Skip to main content
The Journal of Immunology Author Choice logoLink to The Journal of Immunology Author Choice
. 2016 Mar 4;196(7):3064–3078. doi: 10.4049/jimmunol.1500527

Achieving Potent Autologous Neutralizing Antibody Responses against Tier 2 HIV-1 Viruses by Strategic Selection of Envelope Immunogens

Ann J Hessell *, Delphine C Malherbe *, Franco Pissani *,, Sean McBurney *, Shelly J Krebs , Michelle Gomes *, Shilpi Pandey *, William F Sutton *, Benjamin J Burwitz *,, Matthew Gray §, Harlan Robins , Byung S Park *, Jonah B Sacha *,, Celia C LaBranche , Deborah H Fuller #, David C Montefiori , Leonidas Stamatatos , D Noah Sather §, Nancy L Haigwood *,**,
PMCID: PMC4797725  PMID: 26944928

Abstract

Advancement in immunogen selection and vaccine design that will rapidly elicit a protective Ab response is considered critical for HIV vaccine protective efficacy. Vaccine-elicited Ab responses must therefore have the capacity to prevent infection by neutralization-resistant phenotypes of transmitted/founder (T/F) viruses that establish infection in humans. Most vaccine candidates to date have been ineffective at generating Abs that neutralize T/F or early variants. In this study, we report that coimmunizing rhesus macaques with HIV-1 gp160 DNA and gp140 trimeric protein selected from native envelope gene sequences (envs) induced neutralizing Abs against Tier 2 autologous viruses expressing cognate envelope (Env). The Env immunogens were selected from envs emerging during the earliest stages of neutralization breadth developing within the first 2 years of infection in two clade B–infected human subjects. Moreover, the IgG responses in macaques emulated the targeting to specific regions of Env known to be associated with autologous and heterologous neutralizing Abs developed within the human subjects. Furthermore, we measured increasing affinity of macaque polyclonal IgG responses over the course of the immunization regimen that correlated with Tier 1 neutralization. In addition, we report firm correlations between Tier 2 autologous neutralization and Tier 1 heterologous neutralization, as well as overall TZM-bl breadth scores. Additionally, the activation of Env-specific follicular helper CD4 T cells in lymphocytes isolated from inguinal lymph nodes of vaccinated macaques correlated with Tier 2 autologous neutralization. These results demonstrate the potential for native Env derived from subjects at the time of neutralization broadening as effective HIV vaccine elements.

Introduction

Achieving a vaccine-elicited protective Ab response that is capable of addressing the unparalleled genetic diversity of HIV-1 envelope (Env) is a fundamental goal of HIV vaccine research. Notwithstanding the modest efficacy of the RV144 Thai trial in humans (1) that correlated binding Abs with a lower risk of infection, much of the HIV-1 vaccine research focus has been directed toward developing strategies and immunogens that will elicit protective Abs, including broadly neutralizing Abs (bNAbs). This goal is supported by the overwhelming evidence of the capability of broadly neutralizing mAbs (bNmAbs) given prior to mucosal exposure in preventing viral infection in macaques using the chimeric simian/HIV (SHIV) bearing HIV env (25). Neutralizing polyclonal Igs at high concentrations can block infection and have been shown to ameliorate disease pathogenesis in nonhuman primates (NHP) (6, 7). Recently, bNmAbs used as therapeutic treatment during chronic infection in macaques and humanized mice led to rapid declines in plasma viremia and temporary viral suppression (811). These studies support the premise that Abs have a greater advantage if present before virus exposure or shortly postinfection before exponential virus replication begins (7) and, if possible, before the establishment of latent viral reservoirs. Thus, efforts to design vaccines that rapidly elicit an effective and broadly cross-reactive neutralizing Ab (nAb) response seem rational based primarily on the observation that doses of bNmAbs are the only formula to date that has been shown to prevent infection and to provide sterilizing immunity in NHP. Despite multiple efforts to develop an immunogen or immunogens that can elicit bNAbs following vaccination, success has been limited (1221). Some incremental advances have been made, including our recent immunogenicity studies (22) and those of others (2325) that have shown an advantage of coimmunization with DNA and protein immunogens, including the potential of contracting the vaccine regimen to a small number of immunizations to reach peak NAb responses. Although breadth and potency of an elicited bNAb response is considered a prudent goal, it may be equally important to induce Abs that will rapidly prevent infection of the transmitted/founder (T/F) virus. Indeed, the ability to induce protective Abs against natural T/F viruses is quickly becoming recognized as a requirement for the development of new SHIVs that could be considered as biologically relevant tests for vaccine protection in rhesus macaques, a task that is proving to be challenging (26). This study has caused us to heed both the diversity of pathways whereby bNAbs can be achieved and led us to a more focused understanding of the role of the initial autologous neutralizing Ab (ANAb) responses and their impact on the route to potentially achieving protective humoral immunity.

We studied the phylogeny of HIV-1 envelope gene sequence (env) evolving during infection in two clade B infected individuals enrolled in the Tennessee Center for AIDS Research (CFAR), Vanderbilt University School of Medicine Cohort who developed moderate bNAbs less than 3 y after infection (22). Breadth in subject VC10014 was attributed to an epitope in gp120 that overlaps the CD4 binding site (CD4bs), and VC10013 breadth was mapped to a previously unrecognized epitope in the membrane proximal external region (MPER) of gp41. In these subjects, only a few critical epitopes that emerged within the first 2 y of infection accounted for affinity maturation resulting in distinctly unique pathways, leading to moderate breadth (27). After cloning and assessing a sizeable collection of gp160 env quasispecies representing the longitudinal evolution of env circulating within each individual, we designed DNA and protein vaccines using native envs and systematically conducted multiple comparative immunogenicity studies in rabbits (22). Vaccinating with selected natural quasispecies envs, we demonstrated that envs identified from two separate subjects can induce equally strong Ab responses and that some envs were superior to others. Specifically, we found that rabbits vaccinated with envs selected from times preceding, or contemporaneous with, the development of breadth produced the strongest NAbs. However, the NAbs in the rabbits neutralized only Tier 1 viruses moderately with negligible evidence of ANabs. On the basis of our characterization of envs from VC10014 and VC20013 (27), the vaccine env clones exhibited a Tier 2 neutralization phenotype. Importantly, achieving Tier 2 neutralization represents a substantial advance in generating an effective humoral response. In this study, the development of potent ANAbs in macaques vaccinated with the same “Early Breadth” envs from VC10014 and VC20013 provides a more informed evaluation of the envs than what we gained from the rabbit studies. Although not a perfect model for HIV-1 vaccine research, NHP possess a closer similarity in VH gene usage to humans compared with rabbits, and this difference may account for some of the improvements in induced immunity in this study. The macaque model also allowed us to examine a wider range of functional immunologic responses, including Env-specific follicular helper CD4 T cell (TFH) activation. We report a clear correlation with Tier 2 autologous neutralization and TFH cell activation implying their concomitant development, which to our knowledge is the first report of this finding in vaccinated macaques.

Materials and Methods

Animals and immunizations

Adult rhesus macaques were housed at the Oregon National Primate Research Center (Beaverton, OR). All procedures were performed according to rules approved by the Institutional Animal Care and Use Committee at Oregon Health and Science University. Twelve macaques were coimmunized with HIV-1 env gene expression plasmids and soluble gp140 trimeric protein at weeks 0, 4, 12, and 20. At each immunization, 36 μg DNA was given with a particle-mediated epidermal delivery (PMED) device (gene gun, XR-1 research model; PowderMed, Oxford, UK), by administering 2 μg of the DNA vaccines coated onto 1 μm-size gold particles into each of 18 sites along the shaved abdomen and upper thighs. Simultaneously, 50 μg recombinant Env gp140 protein was delivered i.m., formulated with not more than 20% Adjuplex (Sigma) adjuvant. Regular blood draws monitored immune responses in sera and PBMCs. Inguinal lymph node biopsies were performed at weeks 21 and 22 following the last immunization.

DNA and protein immunogen preparation

Single genome amplification and env cloning was previously performed and described (22) to isolate sequences subsequently used as DNA and protein immunogens.

DNA vaccine gene Gun cartridges.

DNA was precipitated onto 1 μm–diameter gold beads, and cartridges were prepared for delivery with the PowderMed PMED gene gun delivery device as described (28).

Recombinant gp140 proteins.

The gp140 DNA was derived from the gp160 env sequence by site-directed mutagenesis (Stratagene, La Jolla, CA) to insert the previously described mutations (28, 29) in the primary and secondary protease cleavage sites respectively: REKR → RSKS and KAKRR → KAISS. A large-scale endotoxin-free plasmid preparation (Qiagen, Valencia, CA) was used for stable expression in 293F cells for protein production as described previously (30). Epitope exposure and antigenicity of gp140 trimeric protein immunogens was assessed by ELISA, biolayer interferometry (BLI), and surface plasmon resonance for binding of multiple bNmAbs as described previously (22).

Abs, peptides, and recombinant proteins

Anti–HIV-1 mAbs used as controls in ELISA and neutralization assays, Clade B Consensus gp160 Env overlapping peptide set, and recombinant proteins RSC3, RSC3/G367R, and RSC3/Δ371I were obtained from the National Institutes of Health (NIH) AIDS Reagent Program. The HIV-1 SF162 V3 peptide (PNNNTRKSITIGPGRAFYATGD), the MPER peptide (RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR), and MPER scrambled peptide (KKKRIYWLWNTIDFWNWLSAWKDLELLEQENKKK) were synthesized by Genscript (Piscataway, NJ) and used for peptide competition neutralization and ELISAs. The gp70 (MLV)-V1V2 HIV-1/clade B/case A2 recombinant protein was obtained from Immune Technology (New York, NY).

ELISA binding assays

We measured serum Ab binding in blood samples collected every 2 wk against SF162 gp140 and against cognate Env proteins 2 wk following each immunization according to methods previously established (28). Polyclonal macaque IgG was purified from serum or plasma as previously described (28).

Peptide scanning ELISAs.

Peptide ELISA mapping was performed on week 22 serum samples with overlapping linear 15-mer peptides for the gp160 clade B consensus sequence as described previously (31).

gp70 V1V2 ELISA.

The binding Ab response to gp70 (MLV)-V1V2 HIV-1/Clade B/Case A2 protein (Immune Technology, New York, NY) was measured by endpoint ELISA with week 22 serum samples as described (32).

TZM-bl neutralization assays

Serum and purified IgG samples were tested for their ability to neutralize HIV-1 Env-containing pseudoviruses using the single-cycle TZM-bl neutralization assay as described previously (31, 33, 34). As a negative control, a pool of the preimmune serum was used at the lowest dilution tested (1:20). Neutralization dose-response curves were fitted by nonlinear regression and a final titer is reported as the reciprocal of the dilution of serum necessary to achieve 50% neutralization. For mAbs and purified IgG, the concentration of Ab required to obtain 50% neutralization (the IC50) is reported. In the text and figures, we used abbreviated names for the viruses. The full specific names are as follows: SF162, (SF162.LS); BaL, (BaL.26); MW965, (MW965.26); Q461 (Q461.E2.TAIV); SS1196, (SS1196.1); JRCSF; DJ263.8, (DJ263.8); ZM109 (ZM109F.PB4); ZM197 (ZM197M.PB7); QH0692 (QH0692.42); YU2.

