M, Bart MJ, van der Heide HG, Heuvelman KJ, Mooi FR. Small mutations in Bordetella pertussis are associated with selective sweeps. PLoS One. 2012;7(9):e46407. doi: 10.1371/journal.pone.0046407. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Maharjan RP, Gu C, Reeves PR, Sintchenko V, Gilbert GL, Lan R. Genome-wide analysis of single nucleotide polymorphisms in Bordetella pertussis using comparative genomic sequencing. Res Microbiol. 2008;159(9–10):602–608. doi: 10.1016/j.resmic.2008.08.004. [DOI] [PubMed] [Google Scholar]
  • 44.Advani A, Gustafsson L, Ahrén C, Mooi FR, Hallander HO. Appearance of Fim3 and ptxP3-Bordetella pertussis strains, in two regions of Sweden with different vaccination programs. Vaccine. 2011;29(18):3438–3442. doi: 10.1016/j.vaccine.2011.02.070. [DOI] [PubMed] [Google Scholar]
  • 45.Kallonen T, He Q. Bordetella pertussis strain variation and evolution postvaccination. Expert Rev Vaccines. 2009;8(7):863–875. doi: 10.1586/erv.09.46. [DOI] [PubMed] [Google Scholar]
  • 46.King AJ, Berbers G, van Oirschot HF, Hoogerhout P, Knipping K, Mooi FR. Role of the polymorphic region 1 of the Bordetella pertussis protein pertactin in immunity. Microbiology. 2001;147(Pt. 11):2885–2895. doi: 10.1099/00221287-147-11-2885. [DOI] [PubMed] [Google Scholar]
  • 47.Hijnen M, de Voer R, Mooi FR, Schepp R, Moret EE, van Gageldonk P, et al. The role of peptide loops of the Bordetella pertussis protein P.69 pertactin in antibody recognition. Vaccine. 2007;25(31):5902–5914. doi: 10.1016/j.vaccine.2007.05.039. [DOI] [PubMed] [Google Scholar]
  • 48.He Q, Mertsola J. Factors contributing to pertussis resurgence. Future Microbiol. 2008;3(3):329–339. doi: 10.2217/17460913.3.3.329. [DOI] [PubMed] [Google Scholar]
  • 49.Dirix V, Verscheure V, Vermeulen F, De Schutter I, Goetghebuer T, Locht C, et al. Both CD4+ and CD8+ lymphocytes participate in INF response to filamentous hemagglutinin from Bordetella pertussis in infants, children and adults. Clin Dev Immunol. 2012 doi: 10.1155/2012/795958. http://dx.doi.org/10.1155/2012/795958. [DOI] [PMC free article] [PubMed]
  • 50.Ryan M, Murphy G, Ryan E, Nilsson L, Shackley F, Gothers L, et al. Distinct T-cell subtypes induced with whole cell and acellular pertussis vaccines in children. Immunology. 1998;93:1–10. doi: 10.1046/j.1365-2567.1998.00401.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Di Tommaso A, Domenighini M, Bugnoli M, Tagliabue A, Rappuoli R, De Magistris MT. Identification of subregions of Bordetella pertussis filamentous hemagglutinin that stimulate human T-cell responses. Infect Immun. 1991;59:3313–3315. doi: 10.1128/iai.59.9.3313-3315.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Cherry JD, Gornbein J, Heininger U, Stehr K. A search for serologic correlates of immunity to Bordetella pertussis cough illnesses. Vaccine. 1998;16:1901–1906. doi: 10.1016/s0264-410x(98)00226-6. [DOI] [PubMed] [Google Scholar]
  • 53.Storsaeter J, Hallander HO, Gustafsson L, Olin P. Levels of anti-pertussis antibodies related to protection after household exposure to Bordetella pertussis. Vaccine. 1998;16:1907–1916. doi: 10.1016/s0264-410x(98)00227-8. [DOI] [PubMed] [Google Scholar]
