Abstract
Calreticulin (CALR) and JAK2-V617F gene mutations, which are major genetic mutations in patients with primary myelofibrosis (PMF) and essential thrombocythemia (ET), exert different effects on the clinical features and outcomes of these diseases. We analyzed 88 and 9 patients with ET and PMF, respectively, and determined the differences in the clinical characteristics of ET patients with JAK2-V617F compared with CALR mutations. The frequency of the JAK2-V617F and CALR mutations were 64 and 22 %, respectively. Patients with CALR mutations were younger, had a lower white blood cell count, and had a lower rate of thrombotic events than patients with the JAK2 mutation. The neutrophil alkaline phosphatase (NAP) score of 16 patients with CALR mutations was significantly lower than the normal controls, which was mainly due to the high proportion of NAP-negative neutrophils. This is the first report to show an association between CALR mutations in patients with myeloproliferative neoplasms (MPN) and the NAP score. Although the mechanism is unclear, the NAP score could be a useful and reliable biochemical marker to discriminate the mutational status of MPN patients. Further investigation is warranted to determine whether these characteristics contribute to the pathogenesis of MPN and the NAP score.
Keywords: Myeloproliferative neoplasms, Calreticulin, Alkaline phosphatase score, Essential thrombocythemia, Janus kinase 2
Background
The pathogenesis of myeloproliferative neoplasms (MPN) is characterized by constitutive activation of “disease-specific” protein tyrosine kinases. The Janus kinase 2 (JAK2)-V617F mutation and somatic mutations of JAK2 exon 12 constitutively activate JAK2 protein tyrosine kinase and these mutations are detected in almost all patients with polycythemia vera (PV). In addition, the JAK2-V617F mutation is detected in approximately 50–60 % of patients with essential thrombocythemia (ET) and primary myelofibrosis (PMF) (Baxter et al. 2005; James et al. 2005; Kralovics et al. 2005; Levine et al. 2005; Campbell and Green 2006), and activating mutations of the myeloproliferative leukemia virus oncogene (MPL) are present in 5–10 % of patients with ET or PMF without the JAK2-V617F mutation (Pikman et al. 2006; Rumi et al. 2013). Furthermore, novel mutations in the gene encoding calreticulin (CALR) were discovered in patients with ET and PMF with wild-type JAK2 or MPL (Klampfl et al. 2013; Nangalia et al. 2013). CALR mutations are detected only in patients with ET or PMF (Klampfl et al. 2013; Nangalia et al. 2013). The frequency of CALR mutations in patients with ET and PMF are 25 and 35 %, respectively. The clinical features of ET patients with CALR mutations include a higher platelet count, lower hemoglobin level and white blood cell count, fewer thrombotic events, and less leukemic transformation compared to ET patients with JAK2-V617F mutation (Rumi et al. 2014). These results suggest that the clinical features and outcomes of MPN patients are defined by the gene alterations that they acquired.
The neutrophil alkaline phosphatase (NAP) score is a useful and reliable biochemical marker that supports the diagnosis of MPN (Bendix-Hansen and Bergmann 1985). The chronic phase of chronic myelogenous leukemia (CP-CML) is characterized by a low NAP score that is elevated when the disease enters the accelerated phase (Kaplow 1971). Some MPN patients with JAK2-V617F mutation have higher NAP scores. Although the NAP score often reflects the pathophysiological status of patients with MPNs, to our knowledge, the details of NAP scores of patients with MPN with CALR mutations have never been studied. Therefore, the goal of the present study was to identify the clinical features of MPN patients with JAK2-V617F and CALR mutations by focusing on their NAP scores.
Methods
Patients
We recruited 88 patients with ET and 9 with PMF. Patients were diagnosed according to the criteria of the 2008 WHO classification. Clinical laboratory findings acquired at the first visit were utilized. The ethics committees of Kawasaki Medical School and Kawasaki Medical School Hospital (Kurashiki, IRB No. 1747 and 1769) approved this study, and all patients provided written informed consent.