A3R5 neutralization assays

The A3R5 neutralization assay was described recently (35). For each animal, preimmune and postimmune serum samples were assayed side by side. Postimmune samples were scored positive for nAb activity if the titer was 3-fold the titer of the preimmune sample. We used abbreviated identifiers of the viruses in figures and text. The full specific isolate names are as follows: SC22, (SC22.3C2.LucR.T2A.ecto); RHPA, (RHPA.LucR.T2A.ecto); CH58, (CH58.LucR.T2A.ecto); THRO, (THRO.LucR.T2A.ecto); CAP45, (CAP45.2.00.G3.LucR.T2A.ecto); Ce1086, (Ce1086_B2.LucR.T2A.ecto); X2278, (X2278_C2_B1.LucR.T2A.ecto; and TRO.11 (TRO.11.LucR.T2A.ecto); REJO, (REJO. LucR.T2A.ecto).

Competition neutralization assays

Detection of NAbs specifically directed to V3 and MPER peptides was performed as described previously (36, 37). The TZM-bl neutralization assay was conducted with the inclusion of HIV-1 SF162 V3, MPER, or scrambled peptides for 1 h, at a final concentration of 20 μg/ml with titrated purified macaque IgG (week 22) prior to 1 h incubation with 200 TCID50 of SF162 pseudovirus. Similarly, V1V2 and CD4 directed NAbs were assessed against HIV-1 SF162 in competition with gp70 V1V2 scaffold (Immune Technology), RSC3 and RSC3/Δ371I recombinant protein (NIH ARRP). Percent change in neutralization (IC50) was calculated as: ([IC50 without peptide] – [IC50 with peptide]/[IC50 without peptide]) × 100.

BLI binding assays

Macaque IgG samples.

BLI binding assays were performed on the Octet-Red device (FortéBio, Menlo Park, CA) to determine the binding kinetics between polyclonal macaque IgG and HIV-1 SF162 gp140 trimers as described previously (22). Briefly, gp140 trimeric protein was biotinylated using NHS-PEG4-Biotin system (Thermo Scientific, Rockford, IL) and immobilized on streptavidin biosensors (FortéBio) according to the manufacturers’ instructions. Sensors were dipped into six, 2-fold dilutions starting at 1000 nM of the purified macaque IgG samples for 900 s and then moved into kinetics buffer (FortéBio) for an additional 1800 s for dissociation of the Env-bound IgG. Association and dissociation rates were measured in real time and were calculated using the Octet Molecular Interaction System software. Observed binding curves were fit globally to a 1:1 binding model. A buffer-only reference was subtracted from all curves, and preimmune sera were used as a negative control. Association and dissociation rate constants were calculated using at least three different concentrations of IgG, to achieve a X2 < 1, R2 > 0.90. Equilibrium dissociation constants (KD) were calculated as the kinetic dissociation rate constant divided by the kinetic association rate constant.

Human IgG samples

Binding kinetics between polyclonal human IgG and HIV-1 SF162 gp140 trimers and Env immunogen trimeric proteins were also assessed with BLI as described previously (27).

Follicular helper CD4 T cells intracellular staining

Lymphocytes were isolated from inguinal lymph node biopsy specimens. Purified lymphocytes (5 × 106) were incubated with soluble gp140 Env (25 μg), anti-CD28 (0.5 μg; BD Biosciences), and anti-CD49d (0.5 μg; BD Biosciences) at 37°C for 1 h. After 1 h, Brefeldin A (0.5 μg; Sigma) was added, and the cells were incubated for an additional 8 h at 37°C. Cells were then washed with PBS and surfaced stained with Pacific Blue mouse anti-human CD3 (BD Bioscience), Alexa Flour 700 mouse anti-human CD4 (BD Biosciences), PerCP anti-human CD279 (PD-1; eBioscience), PE-Cyanine7 anti-human CD95 (eBioscience), FITC anti-human CD278 (eBioscience), and PE-eFluor 610 anti-human CD185 (CXCR5; eBioscience) for 30 min at room temperature. Cells were washed with PBS, fixed with 2% paraformaldehyde, and permeabilized with FACS lysing solution (BD Biosciences) followed by incubation with the intracellular stains APC mouse anti-human IFN-γ (BD Biosciences) and PE anti-human IL-21 (BioLegend) for 1 h at room temperature. The cells were then washed with saponin (Sigma) buffer and analyzed on a BD LSRII flow cytometer. TFH were defined as CD3+CD4+CD95+, PD-1hi along with either CXCR5+ or ICOS+. Env-specific responses were measured by IL-21 and IFN-γ.

Statistics

For autologous neutralization (ID50) of immunogen Env pseudoviruses, longitudinal neutralization of SF162, and KD values after immunizations, repeated measure ANOVA with vaccine group as a between-group factor and number of vaccination as a within-group factor was used to explore the effect of vaccine over time. The first-order autoregressive (1), which only the immediately previous measurement has a direct contribution to the current measurement in a longitudinal setting, was chosen to be within a covariance structure. Tukey adjustment was used to adjust for multiple comparisons. Repeated measures ANOVA was used to evaluate RSC3 core gp120 protein ELISA (OD 450/650 nm) with vaccination (013, 014) and scheme (RSC, RSC3/G367R, 013RSC3/Δ371I) as between-group factors and IgG (μg/ml) as within-group factor, and compound symmetry as a within-group correlation structure. Tukey multiple corrections were adopted to control overall type I error rate. Wilcoxon signed rank test was used to assess consensus B gp160 peptide scan with macaque IgG. For the epitope-specific binding and competition neutralization by macaque IgG, IC50 and percent inhibition of SF162 was compared using a Mann–Whitney U test. Multivariate Poisson regression was used to examine the vaccination variation between groups and time effects for breadth response. A Poisson regression model fits a count or the number of occurrences of an event or the rate of occurrence of an event (breadth response) as a function of some predictor variables (vaccination scheme, time). A generalized estimating equation is used to estimate the parameters of a Poisson regression with a possible unknown correlation between outcomes due to repeated measures. Spearman correlation was use to evaluate the association between SF162 ID50 and TZM-bl and A3R5 virus panel breadth score and KD. The statistical analyses were performed with either GraphPad Prism, Version 6.0f for Mac, or SAS V9.4 software packages.

Results

Rhesus macaques are vaccinated with DNA + protein coimmunization regimens

Quasispecies env sequences circulating during the early stages of the development of breadth in HIV-1 clade B infected human subjects VC10014 and VC20013 were selected for this study and are itemized in Table I. Extensive in vitro and in silico analyses preceded the selection of the Envs that were used in comparative studies in rabbits with multiple vaccine strategies (22). We found that quasispecies envs circulating during the early stages of the development of breadth in both VC10014 and VC20013 induced the strongest NAbs in rabbits against a panel of seven heterologous Tier 1A and 1B pseudoviruses from clades A, B, and C measured in the TZM-bl assay (22). These “Early Breadth” Envs also drove increased Env-specific affinity with repeated immunizations in rabbits that resulted in moderate neutralization breadth, but with little to no autologous neutralization (22). In this study, we immunized 12 adult rhesus macaques in two groups of six each at weeks 0, 4, 12, and 20 with the “Early Breadth” Envs from VC10014 and VC20013 and collected samples according to the timeline shown in Fig. 1. Each dose consisted of gene gun epidermal delivery of 36 μg plasmid gp160 DNA expressing two or more native envs concurrent with an i.m. delivery of 50 μg of at least one soluble gp140 trimeric protein formulated in adjuvant at each immunization time point.

Table I. Vaccine components and strategies.


Immunizations
Week 0 Week 4 Week 12 Week 20
Subject
DNA
Protein
DNA
Protein
DNA
Protein
DNA
Protein
VC10014 041504 G10a 041504 F8 041504 G10a 041504 F8 041504 G10a 041504 F8 041504 G10a 041504 F8
041504 G6a 101504 C6a 041504 G6a 101504 C6a 041504 G6a 101504 C6a 041504 G6a 101504 C6a
041504 F8 041504 F8 041504 F8 041504 F8
101504 C6a 101504 C6a 101504 C6a 101504 C6a
101504 E5a 101504 E5a 101504 E5a 101504 E5a
101504 H10 101504 H10 101504 H10 101504 H10
VC20013 092304 c1 092304 c1 092304 c1 092304 c1 092304 c15 030305 c5 092304 c5 092304 c5
092304 c13 092304 c13 030305 c5 092304 c19

Clade B HIV-1-infected subjects VC10014 and VC20013 are from the Tennessee/CFAR Cohort, Vanderbilt University School of Medicine A full description of the single-genome amplification, env cloning, and phylogeny of each subject was reported previously (22). Vaccine immunogens were delivered simultaneously at each immunization as gp160 DNA via gene gun epidermally and as gp140 protein as an i.m. injection. Dates are indicated as month, day, and year (e.g., 041504 is April 15, 2004).

FIGURE 1.

FIGURE 1.

Experimental vaccine regimen. Twelve adult male rhesus macaques were assigned to this study and divided into two groups of six for immunizations. Animals were coimmunized with HIV-1 env gp160 gene expression plasmids and soluble gp140 trimeric protein at weeks 0, 4, 12, and 20. At each immunization, 36 μg DNA was delivered epidermally by the PMED gene gun (PowderMed, Oxford, UK) and 50 μg recombinant Env gp140 protein formulated in 20% Adjuplex (Sigma) adjuvant was delivered i.m. Regular blood draws monitored immune responses in sera and PBMCs. Inguinal lymph node biopsies were performed at weeks 21 and 22 following the last immunization.

Native presentation of conserved Env epitopes recognized by bNAbs is a necessary characteristic of Env immunogens that can elicit neutralization breadth in a vaccine-induced response (38, 39). Using BLI, surface plasmon resonance, and ELISA, we previously showed that the soluble trimeric Env proteins used in this study as vaccines bind strongly to several potent bNmAbs that target conformational epitopes on the HIV-1 trimeric Env spike (22). The binding experiments also correlated well with neutralization of pseudoviruses expressing immunogens envs by neutralizing mAbs (NmAbs) (27). The gp140 Env trimer immunogens in these studies possess some but not all of the structural and antigenic components of native infectious virions. Therefore, we coimmunized animals with full-length gp160 DNA with the goal of providing natively expressed protein in vivo along with an i.m. delivery of soluble gp140 Env trimeric protein for additional priming of a T cell dependent type of B cell response to stimulate isotype switching and affinity maturation during Ab development. The individual roles of the native protein expressed by the DNA versus the trimeric protein boost in contributing to improved Ab responses in this set of experiments, however, were not parsed.

