The crystal structure of AibC, the terminal reductase in myxococcal de novo isovaleryl coenzyme A biosynthesis, has been determined at 2.55 Å resolution.
Keywords: alternative isovaleryl coenzyme A biosynthesis, medium-chain dehydrogenase/reductase, zinc-dependence, hexahistidine tag, TEV protease-recognition sequence, Myxococcus xanthus
Abstract
Isovaleryl coenzyme A (IV-CoA) performs a crucial role during development and fruiting-body formation in myxobacteria, which is reflected in the existence of a de novo biosynthetic pathway that is highly upregulated when leucine, the common precursor of IV-CoA, is limited. The final step in de novo IV-CoA biosynthesis is catalyzed by AibC, a medium-chain dehydrogenase/reductase. Here, the crystal structure of AibC from Myxococcus xanthus refined to 2.55 Å resolution is presented. The protein adopts two different conformations in the crystal lattice, which is a consequence of partial interaction with the purification tag. Based on this structure, it is suggested that AibC most probably uses a Zn2+-supported catalytic mechanism in which NADPH is preferred over NADH. Taken together, this study reveals structural details of the alternative IV-CoA-producing pathway in myxobacteria, which may serve as a base for further biotechnological research and biofuel production.
1. Introduction
Branched-chain fatty acids and lipids are important compounds for the Gram-negative bacterium Myxococcus xanthus, since they are utilized as signalling molecules during development and serve as membrane fluidity-maintaining substances (Hoiczyk et al., 2009 ▸; Downward & Toal, 1995 ▸). These molecules are produced from the common precursor isovaleryl coenzyme A (IV-CoA; Bode et al., 2006 ▸; Ring et al., 2006 ▸; Toal et al., 1995 ▸), which is typically generated by the degradation of leucine (Michal, 1999 ▸). However, Bode and coworkers recently showed that M. xanthus harbours an additional, acetyl-CoA-dependent pathway to produce IV-CoA de novo, assigned as ‘alternative isovaleryl coenzyme A biosynthesis’ (aib), a route which appeared to be highly active under leucine-limiting conditions (Fig. 1 ▸ a; Bode et al., 2009 ▸). Further biochemical analysis revealed four proteins directly involved in aib, namely MvaS, LiuC and AibA/AibB (Fig. 1 ▸ a; Bode et al., 2009 ▸; Li et al., 2013 ▸; Bock et al., 2016 ▸). The last step in aib, the conversion of 3,3-dimethylacrylyl coenzyme A (DMA-CoA) to IV-CoA, is catalyzed by AibC. Based on its sequence, AibC was predicted to belong to the alcohol dehydrogenases (EC 1.1.1.1) as a member of the medium-chain dehydrogenases/reductase family. Preliminary characterization revealed that AibC requires NADH and seems to be metal-independent (Li et al., 2013 ▸).
Figure 1.
Contribution of AibC to the alternative isovaleryl coenzyme A-biosynthesis pathway and sequence alignment of AibC and related ADHs from different phyla performed using BLAST (Altschul et al., 1990 ▸). (a) The reaction catalyzed by AibC is coloured red. AcAc-CoA, acetoacetyl CoA; HMG-CoA, 3-hydroxy-3-methylglutaryl CoA; MG-CoA, 3-methylglutaconyl CoA; DMA-CoA, 3,3-dimethylacrylyl CoA; IV-CoA, isovaleryl CoA. (b) Sequence alignment of myxobacterial AibC (AibC), human liver alcohol dehydrogenase (NADH-dependent; hADH; Colonna-Cesari et al., 1986 ▸), cinnamyl alcohol dehydrogenase from Arabidopsis thaliana (NADPH-dependent; AtCAD5; Youn et al., 2006 ▸), quinone oxidoreductase Rv1454c from Mycobacterium tuberculosis (NADPH-dependent; MtADH; Zheng et al., 2015 ▸), alcohol dehydrogenase from Pseudomonas aeruginosa (NAD-dependent; PaADH; Levin et al., 2004 ▸) and threonine 3-dehydrogenase from Thermus thermophilus (TtADH; RIKEN Structural Genomics/Proteomics Initiative, unpublished work). Residues involved in structural Zn2+ coordination are highlighted in green; those involved in coordination of the active-site Zn2+ are highlighted in blue. The red box indicates residues that mediate the preference between NADH and NADPH.
Alcohol dehydrogenase (ADH) family members are found in all three kingdoms of life. They possess a wide spectrum of physiological functions and participate, for instance, in the detoxification of ethanol and formaldehyde, in signalling processes and in various metabolic pathways (Persson et al., 1994 ▸; Sanghani et al., 2000 ▸; Deltour et al., 1999 ▸). Because of this broad functionality, these enzymes are capable of converting a large number of substrates, ranging from branched and cyclic alcohols to ketones and aldehydes (Vitale et al., 2013 ▸). Another specific feature of ADHs is the stereoselectivity of the reaction that they catalyse. This makes them perfectly suited for the biotechnological food industry, pharmaceutical and fine chemical production, especially in the case of ADH enzymes that show tolerance to heat and denaturants (Vitale et al., 2013 ▸; Persson et al., 1991 ▸; Radianingtyas & Wright, 2003 ▸). ADHs can be grouped into three different classes according to their size. Class I, also known as medium-chain dehydrogenases/reductases (MDRs), consist of approximately 350–390 amino acids and typically contain Zn2+ cations for structural and functional purposes. Furthermore, the oligomerization state of class I members differs according to their origin. Bacterial MDRs usually appear as tetramers, whereas dimers are found in higher plants and mammals (Korkhin et al., 1998 ▸). Class II proteins, known as nonmetallic or short-chain enzymes, consist of 250 amino acids per chain, whereas class III enzymes possess up to 700 residues (Korkhin et al., 1998 ▸).