NAP score analysis
The NAP score was determined using a peripheral blood smear stained using our laboratory’s protocol. Briefly, slides with dried peripheral blood smears were fixed for 5 s in ice-cold methanol containing 10 % formalin and 0.001 % glacial acetic acid. After drying, the slides were treated with a staining solution (0.13 mmol/l naphthol AS-MX phosphate, 0.25 mol/l dimethylformamide, 0.076 mol/l propanediol buffer, and 0.04 mmol/l Fast Blue RR Salt) at 37 °C for 2 h. After washing with water, the slides were stained using 1 % safranin for 2 min. Neutrophils (n = 100) were assigned scores ranging from 0 to 5 according to the number and distribution of NAP-positive granules. The median NAP score of a healthy control in our laboratory is 250.
DNA sequence analysis
Genomic DNA was isolated from polymorphonuclear leukocytes of patients’ peripheral blood. We tested for JAK2, MPL, and CALR mutations that were previously reported in patients with ET or PMF (Kondo et al. 2008). The primers, which were designed using Primer3 (version 0.4.0) software (accessible at http://primer3.sourceforge.net/), used to detect the mutations were as follows (forward, reverse): JAK2-V617F, 5′-AGTCATGCTGAAAGTAGGA-3′ and 5′-ATTGCTTTCCTTTTTCACAAGAT-3′; CALR exon 9, 5′-CTGGTCCTGGTCCTGATGTC-3′ and 5′-CAGAGACATTATTTGGCGCG-3′; and MPL exon 10, 5′-AGAGTAGGGGCTGGCTGGAT-3′ and 5′-CAGGTCCCACCTCCTAAACC-3′. DNA was amplified using polymerase chain reaction (PCR) Master Mix (Promega KK, Madison, WI, USA) as follows: 1 cycle at 95 °C for 2 min, 35 cycles of denaturation at 95 °C for 30 s, annealing at 52 °C (MPL, 60 °C) for 30 s, and extension at 72 °C for 30 s. PCR products were analyzed using 3 % agarose gel electrophoresis in the presence of ethidium bromide, and the amplicons were purified using Illustra ExoProStar (GE Healthcare Life Sciences, Buckinghamshire, UK). Direct sequencing was performed using the Big Dye Terminator ver3.1 Cycle Sequencing Kit (Applied Biosystems, Foster City, CA, USA) and an ABI Prism 3130 Genetic Analyzer. Sequence data were analyzed using Mutation Surveyor ver3.10 (Softgenetics, State College, PA, USA).
Subjects’ characteristics and clinical parameters were compared using the χ2 test, Mann–Whitney U test, and Kruskal–Wallis tests. The strength of the association between two variables was determined using the Spearman’s rank correlation. Probability values <0.05 were considered significant. Statistical analyses were performed using SPSS ver.15.0.1 J software (IBM, Tokyo, Japan).
Results
We searched for JAK2, CALR, and MPL mutations in 88 patients with ET and 9 patients with PMF. Table 1 shows the clinical and laboratory features at diagnosis of the patients stratified according to MPN subtype and mutational status. In the 88 patients with ET, the frequency of the JAK2-V617F and CALR exon-9 mutations were 65 and 21 %, respectively, and in the patients with PMF, they were 56 and 22 %, respectively. MPL mutations were not detected in any patient. Triple negativity for JAK2, CALR, and MPL mutations was found in 14 and 22 % of the patients with ET and PMF, respectively. CALR mutations were detected in 21 patients, and the details of these mutations are shown in Table 2. All mutations were heterogeneous insertions or deletions in exon 9, with 10 distinct variants as follows: six deletions, two insertions, and two complex insertions and deletions. All CALR mutations were predicted to generate a commonly known C-terminal peptide sequence (Klampfl et al. 2013; Nangalia et al. 2013). There were two common variants: L367 fs*46 (33 %) and K385 fs*47 (24 %).
Table 1.