Macaque Abs target regions of Env associated with autologous and heterologous NAbs in human subjects

We have previously mapped bNAb activity of the human subject VC10014 to gp120 and the bNAb activity associated with VC20013 to the MPER of gp41 (27). Autologous anti-MPER NAbs were present during early infection (<1 y) and before heterologous neutralizing Abs (HNAbs) appeared in VC20013 (27). To assess targeting of the Env-specific binding Abs elicited in macaques, we performed a gp160 scanning peptide ELISA. We measured responses to linear epitopes contained in the clade B consensus Env peptides (15-mer with 11-aa overlap) in pooled macaque IgG from each vaccine group after the fourth DNA and protein immunization (at week 22). To compare the responses, we calculated and plotted the difference between the vaccine groups for each peptide (Fig. 2A, 2B). Although similar levels of binding Abs against gp140 Env protein immunogens were measured in both vaccine groups (Supplemental Fig. 1A), we detected differences in the recognition by macaque IgG in the peptide scan that implies regional targeting by the polyclonal response to Env. The VC10014 vaccines induced a strong trend toward increased binding to several regions of gp120 compared with the VC20013 vaccines (p = 0.0584; Fig. 2A). A comparison of responses directed against gp41 epitopes revealed that the overall gp41 responses and the MPER responses elicited by VC20013 immunogens in macaques were greater (p < 0.0001, p = 0.0022, respectively) than those elicited by VC10014 immunogens (Fig. 2B).

FIGURE 2.

FIGURE 2.

Consensus B gp160 peptide scan with macaque IgG. Pooled macaque IgG from each group after four immunizations (week 22) was used to assess responses to linear epitopes contained in the clade B consensus Env peptides (15-mer with 11 aa overlap). The difference between the groups for each peptide within (A) gp120 and (B) gp41 are plotted. Binding of individual macaque IgG samples from each group (C and D) is shown against the entire MPER region of gp41, contained within Peptides 159–170. Amino acid sequences of peptides 163–165 containing the epitope within MPER targeted by the mAb 2F5 and amino acid sequences of peptides 166–168 are shown to denote a critical site mutation in the MPER region of gp41 (27) associated with breadth developed in the VC20013 human subject. The entire gp160 spanning ELISA was performed once. Subsets were repeated; background of naive IgG was subtracted from data reported.

To determine whether the MPER recognition by VC20013-immunized macaques was associated with a single or multiple animals within the group, we compared binding of individual macaque IgG from both vaccine groups to overlapping peptides spanning the MPER region of gp41 (Fig. 2C, 2D). A subset, peptides 159–161, contain sequences from the immunodominant region of gp41 (40), and this region is fully conserved in all Env immunogen sequences for both VC10014 and VC20013. Half of the macaques (3 of 6) immunized with VC10014 Envs developed higher binding responses to this region of gp41 compared with responses in VC20013-vaccinated macaques (Fig. 2C, 2D), suggesting less epitope-focused targeting of MPER. Notably, the highly conserved 2F5 epitope sequence (also contained in all VC20013 and VC10014 Env immunogens) was recognized by only a single VC10014 macaque (25740; Fig. 2C). In contrast, IgG binding from the majority (4 of 6) of VC20013-vaccinated macaques was significantly greater to peptide 164 comprising the entire 2F5 epitope compared with VC10014 IgG (p = 0.0055; Fig. 2D). The clearly stronger response by VC20013 macaques to the linear epitopes associated with bNAbs targeting MPER is remarkable because neutralizing activity in the VC20013 human subject was measured against the whole MPER fragment very early in the course of infection and preceded breadth (27). Thus, the differences in binding patterns spanning the gp160 sequences suggest that the “Early Breadth” Envs cloned from the plasma of VC10014 and VC20013 and used as vaccines elicited responses in macaques that were directed to the same regions of Env associated with the development of autologous and heterologous breadth in the human subjects (27).

Macaques developed autologous and heterologous Env-specific binding Abs

We also monitored binding to heterologous SF162 gp140 Env and autologous Envs throughout the course of immunizations. At 2 wk after each immunization, we measured binding titers near or greater than 104 in the sera of every immunized macaque in both groups against cognate Envs (Supplemental Fig. 1A). A biweekly longitudinal monitoring revealed equal binding titers to heterologous SF162 gp140 with the greatest increase in binding seen following the second immunization. Using a mean of each vaccine group, the titers decreased ∼log10 between immunizations and returned to ∼104 within 1–2 wk following each boost (Supplemental Fig. 1B). Notably, at the final measurement, 4 wk following the fourth immunization, titers remained >104 in all macaques. There was no follow-up until 1 y after the final immunization. At that time, binding titers remained strong and had decreased only on the order of ∼1 log10 (Supplemental Fig. 1C).

Macaque IgG is evaluated for epitope-specific binding and competition neutralization

To define more specificity in Ab responses, we conducted binding and neutralizing experiments with macaque IgG using epitope-specific recombinant proteins. No significant difference in V1V2-directed Abs was seen between vaccine groups in binding or in competition neutralization assays with gp70 V1V2 recombinant protein (41) (Fig. 3A, 3C). As a probe for detecting CD4bs-specific Abs in macaque IgG, we used the resurfaced stabilized gp120 core (RSC3) and its CD4bs knockout variants, RSC/G367R (42, 43) and RSC3/Δ371I (44, 45). Macaques immunized with VC10014 Env immunogens raised stronger binding responses to all three of the RSC3 probes compared with VC20013 vaccines (RSC3, p = 0.0187; RSC3/G367R, p = 0.0203; and RSC3/Δ371I p = 0.0229; Fig. 3B). The stronger binding (and reduced IC50) of the polyclonal IgG raised in VC10014 macaques again suggests a more directed response to gp120 compared with the VC20013 macaque responses, and thus reflecting the regional targeting of the VC10014 human subject.

FIGURE 3.

FIGURE 3.

Epitope-specific binding and competition neutralization of macaque IgG. Individual macaque IgG samples purified from week 22 plasma after four immunizations were used in ELISA to assess binding to (A) gp70 V1V2 recombinant scaffold protein and (B) resurfaced gp120 recombinant core proteins RSC3, RSC3/G367R, and RSC3/Δ371I. Neutralization was assessed with each macaque week 22 IgG sample against HIV-1 SF162 pseudovirus and competed with (C) gp70 V1V2, (D) RSC3 and RSC3/Δ371I recombinant protein, (E) V3 peptide, and (F) MPER peptide. Percent change in neutralization (IC50) was calculated as: ([IC50 without competitor] − [IC50 with competitor]/[IC50 without competitor]) × 100. One representative experiment is shown of at least two performed.

Higher reactivity to the RSC3 and RSC3/G367R proteins can distinguish between CD4bs-specific bNmAbs and other CD4bs mAbs that display weak or no binding. RSC3/G367R is based on modeling of available crystal structures of HIV-1 Env to further improve the specificity of RSC3 for VRC01-like MAbs by abrogating or substantially reducing binding to NmAb b12 while maintaining VRC01 binding (45). It is interesting to note that although quasispecies isolates from human subject VC20013 were initially sensitive to CD4bs-specific bNmAb neutralization, including VRC01 and b12, there was no evidence of continued immune pressure to the CD4bs. Therefore, VC20013 did not develop a VRC01- or b12-like NAb response (27) and, comparatively, VC20013 vaccines induced overall lower gp120-directed binding Abs than VC10014 vaccines did (Figs. 2A, 3A, 3B, 3D). Moreover, ANAbs in the human subject VC10014 were found to target the C2 region of gp120, an area known to form parts of the CD4bs, but not the CD4bs specifically. Therefore, we were not necessarily expecting to see evidence of CD4bs-specific responses in either group. In fact, the IgG from both groups had the highest 50% binding titers to the RSC3/Δ371I mutant that is known to reduce binding of VRC01 substantially, implying that the major portion of the polyclonal macaque IgG does not contain VRC01-like Abs (Fig. 3B).

In assays measuring neutralization of HIV-1 SF162 by macaque IgG, we saw no difference in the inhibition of neutralization by RSC3 or RSC3/Δ371I gp120 core proteins between the vaccine groups. Neutralization by macaque IgG was competed only negligibly except in two VC10014 and one VC20013 macaque (Fig. 3D). This weak neutralization activity in the presence of the RSC3 gp120 protein suggests that the level of CD4-directed Abs in the macaque IgG was too low to mediate neutralization, and it is unlikely that the vaccine-elicited Abs were sufficiently affinity matured to mediate virus neutralization.

We also conducted TZM-bl neutralization assays with macaque IgG against SF162 in the presence of either MPER or V3 peptides. Results with a V3 peptide competitor (based on the SF162 isolate), indicate that the majority of the neutralization activity was directed to this region in both vaccine groups (Fig. 3E). Nonetheless, more VC20013 macaques developed binding Abs to the MPER (Fig. 2), and as a group developed more MPER NAbs, nearly reaching a significant increase over VC10014 macaques (p = 0.0563; Fig. 3F), indicating a difference in the targeting of the NAb activity between the vaccine groups. In the VC20013 subject, a unique mutation, K677N appeared at the time of initial neutralization breadth and became fixed in the quasispecies population. Early anti-MPER activity was a primary factor of both heterologous and autologous neutralizing activity in VC20013. However, the early appearance of the N677 escape mutation within MPER and its sustained presence was associated with cross-neutralizing activity and accounted for the eventual development of breadth (27). Notably, only a single VC20013 Env immunogen (030305_C5) that was delivered as both DNA and protein was a K677N mutant, and sera from VC20013 immunized macaques did not neutralize the N677K version of this clone (data not shown), suggesting a dependence on the change for neutralization in the macaques. All other VC20013 immunogens contained K677. Thus, the modest increase in MPER-directed NAbs in VC20013 macaques compared with VC10014 macaques may reflect the same early low-level MPER-directed NAbs in the human subject.

Macaques develop potent ANAbs

To evaluate the sensitivity of Env quasispecies in subjects VC10014 and VC20013 before the final selection and construction of Env immunogens, pseudoviruses based on the cloned envs were characterized for sensitivity to longitudinal autologous plasma and to a panel of bNmAbs (27). We reasoned that the antigenicity of the Env immunogens based on the sensitivity to bNmAbs was a good selection criterion. As has been observed with T/F and other HIV-1 Envs derived from early infection, the pseudotyped viruses based on VC10014 and VC20013 vaccine clones were either completely resistant or were poorly neutralized by contemporaneous autologous plasma at all times tested (27). However, the vaccine Envs showed variable and moderate sensitivity to a panel of six human NmAbs that are comparable to the IC50s of the same NmAbs characterized for neutralization of the recently published global panel of Tier 2 HIV-1 Env reference strains (46).

The first group of macaques was immunized with VC10014 DNA and protein from env clones appearing at times when breadth was first expanding (101504 [dates are indicated throughout as month, day, and year (e.g., 101504 is October 15, 2004).) and at the times immediately preceding it (041504; Table I (22, 27). We tested the neutralization sensitivity of pseudoviruses made from the matched DNA and protein immunogens from both vaccine groups in the TZM-bl assay. Macaque immune sera collected after the second immunization contained ANAbs against the earlier 041504_F8 Env that was more sensitive to bNmAbs as determined in our earlier study (27). However, ANAbs were not generated against the more resistant 101504_C6a clone (Fig. 4A). Serum neutralization of the 041504_F8 Env increased significantly with the third immunization (p = 0.0411), and increased significantly after all four immunizations (p = 0.0043). Yet, the fourth immunization did not improve ANAb responses to 041504_F8 compared with the responses following the third immunization, suggesting that three presentations may be sufficient to induce the maximum ANAb-eliciting response to this Env immunogen.