  • 54.Leef M, Elkins KL, Barbic J, Shahin RD. Protective immunity to Bordetella pertussis requires both B cells and CD4(+) T cells for key functions other than specific antibody production. J Exp Med. 2000;191:1841–1852. doi: 10.1084/jem.191.11.1841. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Mahon BP, Sheahan BJ, Griffin F, Murphy G, Mills KH. Atypical disease after Bordetella pertussis respiratory infection of mice with targeted disruptions of interferon-gamma receptor or immunoglobulin mu chain genes. J Exp Med. 1997;186:1843–1851. doi: 10.1084/jem.186.11.1843. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Kirimanjeswara GS, Mann PB, Harvill ET. Role of antibodies in immunity to Bordetella infections. Infect Immun. 2003;71:1719–1724. doi: 10.1128/IAI.71.4.1719-1724.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Mills KH, Ryan M, Ryan E, Mahon BP. A murine model in which protection correlates with pertussis vaccine efficacy in children reveals complementary roles for humoral and cell- mediated immunity in protection against Bordetella pertussis. Infect Immun. 1998;66:594–602. doi: 10.1128/iai.66.2.594-602.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Tuomanen EI, Zapiain LA, Galvan P, Hewlett EL. Characterization of antibody inhibiting adherence of Bordetella pertussis to human respiratory epithelial cells. J Clin Microbiol. 1984;20(2):167–170. doi: 10.1128/jcm.20.2.167-170.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Redhead K, Watkins J, Barnard A, Mills KH. Effective immunization against Bordetella pertussis respiratory infection in mice is dependent on induction of cell-mediated immunity. Infect Immun. 1993;61:3190–3198. doi: 10.1128/iai.61.8.3190-3198.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Ryan M, Murphy G, Gothefors L, Nilsson L, Storsaeter J, Mills KH. Bordetella pertussis respiratory infection in children is associated with preferential activation of type 1 T helper cells. J Infect Dis. 1997;175:1246–1250. doi: 10.1086/593682. [DOI] [PubMed] [Google Scholar]
  • 61.Rieber N, Graf A, Hartl D, Urschel S, Belohradsky BH, Liese J. Acellular pertussis booster in adolescents induces Th1 and memory CD8+ T cell immune response. PLoS One. 2011;6(3):e17271. doi: 10.1371/journal.pone.0017271. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Hafler JP, Pohl-Koppe A. The cellular immune response to Bordetella pertussis in two children with whooping cough. Eur J Med Res. 1998;3:523–526. [PubMed] [Google Scholar]
  • 63.Ausiello CM, Lande R, Urbani F, Di Carlo B, Stefanelli P, Salmaso S, et al. Cell-mediated immunity and antibody responses to Bordetella pertussis antigens in children with a history of pertussis infection and in recipients of an acellular pertussis vaccine. J Infect Dis. 2000;181:1989–1995. doi: 10.1086/315509. [DOI] [PubMed] [Google Scholar]
  • 64.Petersen JW, Ibsen PH, Haslov K, Heron I. Proliferative responses and gamma interferon and tumor necrosis factor production by lymphocytes isolated from tracheobroncheal lymph nodes and spleen of mice aerosol infected with Bordetella pertussis. Infect Immun. 1992;60:4563–4570. doi: 10.1128/iai.60.11.4563-4570.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Rowe J, Yerkovich ST, Richmond P, Suriyaarachchi D, Fisher E, Feddema L, et al. Th2-Associated local reactions to the acellular Diphtheria-Tetanus-Pertussis vaccine in 4- to 6-year-old children. Infect Immun. 2005;73:8130–8135. doi: 10.1128/IAI.73.12.8130-8135.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Lindestam Arlehamn CS, Gerasimova A, Mele F, Henderson R, Swann J, Greenbaum JA, et al. Memory T cells in latent Mycobacterium tuberculosis infection are directed against three antigenic islands and largely contained in a CXCR3+CCR6+ Th1 subset. PLoS Pathog. 2013;9(1):e1003130. doi: 10.1371/journal.ppat.1003130. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supp Refs
Supp Table 1

RESOURCES