Presenting features of the 97 patients with ET or PMF, stratified according to their mutational status
| JAK2 mutated (A) | CALR mutated (B) | Triple negative | p (A vs B)* | |
|---|---|---|---|---|
| ET (N = 88) | ||||
| No. of patients, n (%) | 57 (65) | 19 (21) | 12 (14) | |
| Age, median (range), year | 66 (33–86) | 58 (30–85) | 66.5 (29–82) | 0.056 |
| Age ≧ 60 year, n (%) | 42 (74) | 8 (42) | 8 (67) | 0.012 |
| Females, n (%) | 33 (58) | 9 (47) | 5 (42) | 0.439 |
| Leukocytes, median (range), ×109/L | 12.1 (6.0–42.3) | 9.2 (5.3–16.3) | 8.4 (4.6–13.9) | <.001 |
| Hemoglobin, median (range), g/dL | 14.3 (10.2–18.6) | 13.5 (11.4–17.1) | 13.7 (11.3–16.2) | 0.593 |
| Platelets, median (range), ×109/L | 867 (489–2285) | 930 (631–2336) | 717 (501–922) | 0.359 |
| NAP score median (range) | 312 (202–417) | 215 (106–286) | 254.5 (116–404) | <.001 |
| High LD, n (%) | 38 (67) | 11 (58) | 3 (25) | 0.489 |
| Palpable splenomegaly, n (%) | 19 (33) | 3 (16) | 1 (8) | 0.144 |
| Thrombosis history, n (%) | 22 (39) | 2 (11) | 3 (25) | 0.023 |
| Needed to cytoreductive therapy, n (%) | 39 (68) | 12 (63) | 5 (42) | 0.672 |
| PMF (N = 9) | ||||
| No. of patients, n (%) | 5 (56) | 2 (22) | 2 (22) | |
| Age, median (range), year | 65 (51–85) | 63.5 (58–69) | 67.5 (57–78) | NA |
| Age ≧ 60 year, n (%) | 4 (80) | 1 (50) | 1 (50) | NA |
| Females, n (%) | 3 (60) | 1 (50) | 1 (50) | NA |
| Leukocytes, median (range), ×109/L | 14.4 (8.6–37.1) | 5.8 (5.6–6.1) | 5.1 (5.0–5.3) | NA |
| Hemoglobin, median (range), g/dL | 13.2 (9.8–16.8) | 12.2 (11.7–12.6) | 11.1 (8.9–13.3) | NA |
| Platelets, median (range), ×109/L | 384 (194–654) | 306 (260–352) | 383 (122–644) | NA |
| NAP score median (range) | 341 (301–378) | 157 (150–164) | 253.5 (210–297) | NA |
| High LD, n (%) | 5 (100) | 2 (100) | 1 (50) | NA |
| Palpable splenomegaly, n (%) | 5 (100) | 2 (100) | 0 (0) | NA |
| Thrombosis history, n (%) | 1 (20) | 0 (0) | 1 (50) | NA |
| Needed to cytoreductive therapy, n (%) | 1 (20) | 0 (0) | 1 (50) | NA |
NA Not available
*Calculated using the χ2 test except for age, CBC and NAP score, which was calculated using the Mann–Whitney U test
Table 2.
Mutational status of CALR exon 9 in the 21 patients with ET or PMF
| Diagnosis | cDNA change | Protein change | C-terminal novel amino acid sequence |
|---|---|---|---|
| ET | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| PMF | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1092_1143del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1099_1150del | p.L367 fs*46 | TRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1154_1155ins TTGTC | p.K385 fs*47 | NCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| PMF | c.1154_1155ins TTGTC | p.K385 fs*47 | NCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1154_1155ins TTGTC | p.K385 fs*47 | NCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1154_1155ins TTGTC | p.K385 fs*47 | NCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1154_1155ins TTGTC | p.K385 fs*47 | NCRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1102_1153del | p.K368 fs*45 | RRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1102_1153del | p.K368 fs*45 | RRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1110_1140del | p.E371 fs*49 | RQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1109_1160del | p.E370 fs*42 | VMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1150_1154delins TGTC | p.D384 fs*46 | CRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1125_1126 ins TTCTTAGTGCT | p.R376 fs*58 | FLVLAKRRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1091_1124del | p.E364 fs*54 | DAKRRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1080_1144delins GGAAGAAGACAAG | p.Q361 fs*51 | KAAEKQMKDKEEDKQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
| ET | c.1122_1134del | p.K375 fs*50 | KAAEKQMKDKQDEEQRLKEEEEDKRRRQRTRRMMRTKMRMRRMRRTRRKMRRKMSPARPRTSCREACLQGWTEA |
We investigated the clinical features of ET patients with JAK2 and CALR mutations. The median age of ET patients with CALR mutations was less than the ET patients with JAK2 mutations, although this difference was not significant (p = 0.056). The proportion of patients aged >60 years was significantly lower in the CALR mutation group (p = 0.012). The ET patients with CALR mutations had a significantly lower white blood cell count (p < 0.001), NAP score (p < 0.001), and prevalence of thrombotic events than the patients with JAK2 mutations (p = 0.023; Table 1).