FIGURE 4.

FIGURE 4.

Autologous neutralization. Serum samples from VC10014 (A) and VC20013 (B) vaccinated macaques were tested for neutralization of pseudoviruses expressing cognate Env immunogens by TZM-bl assay. Neutralization data are shown as the serum dilution that neutralized 50% (ID50) of the virus being tested. The ID50 for each macaque serum sample collected 2 wk following the second, third, and fourth immunizations against each cognate Env is shown. Assays were performed twice with similar results.

VC20013 vaccines were also composed of Env sequences appearing during early HNAb development in the human subject (092304, 030305; Table I) and also within the first 2 y of the estimated time of infection (27). However, unlike VC10014, early appearing VC20013 quasispecies envs induced minimal ANAbs in the plasma until after the appearance of HNAbs at 0303005 (27). Therefore, we applied a different logic when selecting the variants for VC20013 immunogen construction. We knew from our earlier studies that a distinguishing feature of VC20013 envs at ∼1 y postinfection was that six of the envs isolated from 092304 and 030305 plasma showed moderate sensitivity to PG9/PG16 bNmAbs that target a glycopeptide epitope in the V2 region of gp120 (47), but later envs were resistant (27). Because the envs from the 092304 and 030305 time points were similar, we hypothesized that the variable sensitivity to neutralization via the PG9/PG16 epitope might be due to structural differences that could affect immunogenicity if constructed as immunogens (22). Therefore, we established two VC20013 “Early Breadth” vaccine strategies for initial comparative studies in rabbits. One strategy first presented the Envs more sensitive to PG9/PG16 followed by the more resistant Envs (“Early Breadth,” Sensitive to Resistant). The second “Early Breadth” Env group was presented in the opposite order and termed “Early Breadth,” Resistant to Sensitive. Based on the results of neutralization assessments in the rabbit studies (22), VC20013 macaques were immunized with the “Early Breadth,” Resistant to Sensitive strategy.

VC20013 vaccinated macaques developed ANAbs against the 030305_c5 Env and ∼1 log10 lower titers were induced against 092304_c5 Env, but ID50s were not achieved against the 092304_c1 Env (Fig. 4B) that was resistant to PG9/PG16 neutralization (27). Therefore, it is reasonable to speculate that the inability of the macaque Abs to neutralize 092304_c1 is consistent with the absence of neutralization seen in VC20013 human plasma (27) if 092304_c1-like Envs were dominant in the quasispecies at this early time. This pattern of ANAb activity reflects the lack of contemporaneous ANAbs in VC20013 and the subsequent development of ANAbs toward earlier Envs as described in other studies (4850), supporting the notion of a maturing NAb response.

In subject VC20013, the variants 030305_c5 and 092304_c15 (see Week 12 in Table I) that were neutralized by PG9/PG16 induced significant ANAb boosts in macaques after their initial presentation at the third immunization (p = 0.0009 and p = 0.0013; Fig. 4B). However, no improvement in ANAbs was achieved with a fourth immunization (p = 0.4788 and p = 0.719; Fig. 4B). It is unclear why the responses to these immunogens were not boosted, but it is clear that a fourth immunization did not increase ANAbs in macaques immunized with either VC20013 or VC10014 Envs.

Neutralization breadth is induced against heterologous Tier 1 and Tier 2 viruses

We assayed vaccinated macaque sera to characterize the HNAb responses elicited by VC10014 and VC20013 vaccines. To evaluate neutralization breadth against a variety of pseudoviruses representing different clades and tiers, we conducted assays in the TZM-bl (51) and A3R5 (52) assay formats. First, using the TZM-bl assay format, we measured HNAbs in the sera of vaccinated macaques against a panel of seven clade A, B, and C Tier 1A and 1B pseudoviruses, including the clade B Tier 2 virus, JRCSF (Fig. 5). As expected, the highest potency was detected against the Clade A, B, and C Tier 1A viruses. Notably, after three immunizations, 9 of 12 macaques developed HNAbs against all seven viruses in the TZM-bl assay panel (Fig. 5A). Clade C Tier 1B viruses ZM109 and ZM197 that appear in the LANL standard reference panel were not neutralized by plasma from the human subjects at times commensurate with our “Early Breadth” Env immunogens (22, 53) and were predictably not sensitive to macaque sera after three immunizations (data not shown). Similarly, VC10014 and VC20013 “Early Breadth” plasma did not neutralize Tier 2 clade A viruses Q259.d2 or Q461.e2 (27, 53). However, we included the sensitive Q461.e2 TAIV (Tier 1A), a mutated Env version of the Tier 2 Q461.e2, to test for neutralization against clade A viruses by vaccinated macaque sera.

FIGURE 5.

FIGURE 5.

Neutralization breadth in macaque sera. Macaque serum samples collected 2 wk after the third (A) and fourth (B) immunizations were tested for neutralization against a panel of seven heterologous clade A, B, and C viruses in the TZM-bl assay. (C) Sera from 2 wk following the fourth immunization were tested against a panel of nine clade B and C viruses in the A3R5 assay. Neutralization data are shown as the serum dilution that neutralized 50% of the viruses (ID50) tested. Neutralization breadth is expressed as percentage of pseudoviruses neutralized (number of neutralized isolates divided by the total number of viruses in the panel). Breadth scores that account for virus sensitivities were determined as described previously (76). Assays with most viruses in the panels were performed twice with similar results.

To further analyze the HNAb responses elicited in macaques by each set of vaccines, we calculated breadth scores that account for the sensitivities of each virus. The reported breadth score represents the number of viruses that a given serum sample neutralized at an ID50 that was higher than the median ID50 for that virus across all macaque serum samples (54). Using this method to assess the relative efficacy of the vaccines among all animals in each group, we found that after three immunizations two of six macaques in the VC20013 group achieved 100% breadth with a score of 7 and an average breadth score for the entire vaccine group of 4.7 (Fig. 5A). Although the average breadth score for the VC20013 group exceeded the score for the VC10014 group, they were not significantly different (p = 0.6998). The fourth immunization improved neutralization titers in the VC10014 group, although titers against JRCSF decreased in the VC20013 group. However, the final average breadth scores were equal between the two immunization groups (Fig. 5B). Importantly, the Tier 1 and 2 (JRCSF) breadth was comparable to the breadth seen in a longitudinal assessment of plasma samples of the human subjects from whom the Env immunogens were derived (22). Macaque IgG was used to further assess neutralization of Tier 2 viruses (JRFL, QH0692) that were previously reported to be neutralized by the VC10014 and VC20013 human plasma during early development of breadth (53), summarized in Table II. VC20013 vaccinated macaques raised stronger nAbs against QH0692 and JRFL compared with VC10014 vaccinated macaques, and this pattern is matched by the human subject plasma. Also, Tier 2 JRFL neutralization by VC20013 macaque IgG inversely correlates with a decreasing IC50 (μg/ml) against SF162 NAbs (p = 0.0111; Table II, Supplemental Fig. 3A) indicating a concomitant increase in potency against these two Tier 1 and Tier 2 viruses. However, the same correlation between SF162 IC50 and Tier 2 QH0692 did not reach significance (p = 0.0857; Table II, Supplemental Fig. 3B).

Table II. Comparison of neutralization of SF162 and Tier 2 viruses by macaque polyclonal IgG and plasma from human subjects, VC10014 and VC20013.

Viruses
SF162
JRFL
QH0692
YU2

Tier 1
Tier 2
Plasma Time Points Human Plasma ID50
VC10014 (1.19 EYa) >2560 165 350 430
VC20013 (1.80 EYa) >2560 940 935 620
Macaque ID IC50 Percent (%) Neutralizationa
VC10014 25740 8.5 (−) 40 16
26379 ND ND ND 20
26429 3.0 (−) 49 16
26433 5.3 (−) 40 17
23640 2.7 (−) 39 10
25257 2.6 (−) 43 ND
VC20013 23262 2.6 32 63 ND
24894 2.1 38 64 ND
25900 1.6 34 58 ND
27090 2.1 32 61 ND
27242 6.5 17 46 ND
26465 3.0 28 63 ND
a

Percent neutralization by macaque IgG at 1 mg/ml.

EY, time (y) since infection that the plasma sample was obtained and tested (53); IC50, concentration (mg/ml) that leads to 50% neutralization; ID50, plasma dilution that leads to 50% neutralization; ND, no data.

We then pursued an expanded panel of circulating Tier 2 strains of HIV-1, the majority of which were isolated from early infection (Fiebig stage <V) (5557). However, we note that in the A3R5 assay these viruses exhibit a more neutralization-sensitive Tier 1 phenotype with HIV-1 sera (D. Montefiori, manuscript in preparation). Apart from the caveats of the A3R5 assay, sera from vaccinated macaques after four immunizations neutralized all nine viruses tested with varying potencies (Fig. 5). Remarkably, all macaques in both vaccine groups neutralized four of the nine viruses; only REJO was resistant to the Abs elicited by most macaques (Fig. 5C). We measured breadth scores in the same manner as noted above, and found that three macaques in each vaccine group exceeded 50% neutralization breadth. Moreover, the NAbs measured here in vaccinated macaques are higher than nAb responses in immune sera from human clinical trials using Env immunogens. In the Vax003 trial, neutralization of Tier 2 viruses using the A3R5 assay was infrequent and weak and no Tier 2 neutralization with this assay was seen in the RV144 trial (52).

Macaque sera collected 2 wk following each of the four immunizations were used in TZM-bl neutralization assays to initially assess potency against SF162 (Tier 1A) throughout the study. Macaques rapidly developed NAbs against SF162 that increased in potency following subsequent immunizations (Fig. 6A). As a means to track whether the sensitive Tier 1A SF162 neutralization titers were reflective of other viruses, we compared the breadth scores from both the TZM-bl (omitting SF162) and A3R5 assays. We saw a clear association of the breadth scores derived from both assay types using different panels of viruses (Fig. 6B). Moreover, we found a strong correlation between higher SF162 ID50 values and the breadth scores from both assays (Fig. 6C, 6D). Because the breadth scores in both assay formats are calculated on the sensitivities of the viruses within each panel, this suggests that the strength of the macaque responses is consistent using either protocol. More interesting is the correlation of the Tier 2 autologous neutralization titers with SF162 NAbs (Fig. 6E) and with the TZM-bl breadth scores (Fig. 6F). This result differs with recent findings that Tier 1 and Tier 2 titers induced in rabbits immunized with native-like trimers were not correlative (58).

FIGURE 6.

FIGURE 6.

Longitudinal SF162 neutralization and correlations with autologous NAbs and breadth. (A) Sera from macaques were assessed for neutralization of HIV-1 SF162 from biweekly blood sampling over the course of the study. Data shown are from one experiment for each time point. (B) The correlation between A3R5 and TZM-bl assay breadth scores. (C and D) The correlation between TZM-bl and A3R5 breadth scores and serum 50% neutralization titers against HIV-1 SF162 (omitting SF162), respectively. (E) The correlation of ID50 of macaque sera against Tier 1 SF162 and Tier 2 autologous viruses. (F) TZMbl breadth scores correlate with macaque serum neutralization of Tier 2 autologous viruses. ID50 of VC10014 immunogen 041504_F8 and VC20013 immunogen 030305_C5 are used for correlations. Statistics: Mann–Whitney and Spearman correlation.

An overall comparison of 50% HNAb titers measured in macaque sera 2 wk following the second, third, and fourth immunization in each vaccine group, revealed significant increases in HNAbs induced by the third immunization in both groups against most of the viruses tested. In contrast, no significant increase in HNAb development was induced with the fourth immunization against any of the viruses tested (Supplemental Fig. 2A, 2B). This trend again implies that a shorter immunization regimen with optimal Env selection may be as effective as an extended protocol. However, even with the extended protocol of four immunizations, no neutralizing activity was detected against a global panel of Tier 2 HIV-1 Env-pseudotyped reference strains (46) in the TZM-bl assay (data not shown).

We also evaluated the longevity of the elicited NAb responses in ten of the vaccinated macaques 1 y following the fourth immunization against the Tier 1 clade B virus SF162 and Tier 1 clade C MW965. Two macaques (one from each group) were euthanized for reasons unrelated to this study. The titers of the remaining five animals from each group were 1 log10 lower from the highest titers measured after the third or fourth immunization (Supplemental Fig. 2C, 2D). This result is in line with the residual binding titers reported above (Supplemental Fig. 1C) and demonstrates the presence of long-lived HIV-1 specific B cells circulating in the blood of macaques 1 y after vaccination.

Macaque polyclonal IgG shows maturing affinity and correlates with NAbs

The “Early Breadth” immunogens from VC10014 and VC20013 used here were shown to increase apparent affinity in the polyclonal responses of immunized rabbits (22). Similarly, we examined the binding kinetics of macaque polyclonal IgG purified from immune sera to SF162 gp140 trimeric protein to evaluate differences in avidity effects using BLI assayed on the Octet-Red platform. An equilibrium dissociation constant (KD) was calculated for each sample to track the change in average affinity of the macaque IgG samples after two, three, and four immunizations from each vaccine group (Supplemental Table I). We found that the average affinity for HIV-1 SF162 Env increased significantly (reduction in KD) in both groups over the course of the immunizations (VC10014, p = 0.0087; VC20013, p = 0.0010; Fig. 7A), suggesting that both vaccine strategies using “Early Breadth” Envs from different donors led to strong avidity with evidence of emerging affinity maturation. At the end of the immunizations, the KDs of both groups were comparable (p = 0.1640). Affinities were also similar after the second (p = 0.4604) and third (p = 0.9039) immunizations. However, some differences can be noted between groups. For example, a stronger increase in affinity in the IgG from the VC20013 group was induced by the third immunization (p = 0.0021), compared with the VC10014 group (p = 0.0766); the effect of the fourth immunization by VC10014 vaccines was significantly stronger (p = 0.0461) compared with the effect of a fourth VC20013 vaccine (p = 0.9276) (Fig. 7A). Notwithstanding our earlier observations of no significant improvements gained by the fourth immunization with VC10014 vaccines in ANAbs (Fig. 4A), HNAbs (Fig. 5, Supplemental Fig. 2), or binding Abs (Supplemental Fig. 1), the continued increase in apparent affinity justifies the extended immunization regimen in this group.

FIGURE 7.

FIGURE 7.

Affinity maturation of the polyclonal macaque IgG and correlation with NAbs. (A) BLI binding assays were performed on the Octet-Red (FortéBio, Menlo Park, CA) to determine the binding kinetics of macaque IgG to HIV-1 SF162 gp140 trimeric protein over the course of the immunizations. Polyclonal IgG samples were purified from sera collected 2 wk following each immunization. The p values shown denote results of statistical analyses within and between groups to demonstrate the increase in affinity over the course of immunizations. Data are reported as KD values (nM). Increasing affinity corresponds to decreasing KD. (B) Data shown are the inverse correlation between SF162 NAbs and KD after four immunizations in both vaccine groups. (Statistics: Repeated measures ANOVA and Spearman correlation.) Data shown are from one experiment with two replicates of each sample.

We also evaluated the KDs associated with the elicited polyclonal IgG response in both groups of vaccinated macaques over the course of this study to look for a correlation with increasing affinity and the development of neutralization strength in sera. We found a clear association between increased affinity of the polyclonal IgG and increasing serum-neutralizing titers against SF162 (p = 0.0428; Fig. 7B) indicating that the average affinity of the Ab increased concomitantly with increasing NAbs.

For comparison, we purified IgG from VC10014 and VC20013 human subjects at five different time points during infection, including time points concurrent with the vaccine envs used to immunize macaques. We measured the binding kinetics of the human IgG derived from each of the time points against each of the respective soluble gp140 trimeric Env immunogens (Table III). We also measured the affinity of the human IgG and compared those KDs to the KDs of the macaque IgG for SF162 gp140 trimeric protein. Clade B breadth was reported as 64% in plasma samples from VC10014 at 101504 (22), less than 2 y following the estimated time of infection (27). At this timepoint, the KD of the human polyclonal Ig response was 14.42 nM (Table III), comparable to the average KD of 8.07 nM of all six VC10014 immunized macaques after four immunizations and 17.70 nM after three immunizations (Supplemental Table I). Similarly, for VC20013, clade B breadth was 64% at 030305, ∼1 y following infection (22), and purified human IgG from that time point produced a KD of 13.20 nM (Table III). The average KD from VC20013 vaccinated macaques was 20.03 nM after four immunizations and 22.60 nM after three immunizations (Supplemental Table I). Thus, the vaccine regimens using selected Env immunogens in this study generated Abs with binding affinities closely similar to naturally induced polyclonal responses during infection.

Table III. Longitudinal binding affinities of polyclonal IgG from human subjects VC10014 and VC20013 to Env immunogens and HIV-1 SF162.


Human Subject VC10014 IgG Samples
092603 041504 101504 111006 102208
Plasma Time Points KD (nM)
gp140 Envs
 041504 F8 3362.13 12.73 8.44 6.11 5.69
 101504 C6a 20.16 29.95 4.35 9.19 0.09
 SF162 4.85 53.21 14.42 19.53 5.77
Human Subject VC20013 IgG Samples
090204
092304
030305
041206
101506
Plasma Time Points
KD (nM)
gp140 Envs
 092304 C1 22.83 37.71 14.14 5.52 3.13
 092304 C5 89.04 12.96 14.57 18.34 1.97
 030305 C5 17.75 27.53 7.46 4.07 11.93
 SF162 34.20 15.46 13.20 4.84 23.20

Polyclonal IgG was purified from plasma samples collected on the dates shown. gp140 Envs used as protein immunogens for each subject are shown. KD data were generated by BLI (Octet Red; FortéBio, Menlo Park, CA). Dates are indicated as month, day, and year (e.g., 092603 is September 26, 2003).

Env-specific responses are detected in TFH cells in lymphoid tissue

Activation of TFH cells in lymphoid tissues of HIV-1 Env–based vaccination has not been reported, but may be an important marker for eliciting a protective bNAb response. In this study, coimmunization with DNA and protein vaccines induced in macaques produced measurable vaccine-specific TFH responses in lymphocytes isolated from inguinal lymph nodes (Fig. 8). The expression of CXCR5, PD-1, IL-21, and ICOS are some of the distinguishing characteristics of TFH cells (59). In this study, we quantified subsets of memory CD4+ T cells that are characterized by expression of the TFH cell marker PD-1. Studies examining chronic SIV infection in macaques (6062) and HIV infection (63, 64) have used different methods to identify TFH populations. Because this study pioneers the examination of TFH cells in the lymph nodes of vaccinated macaques, we have chosen to report two of the most commonly used sets of markers. Thus, we identified TFH cells as CXCR5+PD-1hi and as ICOS+PD-1hi CD4+ T cells. We identified these populations as being those CD4+ T cells that most closely resemble previously described and characterized germinal center (GC) TFH cells among resting memory CD4+ T cells in terms of B cell help functionality and transcriptional signature (64). We were able to measure functional TFH cells within the lymphocyte populations of all six macaques immunized with the VC10014 DNA and protein immunogens (Fig. 8C). Surprisingly, of the five VC20013 macaques from which we were able to test for TFH cells, only two developed these responses to all three Env immunogens (24894, 25900; (Fig. 8D). Nonetheless, we found a firm correlation between activation of TFH and neutralization of Tier 2 autologous viruses (p = 0.0386; Fig. 8E). Overall, the levels of functional Env-specific TFH cells were low, measured at <0.6% of the total lymphocyte population, but were still comparable to frequencies of the same subpopulations found in lymphoid tissues of chronically SIV-infected macaques (Fig. 8F). Nonetheless, detection of even a modest activation of this specialized CD4+ T memory cell subpopulation after vaccination is notable and adds a novel metric for measuring the successes of Env-based vaccine design.

FIGURE 8.

FIGURE 8.

Frequencies of cognate Env-specific TFH cells in inguinal lymph nodes of vaccinated macaques. Gating strategy and representative flow plots of T lymphocytes isolated from lymph nodes of macaques after four immunizations are shown. TFH cell subpopulations are defined as (A) and CD3+CD4+CXCR5+PD-1hi and (B) CD3+CD4+ICOS+PD-1hi. (C) Percentage of functional CD4+TFH cells stimulated by vaccine immunogens from VC10014 and (D) VC20013. (E) Correlation between TFH activation and Tier 2 autologous neutralization. (F) Frequencies of TFH cell populations measured in three types of lymphoid tissue (axillary, inguinal, and mesenteric lymph nodes) from a chronically SIV infected rhesus macaque (20845). PMA/Ionomycin and No Stim populations were used as positive and negative controls, respectively. Experiments were repeated at least twice.

Discussion

In HIV-infected subjects, the development of ANAbs against the T/F virus is the first measure of neutralization, followed by enhancement of this response and broadening that in some subjects precedes the development of bNAbs (48). On the basis of studies of bNmAbs, we recognize that NAbs against HIV-1 are known to develop through somatic hypermutation during chronic infection (65, 66). It is unknown whether a vaccine can promote adequate affinity maturation during the course of an immunization regimen to elicit protective Abs, primarily because it is not known to what extent germline B cell receptors (BCRs) influence affinity maturation and selection of B cells giving rise to bNAbs in GCs. Recent studies suggest these events may be rare (67), and only a few Env mutations confer high affinity germline binding which may indicate the stochastic nature of these mutations occurring during chronic infection (67, 68). Nonetheless, all subjects who seroconvert develop ANAbs, despite exposure to Envs from T/F that are rarely identical among subjects. Therefore, identification of HIV-1 Env variants that contain sequence and structural determinants that can shortcut a pathway to ANAb and, ideally, bNAb development may be a logical approach for vaccine candidate selection.