The NAP scores of 63 patients with MPN were evaluable, including 47 patients with JAK2 mutations and 16 patients with CALR mutations. The median NAP score of the patients with CALR mutations was significantly lower than normal controls (Fig. 1). In contrast to the normal to high range of NAP scores of the patients with JAK2 mutations, the scores of the patients with CALR mutations were normal to low. The NAP rate of the MPN patients with CALR mutations was lower (n = 13; median NAP rate 55 %; range 38–91 %), mainly due to the high proportion of NAP-negative neutrophils (score = 0; Fig. 2). This pattern of NAP scores was similar to that of patients with CP-CML with low NAP scores (n = 9; median NAP rate 51 %; range 20–67 %; Fig. 2). There was no significant correlation between the NAP score and any clinical parameter (white blood cell count, hemoglobin value, platelet count, or disease duration) in the MPN patients with CALR mutations (data not shown). The NAP rate of the MPN patients with JAK2 mutations was high compared with patients with CALR mutations (n = 10; median 87.5 %; range 74–100 %) and may be explained by the increase in strongly NAP-positive neutrophils (score 4 or 5). In patients with JAK2 mutations, the NAP score was significantly correlated with the burden of the V617F mutant allele (n = 47, p < 0.001, r = 0.748).
Fig. 1.

Neutrophil alkaline phosphatase scores of patients with essential thrombocythemia or primary myelofibrosis stratified according to their mutational status. The probability was calculated using the Kruskal–Wallis test (p < 0.001)
Fig. 2.

Analysis of the neutrophil alkaline phosphatase rate according to the mutational status of patients with MPN. a Normal controls (n = 14). b Patients with MPN with CALR mutations (n = 13). c Patients with MPN with JAK2-V617F mutation (n = 10). d Patients in the CP-CML (n = 9). One hundred neutrophils were counted in each sample
Discussion
In 2013, two groups reported the discovery of CALR mutations in patients with ET or PMF (Klampfl et al. 2013; Nangalia et al. 2013). In the present study, the frequencies of CALR mutations in patients with ET and PMF were 21 and 22 %, respectively. The frequencies of CALR L367 fs*46 and K385 fs*47 mutations, which are the most common mutations in Western countries (Klampfl et al. 2013; Nangalia et al. 2013), were 33 and 24 %, respectively, in our series. Patients with CALR mutations are younger, have a lower hemoglobin level and white blood cell count, and have a higher platelet count and serum erythropoietin than patients with JAK2-V617F mutation (Rumi et al. 2014). CALR mutations can also affect the clinical outcomes. ET patients with CALR mutations do not transform to PV (Rumi et al. 2014). In our series, the clinical features of the patients with CALR mutations included younger age, decreased white blood cell count, and a lower rate of thrombosis compared with patients with JAK2 mutations, although there were no significant differences in hemoglobin levels or platelet count. Further studies are required to better understand the phenotypes of patients with CALR mutations. Altogether, the available data suggest that the differences in mutational status define the clinical subtypes of the disease.
We found that the NAP score of patients with JAK2 mutations generally ranged from normal to high levels and was correlated with their JAK2-V617F mutant-allele burden. In contrast, the median NAP score of the 16 patients with CALR mutations was significantly lower than the normal controls. To our knowledge, this is the first study to report low NAP scores in patients with CALR mutations, which were mainly due to the high proportion of NAP-negative neutrophils and represents a new biological aspect of MPN patients with CALR mutations. Therefore, the NAP score could be a useful and reliable biochemical marker to discriminate the mutational status in patients with ET or PMF.