We reasoned that subjects who develop breadth relatively early in infection would have good candidate Envs with which to address this question. In this study, we focused on Envs that were cloned from two subjects enrolled in the Tennessee CFAR cohort who developed moderate levels of bNAbs about 1 y postinfection through the mechanism of acquiring a single epitope target within 1 y postinfection (27, 53). The source of bNAb activity in VC20013 was mapped to MPER, and VC10014 breadth was associated with an epitope overlapping the CD4bs on gp120 (27). Indeed, it was the similarity between the subjects in achieving cross-clade bNAb development within 2 y of infection that was of initial interest to us. Of further interest was the striking increase in plasma IgG affinity maturation for the autologous Envs that coincided with the initial broadening of the plasma neutralizing activity between the first and second years of infection (27). Taken together, the dissimilar epitope targeting, yet commonality in the mechanism which began with the acquisition of a few critical epitopes in VC10014 and VC20013 quasispecies in the early stages of infection, followed by Ab maturation that led to moderate breadth, provided a unique source of Env immunogens with which to test our hypothesis.

Our challenge for the last several years has been the winnowing down of the large number of Envs cloned from these subjects to identify only the most promising immunogens.

Thus, we used multiple groups of rabbits to initially gauge candidate immunogens and strategies for NAb induction from the collections of Envs cloned from all phases of infection in both subjects. We cannot rule out that additional envs from either of these or other subjects might be as or more immunogenic. In this study, when performed in macaques, vaccine strategies delivering the “Early Breadth” sequences from both VC10014 and VC20013 elicited Abs that neutralized cognate Envs and reflected the same pattern of ANAb development as seen in the human subjects. This improvement from the rabbit studies may reflect the closer VH gene usage to humans by NHP and adds validation to the model as more relevant for HIV-1 vaccination. Broad and potent neutralization by macaque sera was measured against several Tier 1A and 1B viruses and moderate neutralization of the Tier 2 virus, JRCSF, in TZM-bl cells. Macaque polyclonal IgG showed a broader range of neutralization activity with Tier 2 isolates moderately neutralized by the respective patient sera. Neutralization was also measured in A3R5 cells against viruses that were categorized as early Fiebig stage isolates (i.e., envs circulating within the first 30 d of infection and prior to seroconversion) (69) and is reported, although these circulating strains of HIV-1 show a Tier 1 phenotype in these cells. In our view, data from the A3R5 assay provide another comparative evaluation tool of the Ab responses elicited in vaccinated macaques. The neutralization breadth generated by these vaccines is as potent and comparable to that reported in a recent Env-based vaccine study using similar virus panels (13) and notably more potent than others (15, 21, 70), including the immunogenicity results of the studies using native-like trimers (58, 71). Importantly, this study is unique because we show that the Env-specific vaccine-induced macaque polyclonal IgG was biased toward the same regions of Env mapped to NAb breadth in human subject plasma verified in our earlier studies. Moreover, the macaque responses matured in affinity for HIV-1 Env over the course of the immunizations comparable to the measured affinity of the human subjects. This maturing affinity correlated with NAbs generated in macaques.

Aberrant B cell responses and B cell dysfunction occurring in peripheral blood and lymphoid tissues are hallmarks of HIV-1 infection, often attributed to the loss of CD4+ T cells. Closer examination in recent studies has suggested that CD4+ T follicular helper (TFH) cells may provide a key to understanding and improving the B cell responses (59, 64, 72, 73). Although expansion and loss of TFH cell populations vary in HIV-1 infected individuals, TFH cells interact with B cells in GCs and drive the differentiation and maturation of B cells. Total TFH and HIV-specific TFH cell populations in chronic HIV-1 infection in the presence of high viremia are known to contribute to B cell dysregulation and hypersecretion of IgG (74). A better understanding of the mechanisms associated with development of TFH memory cells in the setting of vaccination is an emerging area of interest in the field. In this study, we report vaccine induction of cellular immunity in macaques by measuring the frequency of Env-specific TFH cells in inguinal lymph nodes specific for cognate Envs derived from human subjects that were associated with NAb development. Unique to this study is the correlation of Env-specific TFH cell activation in lymphocytes of vaccinated macaques with Tier 2 autologous neutralization (Fig. 8E). The concomitant development of TFH cellular responses and NAbs reveals that both arms of the immune system can be activated by these Env-based HIV-1 immunogens. We are encouraged by the measurable activation of TFH cells isolated from macaque draining lymph nodes and believe that it strongly indicates that the fundamental immunologic basis for somatic hypermutation was established by these immunization strategies. We compared the detection of TFH cell activation in our vaccinated animals to those of a chronically SIV-infected macaque and found that the responses are on the same order of magnitude. To our knowledge, this is the first reported identification in vaccinated rhesus macaques of Env-specific TFH responses that developed during the emergence of binding and nAbs. Even the modest activation of TFH cells that we measured in macaques vaccinated with the “Early Breadth” clones in this study represents an advance in Env-based HIV-1 design efforts as it provides a new measure of immunogenicity. To address continued affinity maturation of the elicited Ab response, additional studies that further optimize native Env selection combined with a mechanism to deliver a persistent production of viral Env glycoprotein (75) are warranted.

In summary, our results provide evidence that strategically selected native envs circulating in HIV-1–infected individuals during the early phases of breadth should be considered as a source for vaccine components capable of generating Ab responses with the potential of neutralizing T/F viruses and inducing cross-clade breadth. From all cloned envs, the common thread among the best immunogens were those down-selected at prepeak NAb breadth time points during the first 2 y of infection in the human subjects. The Abs generated here were complemented with the evidence of a maturing affinity and activation of TFH memory cells, unique successes for Env-based vaccine design. Comparable HNAbs and ANAbs developed in both groups of macaques although the number of Env immunogens used and the vaccine strategies were different. However, the most remarkable outcome is that the Abs induced in vaccinated macaques mirrored the epitope targeting by ANAbs developed in the human subjects within the first year of infection, resulting in similar NAb profiles. Because NAbs can develop in numerous ways that depend on unique viral and host coevolution kinetics, analysis of native envs at critical times during the development of breadth should be considered a new immunogen design criterion. Structural studies for candidate Env immunogens are also warranted, as they might lead to enhanced immunogen design. Another way forward will be an in-depth examination of the Ab structures and sequences elicited in macaques vaccinated with these and similarly derived Env immunogens.

Supplementary Material

Data Supplement
JI_1500527.zip (225KB, zip)

Acknowledgments

We thank Philip Barnette for excellent technical support. We also thank the Oregon National Primate Research Center veterinary and surgery staff for their assistance with vaccine protocols. The following reagents were obtained through the NIH AIDS Research and Reference Reagent Program: RSC3, #12042, RSC3 d371/P363 #12362, RSC3 G367R #12363, RSC3Δ37I #12362, V3 peptide, #1830, HIV-1 Consensus Subtype B Env peptide set, #9480, TZM-bl cells, #8129, mAb IgG1 b12, #2640, mAb 10E8, #12294, mAb 447-52D, #4030, mAb 4E10, #10091, mAb PG9, #1149, mAb PG16, #12150, mAb 2G12, #1476, mAb VRC01, #12033.

This work was supported by National Institutes of Health Grant P01AI078064, Oregon National Primate Research Center Grants P51 OD001092 and U42, and National Institute of Allergy and Infectious Diseases Contract HHSN27201100016C (to D.C. Montefiori).

The online version of this article contains supplemental material.

Abbreviations used in this article:
ANAb
autologous neutralizing Ab
BLI
biolayer interferometry
bNAb
broadly neutralizing Ab
bNmAb
broadly neutralizing mAb
CD4bs
CD4 binding site
CFAR
Center for AIDS Research
Env
envelope
env
envelope gene sequence
GC
germinal center
HNAb
heterologous neutralizing Ab
MPER
membrane proximal external region
NAb
neutralizing Ab
NHP
nonhuman primate; NIH, National Institutes of Health
NmAb
neutralizing mAb
PMED
particle-mediated epidermal delivery
SHIV
chimeric simian/HIV
T/F
transmitted/founder
TFH
follicular helper CD4 T cell.

Disclosures

The authors have no financial conflicts of interest.