In patients with CP-CML, a low NAP score is the result of low serum levels of granulocyte colony-stimulating factor (Yuo et al. 1987; Watari et al. 1989; Saitoh and Shibata 1993; Tsushita et al. 1993). In contrast, in the present study, there was no significant correlation between these variables (data not shown). Several reports describe the relationship between NAP activation and MPN-related mutations. For example, transfection of the NB4 cell line with a construct that expresses JAK2-V617F induces cell proliferation through the phosphorylation of the signal transducer and activator of transcription (STAT) 5, leading to phosphorylation of STAT3, which activates NAP expression (Oku et al. 2010). Furthermore, patients with MPN, regardless of their diagnosis or JAK2 mutational status, are characterized by upregulation of JAK-STAT signaling molecules, and the CALR mutation activates the JAK2-STAT5 signaling pathway (Rampal et al. 2014). A recent report suggested that JAK2 signaling might occur in ET megakaryocytes with CALR mutations; however, the downstream signaling mechanisms other than those involving STAT3 and STAT5 are likely involved in the pathogenesis of MPN with CALR mutations (Lau et al. 2015). Finally, STAT1, STAT3, and STAT5 were not phosphorylated in the MARIMO cell line derived from a patient with ET harboring a CALR mutation (Kollmann et al. 2015). Taken together, these findings suggest the possibility that a lack of STAT3 phosphorylation may be related to the lower NAP score observed in MPN patients with CALR mutations. In patients with JAK2-V617F, NAP expression increases in parallel to the V617F allele burden (Basquiera et al. 2007; Vannucchi et al. 2007); however, the relationship between the CALR-mutated allele burden and NAP expression is unknown.
The detailed mechanism that causes CALR mutations and their relationship with a low NAP score remains to be elucidated. Our results reinforce the biological and diagnostic importance of the relationship between the NAP score and MPN.
Conclusion
CALR mutations are one of the major driver mutations in ET and PMF. In addition, the NAP score reflects the pathophysiological status of patients with MPN. We found that the NAP score of patients with CALR mutations ranged from normal to low levels, and that the median NAP score of patients with CALR mutations was significantly lower than the normal controls. This is the first report of the relationship between the NAP score and CALR mutations, but the detailed mechanism is still unclear. A low NAP score is a unique aspect of MPN patients with CALR mutations.
Authors’ contributions
TK and NT performed the molecular genetic analysis of all the patient samples; TK performed the statistical analysis; TK, TT, FS, HT, SS, TT, YM, HN, HW, and TS provided the patient materials and clinical data; KT and TS contributed advice; TK and TT wrote the manuscript; All authors read and approved the final manuscript.
Acknowledgements
The authors would like to thank the patients who agreed to participate in this study. The authors would also like to thank their coworkers for their technical assistance as well as the physicians who provided the patient materials.
Competing interests
The authors declare that they have no competing interests.
Grant sources
This work was supported, in part, by a Grant-in-Aid for Scientific Research from the Japan Society for the Promotion of Science and a Kawasaki Medical School Project Grant.
Contributor Information
Toshinori Kondo, Phone: +81-86-462-1111, Email: kondot@med.kawasaki-m.ac.jp.
Taizo Tasaka, Email: taizotasaka@gmail.com.
Nanako Tomioka, Email: okuno.31@med.kawasaki-m.ac.jp.
Fuminori Sano, Email: s.fuminori@gmail.com.
Hirotoshi Tokunaga, Email: tokusan@med.kawasaki-m.ac.jp.
Shin-ichiro Suemori, Email: suemori@med.kawasaki-m.ac.jp.
Takayuki Tsujioka, Email: tsujoka@med.kawasaki-m.ac.jp.
Yoshiko Matsuhashi, Email: matsuhashi@med.kawasaki-m.ac.jp.
Hidekazu Nakanishi, Email: nakanisi@med.kawasaki-m.ac.jp.
Hideho Wada, Email: hideho@med.kawasaki-m.ac.jp.
Kaoru Tohyama, Email: ktohyama@med.kawasaki-m.ac.jp.
Takashi Sugihara, Email: sugit@med.kawasaki-m.ac.jp.