References

  • 1.Rerks-Ngarm S., Pitisuttithum P., Nitayaphan S., Kaewkungwal J., Chiu J., Paris R., Premsri N., Namwat C., de Souza M., Adams E., et al. MOPH-TAVEG Investigators 2009. Vaccination with ALVAC and AIDSVAX to prevent HIV-1 infection in Thailand. N. Engl. J. Med. 361: 2209–2220. [DOI] [PubMed] [Google Scholar]
  • 2.Hessell A. J., Poignard P., Hunter M., Hangartner L., Tehrani D. M., Bleeker W. K., Parren P. W., Marx P. A., Burton D. R. 2009. Effective, low-titer antibody protection against low-dose repeated mucosal SHIV challenge in macaques. Nat. Med. 15: 951–954. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Mascola J. R., Lewis M. G., Stiegler G., Harris D., VanCott T. C., Hayes D., Louder M. K., Brown C. R., Sapan C. V., Frankel S. S., et al. 1999. Protection of Macaques against pathogenic simian/human immunodeficiency virus 89.6PD by passive transfer of neutralizing antibodies. J. Virol. 73: 4009–4018. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Moldt B., Rakasz E. G., Schultz N., Chan-Hui P. Y., Swiderek K., Weisgrau K. L., Piaskowski S. M., Bergman Z., Watkins D. I., Poignard P., Burton D. R. 2012. Highly potent HIV-specific antibody neutralization in vitro translates into effective protection against mucosal SHIV challenge in vivo. Proc. Natl. Acad. Sci. USA 109: 18921–18925. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Parren P. W., Marx P. A., Hessell A. J., Luckay A., Harouse J., Cheng-Mayer C., Moore J. P., Burton D. R. 2001. Antibody protects macaques against vaginal challenge with a pathogenic R5 simian/human immunodeficiency virus at serum levels giving complete neutralization in vitro. J. Virol. 75: 8340–8347. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Ng C. T., Jaworski J. P., Jayaraman P., Sutton W. F., Delio P., Kuller L., Anderson D., Landucci G., Richardson B. A., Burton D. R., et al. 2010. Passive neutralizing antibody controls SHIV viremia and enhances B cell responses in infant macaques. Nat. Med. 16: 1117–1119. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Nishimura Y., Igarashi T., Haigwood N. L., Sadjadpour R., Donau O. K., Buckler C., Plishka R. J., Buckler-White A., Martin M. A. 2003. Transfer of neutralizing IgG to macaques 6 h but not 24 h after SHIV infection confers sterilizing protection: implications for HIV-1 vaccine development. Proc. Natl. Acad. Sci. USA 100: 15131–15136. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Barouch D. H., Whitney J. B., Moldt B., Klein F., Oliveira T. Y., Liu J., Stephenson K. E., Chang H. W., Shekhar K., Gupta S., et al. 2013. Therapeutic efficacy of potent neutralizing HIV-1-specific monoclonal antibodies in SHIV-infected rhesus monkeys. Nature 503: 224–228. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Shingai M., Nishimura Y., Klein F., Mouquet H., Donau O. K., Plishka R., Buckler-White A., Seaman M., Piatak M., Jr., Lifson J. D., et al. 2013. Antibody-mediated immunotherapy of macaques chronically infected with SHIV suppresses viraemia. Nature 503: 277–280. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Klein F., Halper-Stromberg A., Horwitz J. A., Gruell H., Scheid J. F., Bournazos S., Mouquet H., Spatz L. A., Diskin R., Abadir A., et al. 2012. HIV therapy by a combination of broadly neutralizing antibodies in humanized mice. Nature 492: 118–122. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Halper-Stromberg A., Lu C. L., Klein F., Horwitz J. A., Bournazos S., Nogueira L., Eisenreich T. R., Liu C., Gazumyan A., Schaefer U., et al. 2014. Broadly neutralizing antibodies and viral inducers decrease rebound from HIV-1 latent reservoirs in humanized mice. Cell 158: 989–999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Doria-Rose N. A., Learn G. H., Rodrigo A. G., Nickle D. C., Li F., Mahalanabis M., Hensel M. T., McLaughlin S., Edmonson P. F., Montefiori D., et al. 2005. Human immunodeficiency virus type 1 subtype B ancestral envelope protein is functional and elicits neutralizing antibodies in rabbits similar to those elicited by a circulating subtype B envelope. J. Virol. 79: 11214–11224. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Chakrabarti B. K., Feng Y., Sharma S. K., McKee K., Karlsson Hedestam G. B., Labranche C. C., Montefiori D. C., Mascola J. R., Wyatt R. T. 2013. Robust neutralizing antibodies elicited by HIV-1 JRFL envelope glycoprotein trimers in nonhuman primates. J. Virol. 87: 13239–13251. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Dey A. K., David K. B., Lu M., Moore J. P. 2009. Biochemical and biophysical comparison of cleaved and uncleaved soluble, trimeric HIV-1 envelope glycoproteins. Virology 385: 275–281. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Sundling C., Forsell M. N., O’Dell S., Feng Y., Chakrabarti B., Rao S. S., Loré K., Mascola J. R., Wyatt R. T., Douagi I., Karlsson Hedestam G. B. 2010. Soluble HIV-1 Env trimers in adjuvant elicit potent and diverse functional B cell responses in primates. J. Exp. Med. 207: 2003–2017. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Blish C. A., Sather D. N., Sellhorn G., Stamatatos L., Sun Y., Srivastava I., Barnett S. W., Cleveland B., Overbaugh J., Hu S. L. 2010. Comparative immunogenicity of subtype a Human Immunodeficiency Virus type 1 envelope exhibiting differential exposure of conserved neutralization epitopes. J. Virol. 84: 2573–2584. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Guenaga J., Dosenovic P., Ofek G., Baker D., Schief W. R., Kwong P. D., Karlsson Hedestam G. B., Wyatt R. T. 2011. Heterologous epitope-scaffold prime:boosting immuno-focuses B cell responses to the HIV-1 gp41 2F5 neutralization determinant. PLoS One 6: e16074. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Bomsel M., Tudor D., Drillet A. S., Alfsen A., Ganor Y., Roger M. G., Mouz N., Amacker M., Chalifour A., Diomede L., et al. 2011. Immunization with HIV-1 gp41 subunit virosomes induces mucosal antibodies protecting nonhuman primates against vaginal SHIV challenges. Immunity 34: 269–280. [DOI] [PubMed] [Google Scholar]
  • 19.Seaman M. S., Xu L., Beaudry K., Martin K. L., Beddall M. H., Miura A., Sambor A., Chakrabarti B. K., Huang Y., Bailer R., et al. 2005. Multiclade human immunodeficiency virus type 1 envelope immunogens elicit broad cellular and humoral immunity in rhesus monkeys. J. Virol. 79: 2956–2963. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Du S. X., Xu L., Zhang W., Tang S., Boenig R. I., Chen H., Mariano E. B., Zwick M. B., Parren P. W., Burton D. R., et al. 2011. A directed molecular evolution approach to improved immunogenicity of the HIV-1 envelope glycoprotein. PLoS One 6: e20927. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Barouch D. H., Stephenson K. E., Borducchi E. N., Smith K., Stanley K., McNally A. G., Liu J., Abbink P., Maxfield L. F., Seaman M. S., et al. 2013. Protective efficacy of a global HIV-1 mosaic vaccine against heterologous SHIV challenges in rhesus monkeys. Cell 155: 531–539. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Malherbe D. C., Pissani F., Sather D. N., Guo B., Pandey S., Sutton W. F., Stuart A. B., Robins H., Park B., Krebs S. J., et al. 2014. Envelope variants circulating as initial neutralization breadth developed in two HIV-infected subjects stimulate multiclade neutralizing antibodies in rabbits. J. Virol. 88: 12949–12967. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Li J., Valentin A., Kulkarni V., Rosati M., Beach R. K., Alicea C., Hannaman D., Reed S. G., Felber B. K., Pavlakis G. N. 2013. HIV/SIV DNA vaccine combined with protein in a co-immunization protocol elicits highest humoral responses to envelope in mice and macaques. Vaccine 31: 3747–3755. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Jalah R., Kulkarni V., Patel V., Rosati M., Alicea C., Bear J., Yu L., Guan Y., Shen X., Tomaras G. D., et al. 2014. DNA and protein co-immunization improves the magnitude and longevity of humoral immune responses in macaques. PLoS One 9: e91550. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Patel V., Jalah R., Kulkarni V., Valentin A., Rosati M., Alicea C., von Gegerfelt A., Huang W., Guan Y., Keele B. F., et al. 2013. DNA and virus particle vaccination protects against acquisition and confers control of viremia upon heterologous simian immunodeficiency virus challenge. Proc. Natl. Acad. Sci. USA 110: 2975–2980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Asmal M., Luedemann C., Lavine C. L., Mach L. V., Balachandran H., Brinkley C., Denny T. N., Lewis M. G., Anderson H., Pal R., et al. 2015. Infection of monkeys by simian-human immunodeficiency viruses with transmitted/founder clade C HIV-1 envelopes. Virology 475: 37–45. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Sather D. N., Carbonetti S., Malherbe D. C., Pissani F., Stuart A. B., Hessell A. J., Gray M. D., Mikell I., Kalams S. A., Haigwood N. L., Stamatatos L. 2014. Emergence of broadly neutralizing antibodies and viral coevolution in two subjects during the early stages of infection with human immunodeficiency virus type 1. J. Virol. 88: 12968–12981. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Malherbe D. C., Doria-Rose N. A., Misher L., Beckett T., Puryear W. B., Schuman J. T., Kraft Z., O’Malley J., Mori M., Srivastava I., et al. 2011. Sequential immunization with a subtype B HIV-1 envelope quasispecies partially mimics the in vivo development of neutralizing antibodies. J. Virol. 85: 5262–5274. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Srivastava I. K., VanDorsten K., Vojtech L., Barnett S. W., Stamatatos L. 2003. Changes in the immunogenic properties of soluble gp140 human immunodeficiency virus envelope constructs upon partial deletion of the second hypervariable region. J. Virol. 77: 2310–2320. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Sellhorn G., Caldwell Z., Mineart C., Stamatatos L. 2009. Improving the expression of recombinant soluble HIV Envelope glycoproteins using pseudo-stable transient transfection. Vaccine 28: 430–436. [DOI] [PubMed] [Google Scholar]
  • 31.Blay W. M., Kasprzyk T., Misher L., Richardson B. A., Haigwood N. L. 2007. Mutations in envelope gp120 can impact proteolytic processing of the gp160 precursor and thereby affect neutralization sensitivity of human immunodeficiency virus type 1 pseudoviruses. J. Virol. 81: 13037–13049. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Zolla-Pazner S., deCamp A. C., Cardozo T., Karasavvas N., Gottardo R., Williams C., Morris D. E., Tomaras G., Rao M., Billings E., et al. 2013. Analysis of V2 antibody responses induced in vaccinees in the ALVAC/AIDSVAX HIV-1 vaccine efficacy trial. PLoS One 8: e53629. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Wei X., Decker J. M., Wang S., Hui H., Kappes J. C., Wu X., Salazar-Gonzalez J. F., Salazar M. G., Kilby J. M., Saag M. S., et al. 2003. Antibody neutralization and escape by HIV-1. Nature 422: 307–312. [DOI] [PubMed] [Google Scholar]
  • 34.Montefiori D. C. 2009. Measuring HIV neutralization in a luciferase reporter gene assay. Methods Mol. Biol. 485: 395–405. [DOI] [PubMed] [Google Scholar]
  • 35.Sarzotti-Kelsoe M., Daniell X., Todd C. A., Bilska M., Martelli A., LaBranche C., Perez L. G., Ochsenbauer C., Kappes J. C., Rountree W., et al. 2014. Optimization and validation of a neutralizing antibody assay for HIV-1 in A3R5 cells. J. Immunol. Methods 409: 147–160. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Derby N. R., Kraft Z., Kan E., Crooks E. T., Barnett S. W., Srivastava I. K., Binley J. M., Stamatatos L. 2006. Antibody responses elicited in macaques immunized with human immunodeficiency virus type 1 (HIV-1) SF162-derived gp140 envelope immunogens: comparison with those elicited during homologous simian/human immunodeficiency virus SHIVSF162P4 and heterologous HIV-1 infection. J. Virol. 80: 8745–8762. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Krebs S. J., McBurney S. P., Kovarik D. N., Waddell C. D., Jaworski J. P., Sutton W. F., Gomes M. M., Trovato M., Waagmeester G., Barnett S. J., et al. 2014. Multimeric scaffolds displaying the HIV-1 envelope MPER induce MPER-specific antibodies and cross-neutralizing antibodies when co-immunized with gp160 DNA. [Published erratum appears in 2015 PLoS One. DOI: 10.1371/journal.pone.0120027]. PLoS One 9: e113463. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Sanders R. W., Derking R., Cupo A., Julien J. P., Yasmeen A., de Val N., Kim H. J., Blattner C., de la Peña A. T., Korzun J., et al. 2013. A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLoS Pathog. 9: e1003618. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Pugach P., Ozorowski G., Cupo A., Ringe R., Yasmeen A., de Val N., Derking R., Kim H. J., Korzun J., Golabek M., et al. 2015. A native-like SOSIP.664 trimer based on an HIV-1 subtype B env gene. J. Virol. 89: 3380–3395. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Xu J. Y., Gorny M. K., Palker T., Karwowska S., Zolla-Pazner S. 1991. Epitope mapping of two immunodominant domains of gp41, the transmembrane protein of human immunodeficiency virus type 1, using ten human monoclonal antibodies. J. Virol. 65: 4832–4838. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Pinter A., Honnen W. J., Kayman S. C., Trochev O., Wu Z. 1998. Potent neutralization of primary HIV-1 isolates by antibodies directed against epitopes present in the V1/V2 domain of HIV-1 gp120. Vaccine 16: 1803–1811. [DOI] [PubMed] [Google Scholar]