References
- Basquiera AL, Fassetta F, Soria N, Barral JM, Ricchi B, García JJ. Accuracy of leukocyte alkaline phosphatase score to predict JAK2 V617F mutation. Haematologica. 2007;92(5):704–705. doi: 10.3324/haematol.10991. [DOI] [PubMed] [Google Scholar]
- Baxter E, Scott L, Campbell P, East C, Fourouclas N, Swanton S, Vassiliou G, Bench A, Boyd E, Curtin N. Acquired mutation of the tyrosine kinase JAK2 in human myeloproliferative disorders. Lancet. 2005;365(9464):1054–1061. doi: 10.1016/S0140-6736(05)74230-6. [DOI] [PubMed] [Google Scholar]
- Bendix-Hansen K, Bergmann OJ. Evaluation of neutrophil alkaline phosphatase (NAP) activity in untreated myeloproliferative syndromes and in leukaemoid reactions. Scand J Haematol. 1985;35(2):219–224. doi: 10.1111/j.1600-0609.1985.tb01576.x. [DOI] [PubMed] [Google Scholar]
- Campbell PJ, Green AR. The myeloproliferative disorders. N Engl J Med. 2006;355(23):2452–2466. doi: 10.1056/NEJMra063728. [DOI] [PubMed] [Google Scholar]
- James C, Ugo V, Le Couédic J, Staerk J, Delhommeau F, Lacout C, Garçon L, Raslova H, Berger R, Bennaceur-Griscelli A, Villeval JL, Constantinescu SN, Casadevall N, Vainchenker W. A unique clonal JAK2 mutation leading to constitutive signalling causes polycythaemia vera. Nature. 2005;434(7037):1144–1148. doi: 10.1038/nature03546. [DOI] [PubMed] [Google Scholar]
- Kaplow LS. Leukocyte alkaline phosphatase in disease. Crit Rev Clin Lab Sci. 1971;2(2):243–278. doi: 10.3109/10408367109151310. [DOI] [PubMed] [Google Scholar]
- Klampfl T, Gisslinger H, Harutyunyan AS, Nivarthi H, Rumi E, Milosevic JD, Them NCC, Berg T, Gisslinger B, Pietra D, Chen D, Vladimer GI, Bagienski K, Milanesi C, Casetti IC, Sant’Antonio E, Ferretti V, Elena C, Schischlik F, Cleary C. Somatic mutations of calreticulin in myeloproliferative neoplasms. N Engl J Med. 2013;369(25):2379–2390. doi: 10.1056/NEJMoa1311347. [DOI] [PubMed] [Google Scholar]
- Kollmann K, Nangalia J, Warsch W, Quentmeier H, Bench A, Boyd E, Scott M, Drexler HG, Green AR. MARIMO cells harbor a CALR mutation but are not dependent on JAK2/STAT5 signaling. Leukemia. 2015;29(2):494–497. doi: 10.1038/leu.2014.285. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Kondo T, Okuno N, Naruse H, Kishimoto M, Tasaka T, Tsujioka T, Matsuoka A, Sugihara T, Tohyama Y, Tohyama K. Valiation of the revised 2008 WHO diagnostic criteria in 75 suspected cases of myeloproliferative neoplasm. Leuk Lymphoma. 2008;49(9):1784–1791. doi: 10.1080/10428190802258972. [DOI] [PubMed] [Google Scholar]
- Kralovics R, Passamonti F, Buser AS, Teo S, Tiedt R, Passweg JR, Tichelli A, Cazzola M, Skoda RC. A gain-of-function mutation of JAK2 in myeloproliferative disorders. N Engl J Med. 2005;352(17):1779–1790. doi: 10.1056/NEJMoa051113. [DOI] [PubMed] [Google Scholar]
- Lau WWY, Hannah R, Green AR, Göttgens B. The JAK-STAT signaling pathway is differentially activated in CALR-positive compared with JAK2V617F-positive ET patients. Blood. 2015;125(10):1679–1681. doi: 10.1182/blood-2014-12-618074. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Levine RL, Wadleigh M, Cools J, Ebert BL, Wernig G, Huntly BJP, Boggon TJ, Wlodarska I, Clark JJ, Moore S, Adelsperger J, Koo S, Lee JC, Gabriel S, Mercher T, D’Andrea A, Fröhling S, Döhner K, Marynen P, Vandenberghe P. Activating mutation in the tyrosine kinase JAK2 in polycythemia vera, essential thrombocythemia, and myeloid metaplasia with myelofibrosis. Cancer Cell. 2005;7(4):387–397. doi: 10.1016/j.ccr.2005.03.023. [DOI] [PubMed] [Google Scholar]
- Nangalia J, Massie CE, Baxter EJ, Nice FL, Gundem G, Wedge DC, Avezov E, Li J, Kollmann K, Kent DG, Aziz A, Godfrey AL, Hinton J, Martincorena I, Van Loo P, Jones AV, Guglielmelli P, Tarpey P, Harding HP, Fitzpatrick JD. Somatic CALR mutations in myeloproliferative neoplasms with nonmutated JAK2. N Engl J Med. 2013;369(25):2391–2405. doi: 10.1056/NEJMoa1312542. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Oku S, Takenaka K, Kuriyama T, Shide K, Kumano T, Kikushige Y, Urata S, Yamauchi T, Iwamoto C, Shimoda HK, Miyamoto T, Nagafuji K, Kishimoto J, Shimoda K, Akashi K. JAK2 V617F uses distinct signalling pathways to induce cell proliferation and neutrophil activation. Br J Haematol. 2010;150(3):334–344. doi: 10.1111/j.1365-2141.2010.08249.x. [DOI] [PubMed] [Google Scholar]
- Pikman Y, Lee BH, Mercher T, McDowell E, Ebert BL, Gozo M, Cuker A, Wernig G, Moore S, Galinsky I, DeAngelo DJ, Clark JJ, Lee SJ, Golub TR, Wadleigh M, Gilliland DG, Levine RL. MPLW515L is a novel somatic activating mutation in myelofibrosis with myeloid metaplasia. PLOS Med. 2006;3(7):e270. doi: 10.1371/journal.pmed.0030270. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Rampal R, Al-Shahrour F, Abdel-Wahab O, Patel JP, Brunel J, Mermel CH, Bass AJ, Pretz J, Ahn J, Hricik T, Kilpivaara O, Wadleigh M, Busque L, Gilliland DG, Golub TR, Ebert BL, Levine RL. Integrated genomic analysis illustrates the central role of JAK-STAT pathway activation in myeloproliferative neoplasm pathogenesis. Blood. 2014;123(22):e123–e133. doi: 10.1182/blood-2014-02-554634. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Rumi E, Pietra D, Guglielmelli P, Bordoni R, Casetti I, Milanesi C, Sant’Antonio E, Ferretti V, Pancrazzi A, Rotunno G, Severgnini M, Pietrelli A, Astori C, Fugazza E, Pascutto C, Boveri E, Passamonti F, De Bellis G, Vannucchi A, Cazzola M. Acquired copy-neutral loss of heterozygosity of chromosome 1p as a molecular event associated with marrow fibrosis in MPL-mutated myeloproliferative neoplasms. Blood. 2013;121(21):4388–4395. doi: 10.1182/blood-2013-02-486050. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Rumi E, Pietra D, Ferretti V, Klampfl T, Harutyunyan AS, Milosevic JD, Them NCC, Berg T, Elena C, Casetti IC, Milanesi C, Sant’Antonio E, Bellini M, Fugazza E, Renna MC, Boveri E, Astori C, Pascutto C, Kralovics R, Cazzola M. JAK2 or CALR mutation status defines subtypes of essential thrombocythemia with substantially different clinical course and outcomes. Blood. 2014;123(10):1544–1551. doi: 10.1182/blood-2013-11-539098. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Saitoh H, Shibata A. Levels of serum granulocyte colony-stimulating factor in patients with chronic myeloid leukemia. Leuk Lymphoma. 1993;11(5–6):443–446. doi: 10.3109/10428199309067938. [DOI] [PubMed] [Google Scholar]
- Tsushita K, Hotta T, Ichikawa A, Murate T, Saito H. Induction of neutrophil alkaline phosphatase gene expression by granulocyte colony-stimulating factor inchronic myelogenous leukemia. Int J Hematol. 1993;57:45–52. [PubMed] [Google Scholar]
- Vannucchi AM, Antonioli E, Guglielmelli P, Longo G, Pancrazzi A, Ponziani V, Bogani C, Ferrini PR, Rambaldi A, Guerini V, Bosi A, Barbui T. Prospective identification of high-risk polycythemia vera patients based on JAK2V617F allele burden. Leukemia. 2007;21(9):1952–1959. doi: 10.1038/sj.leu.2404854. [DOI] [PubMed] [Google Scholar]
- Watari K, Asano S, Shirafuji N, Kodo H, Ozawa K, Takaku F, Kamachi SI. Serum granulocyte colony-stimulating factor levels in healthy volunteers and patients with various disorders as estimated by enzyme immunoassay. Blood. 1989;73:117–122. [PubMed] [Google Scholar]
- Yuo A, Kitagawa S, Okabe T, Urabe A, Komatsu Y, Itoh S, Takaku F. Recombinant human granulocyte colony-stimulating factor repairs the abnormalities of neutrophils in patients with myelodysplastic syndromes and chronic myelogenous leukemia. Blood. 1987;70:404–411. [PubMed] [Google Scholar]