  • 42.Zhou T., Xu L., Dey B., Hessell A. J., Van Ryk D., Xiang S. H., Yang X., Zhang M. Y., Zwick M. B., Arthos J., et al. 2007. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature 445: 732–737. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Dey B., Svehla K., Xu L., Wycuff D., Zhou T., Voss G., Phogat A., Chakrabarti B. K., Li Y., Shaw G., et al. 2009. Structure-based stabilization of HIV-1 gp120 enhances humoral immune responses to the induced co-receptor binding site. PLoS Pathog. 5: e1000445. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Wu X., Yang Z. Y., Li Y., Hogerkorp C. M., Schief W. R., Seaman M. S., Zhou T., Schmidt S. D., Wu L., Xu L., et al. 2010. Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1. Science 329: 856–861. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Lynch R. M., Tran L., Louder M. K., Schmidt S. D., Cohen M., Dersimonian R., Euler Z., Gray E. S., Abdool Karim S., Kirchherr J., et al. CHAVI 001 Clinical Team Members 2012. The development of CD4 binding site antibodies during HIV-1 infection. J. Virol. 86: 7588–7595. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.deCamp A., Hraber P., Bailer R. T., Seaman M. S., Ochsenbauer C., Kappes J., Gottardo R., Edlefsen P., Self S., Tang H., et al. 2014. Global panel of HIV-1 Env reference strains for standardized assessments of vaccine-elicited neutralizing antibodies. J. Virol. 88: 2489–2507. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Walker L. M., Phogat S. K., Chan-Hui P. Y., Wagner D., Phung P., Goss J. L., Wrin T., Simek M. D., Fling S., Mitcham J. L., et al. Protocol G Principal Investigators 2009. Broad and potent neutralizing antibodies from an African donor reveal a new HIV-1 vaccine target. Science 326: 285–289. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Frost S. D., Wrin T., Smith D. M., Kosakovsky Pond S. L., Liu Y., Paxinos E., Chappey C., Galovich J., Beauchaine J., Petropoulos C. J., et al. 2005. Neutralizing antibody responses drive the evolution of human immunodeficiency virus type 1 envelope during recent HIV infection. Proc. Natl. Acad. Sci. USA 102: 18514–18519. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Moore P. L., Ranchobe N., Lambson B. E., Gray E. S., Cave E., Abrahams M. R., Bandawe G., Mlisana K., Abdool Karim S. S., Williamson C., Morris L., CAPRISA 002 Study. NIAID Center for HIV/AIDS Vaccine Immunology (CHAVI) 2009. Limited neutralizing antibody specificities drive neutralization escape in early HIV-1 subtype C infection. PLoS Pathog. 5: e1000598. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Rong R., Li B., Lynch R. M., Haaland R. E., Murphy M. K., Mulenga J., Allen S. A., Pinter A., Shaw G. M., Hunter E., et al. 2009. Escape from autologous neutralizing antibodies in acute/early subtype C HIV-1 infection requires multiple pathways. PLoS Pathog. 5: e1000594. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Li M., Gao F., Mascola J. R., Stamatatos L., Polonis V. R., Koutsoukos M., Voss G., Goepfert P., Gilbert P., Greene K. M., et al. 2005. Human immunodeficiency virus type 1 env clones from acute and early subtype B infections for standardized assessments of vaccine-elicited neutralizing antibodies. J. Virol. 79: 10108–10125. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Montefiori D. C., Karnasuta C., Huang Y., Ahmed H., Gilbert P., de Souza M. S., McLinden R., Tovanabutra S., Laurence-Chenine A., Sanders-Buell E., et al. 2012. Magnitude and breadth of the neutralizing antibody response in the RV144 and Vax003 HIV-1 vaccine efficacy trials. J. Infect. Dis. 206: 431–441. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Sather D. N., Armann J., Ching L. K., Mavrantoni A., Sellhorn G., Caldwell Z., Yu X., Wood B., Self S., Kalams S., Stamatatos L. 2009. Factors associated with the development of cross-reactive neutralizing antibodies during human immunodeficiency virus type 1 infection. J. Virol. 83: 757–769. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Blish C. A., Dogan O. C., Derby N. R., Nguyen M. A., Chohan B., Richardson B. A., Overbaugh J. 2008. Human immunodeficiency virus type 1 superinfection occurs despite relatively robust neutralizing antibody responses. J. Virol. 82: 12094–12103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Seaman M. S., Janes H., Hawkins N., Grandpre L. E., Devoy C., Giri A., Coffey R. T., Harris L., Wood B., Daniels M. G., et al. 2010. Tiered categorization of a diverse panel of HIV-1 Env pseudoviruses for assessment of neutralizing antibodies. J. Virol. 84: 1439–1452. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Liao H. X., Tsao C. Y., Alam S. M., Muldoon M., Vandergrift N., Ma B. J., Lu X., Sutherland L. L., Scearce R. M., Bowman C., et al. 2013. Antigenicity and immunogenicity of transmitted/founder, consensus, and chronic envelope glycoproteins of human immunodeficiency virus type 1. J. Virol. 87: 4185–4201. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Bar K. J., Tsao C. Y., Iyer S. S., Decker J. M., Yang Y., Bonsignori M., Chen X., Hwang K. K., Montefiori D. C., Liao H. X., et al. 2012. Early low-titer neutralizing antibodies impede HIV-1 replication and select for virus escape. PLoS Pathog. 8: e1002721. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Sanders R. W., van Gils M. J., Derking R., Sok D., Ketas T. J., Burger J. A., Ozorowski G., Cupo A., Simonich C., Goo L., et al. 2015. HIV-1 VACCINES. HIV-1 neutralizing antibodies induced by native-like envelope trimers. Science 349: aac4223. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Crotty S. 2011. Follicular helper CD4 T cells (TFH). Annu. Rev. Immunol. 29: 621–663. [DOI] [PubMed] [Google Scholar]
  • 60.Petrovas C., Yamamoto T., Gerner M. Y., Boswell K. L., Wloka K., Smith E. C., Ambrozak D. R., Sandler N. G., Timmer K. J., Sun X., et al. 2012. CD4 T follicular helper cell dynamics during SIV infection. J. Clin. Invest. 122: 3281–3294. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Fukazawa Y., Park H., Cameron M. J., Lefebvre F., Lum R., Coombes N., Mahyari E., Hagen S. I., Bae J. Y., Reyes M. D., III, et al. 2012. Lymph node T cell responses predict the efficacy of live attenuated SIV vaccines. Nat. Med. 18: 1673–1681. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Onabajo O. O., George J., Lewis M. G., Mattapallil J. J. 2013. Rhesus macaque lymph node PD-1(hi)CD4+ T cells express high levels of CXCR5 and IL-21 and display a CCR7(lo)ICOS+Bcl6+ T-follicular helper (Tfh) cell phenotype. PLoS One 8: e59758. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Perreau M., Savoye A. L., De Crignis E., Corpataux J. M., Cubas R., Haddad E. K., De Leval L., Graziosi C., Pantaleo G. 2013. Follicular helper T cells serve as the major CD4 T cell compartment for HIV-1 infection, replication, and production. J. Exp. Med. 210: 143–156. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Locci M., Havenar-Daughton C., Landais E., Wu J., Kroenke M. A., Arlehamn C. L., Su L. F., Cubas R., Davis M. M., Sette A., et al. International AIDS Vaccine Initiative Protocol C Principal Investigators 2013. Human circulating PD-1+CXCR3-CXCR5+ memory Tfh cells are highly functional and correlate with broadly neutralizing HIV antibody responses. Immunity 39: 758–769. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Sok D., Laserson U., Laserson J., Liu Y., Vigneault F., Julien J. P., Briney B., Ramos A., Saye K. F., Le K., et al. 2013. The effects of somatic hypermutation on neutralization and binding in the PGT121 family of broadly neutralizing HIV antibodies. PLoS Pathog. 9: e1003754. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Klein F., Diskin R., Scheid J. F., Gaebler C., Mouquet H., Georgiev I. S., Pancera M., Zhou T., Incesu R. B., Fu B. Z., et al. 2013. Somatic mutations of the immunoglobulin framework are generally required for broad and potent HIV-1 neutralization. Cell 153: 126–138. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.McGuire A. T., Glenn J. A., Lippy A., Stamatatos L. 2014. Diverse recombinant HIV-1 Envs fail to activate B cells expressing the germline B cell receptors of the broadly neutralizing anti-HIV-1 antibodies PG9 and 447-52D. J. Virol. 88: 2645–2657. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Jardine J., Julien J. P., Menis S., Ota T., Kalyuzhniy O., McGuire A., Sok D., Huang P. S., MacPherson S., Jones M., et al. 2013. Rational HIV immunogen design to target specific germline B cell receptors. Science 340: 711–716. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Fiebig E. W., Wright D. J., Rawal B. D., Garrett P. E., Schumacher R. T., Peddada L., Heldebrant C., Smith R., Conrad A., Kleinman S. H., Busch M. P. 2003. Dynamics of HIV viremia and antibody seroconversion in plasma donors: implications for diagnosis and staging of primary HIV infection. AIDS 17: 1871–1879. [DOI] [PubMed] [Google Scholar]
  • 70.Mörner A., Douagi I., Forsell M. N., Sundling C., Dosenovic P., O’Dell S., Dey B., Kwong P. D., Voss G., Thorstensson R., et al. 2009. Human immunodeficiency virus type 1 env trimer immunization of macaques and impact of priming with viral vector or stabilized core protein. J. Virol. 83: 540–551. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Martinez P., Sundling C., O’Dell S., Mascola J. R., Wyatt R. T., Karlsson Hedestam G. B. 2015. Primate immune responses to HIV-1 Env formulated in the saponin-based adjuvant AbISCO-100 in the presence or absence of TLR9 co-stimulation. Sci. Rep. 5: 8925. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 72.Cubas R. A., Mudd J. C., Savoye A. L., Perreau M., van Grevenynghe J., Metcalf T., Connick E., Meditz A., Freeman G. J., Abesada-Terk G., Jr., et al. 2013. Inadequate T follicular cell help impairs B cell immunity during HIV infection. Nat. Med. 19: 494–499. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73.Streeck H., D’Souza M. P., Littman D. R., Crotty S. 2013. Harnessing CD4⁺ T cell responses in HIV vaccine development. Nat. Med. 19: 143–149. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.Lindqvist M., van Lunzen J., Soghoian D. Z., Kuhl B. D., Ranasinghe S., Kranias G., Flanders M. D., Cutler S., Yudanin N., Muller M. I., et al. 2012. Expansion of HIV-specific T follicular helper cells in chronic HIV infection. J. Clin. Invest. 122: 3271–3280. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Yamamoto T., Lynch R. M., Gautam R., Matus-Nicodemos R., Schmidt S. D., Boswell K. L., Darko S., Wong P., Sheng Z., Petrovas C., et al. 2015. Quality and quantity of TFH cells are critical for broad antibody development in SHIVAD8 infection. Sci. Transl. Med. 7: 298ra120. [DOI] [PubMed] [Google Scholar]
  • 76.Piantadosi A., Panteleeff D., Blish C. A., Baeten J. M., Jaoko W., McClelland R. S., Overbaugh J. 2009. Breadth of neutralizing antibody response to human immunodeficiency virus type 1 is affected by factors early in infection but does not influence disease progression. J. Virol. 83: 10269–10274. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Data Supplement
JI_1500527.zip (225KB, zip)

Articles from The Journal of Immunology Author Choice are provided here courtesy of Oxford University Press

RESOURCES