At the structural level, MDRs are built of two domains: a C-terminal NAD/NADP-binding Rossmann-fold domain and an N-terminal catalytic domain characterized by a GroES-like fold that typically harbours a catalytic Zn2+ cation. However, the residues involved in Zn2+ coordination differ among MDR members. It has been shown that ‘constant ligands’ such as cysteine and histidine are always present, whereas ‘variable ligands’ vary between negatively charged amino acids (aspartic acid or glutamic acid) and an arginine or lysine residue that typically forms a salt bridge with the respective aspartic or glutamic acid (Meijers & Cedergren-Zeppezauer, 2006 ▸). In addition to the catalytic Zn2+ cation, several MDR members contain a second Zn2+ cation located in a loop region that is coordinated by four cysteine residues and is termed the ‘structural Zn2+-binding region’ (Vitale et al., 2010 ▸; Littlechild et al., 2004 ▸; Baker et al., 2009 ▸).
Here, we present the crystal structure of AibC refined at 2.55 Å resolution. We show that AibC contains a structural as well as an active-site Zn2+ cation. Furthermore, sequence and structural analysis reveal a sequence motif indicating a preference for NADPH over NADH, suggesting a Zn2+- and NADPH-dependent reaction mechanism.
2. Materials and methods
2.1. Protein production
The gene coding for AibC was PCR-amplified from pET-28a-AibC using the forward and reverse primers listed in Table 1 ▸ and the PCR product was subsequently cleaved with NdeI and XhoI. The resulting fragment was inserted into NdeI/XhoI-linearized pET-19m expression vector (modified pET-19b; Novagen), leading to a TEV-protease-cleavable His6-tagged (pET-19m-AibC) construct (Table 1 ▸). The correct insertion of aibC was controlled by sequencing. The expression plasmid pET-19m-AibC was freshly transformed into chemically competent Escherichia coli Rosetta2 pLysS (DE3) cells and subsequently used for preculture inoculation supplemented with 50 mg l−1 kanamycin and 34 mg l−1 chloramphenicol. Large-scale protein production was carried out in lysogeny broth (LB) including the same antibiotics. The cells were incubated at 310 K and 120 rev min−1 until the optical density reached 0.6–0.8. At this point, the temperature was reduced to 293 K and heterologous gene expression was induced with 500 µM IPTG for a further 20 h. The cells were harvested by centrifugation at 5000g for 10 min and flash-frozen in liquid nitrogen until needed. The cells were thawed on ice and diluted with buffer A (50 mM NaH2PO4 pH 7.0, 300 mM NaCl, 20 mM imidazole) and subsequently lysed using an EmulsiFlex-C3 homogenizer (AVESTIN). To remove insoluble parts the cell suspension was centrifuged for 45 min at 30 000g and 277 K. The cleared supernatant was applied onto a HisTrap chelating column (GE Healthcare Life Sciences) loaded with 100 mM nickel sulfate and equilibrated in buffer A. The column was washed with buffer A until the absorption at 280 nm reached the baseline, and the bound proteins were eluted with a three-step gradient from 12% buffer B (buffer A containing 500 mM imidazole) to 20 and 60% buffer B. Fractions containing His-tagged AibC were combined, concentrated and applied onto an S200 16/60 size-exclusion column (GE Healthcare Life Sciences) equilibrated with buffer C (50 mM HEPES pH 7.0, 100 mM NaCl). Pure protein fractions were collected, concentrated to 20 mg ml−1, flash-frozen in liquid nitrogen (77 K) and stored at 193 K until needed for further experiments.
Table 1. Protein-production information.
| Source organism | M. xanthus DK1622 |
| DNA source | pET-28a-AibC (Li et al., 2013 ▸) |
| Forward primer† | ATTTATCATATGAAAGCCGTCGTACTGCGCAGCTTT |
| Reverse primer† | ATTTATCTCGAGTTATCACGCCTCGGGGGGCACC |
| Cloning vector | pET-19m |
| Expression vector | pET-19m (assigned as pET-19m-AibC) |
| Expression host | E. coli Rosetta2 pLysS (DE3) |
| Complete amino-acid sequence of the construct produced‡ | MHHHHHHAENLYFQ|GHMKAVVLRSFGEAGNLKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFFGEELPGGYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGASGGVGLSSVQLARLDGARVIAVTSSEAKVQALKEAGADEVIVSRGLDFASDVRKRTQGAGVDVAVEIVGSATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLVIVKELEILGAYATTQAELDEALRLTATGGVRQFVTDAVPLAEAAKAHFRLENREVAGRLVLVPPEA |
The respective restriction-enzyme recognition sites are underlined.
Complete sequence of the construct produced. The underlined residues are the hexahistidine tag and TEV protease cleavage site, where | indicates the cleavage site.
2.2. Crystallization
Initial crystallization conditions were identified using the vapour-diffusion method in a 96-well sitting-drop format. Screening was performed by mixing 0.2 µl AibC protein solution at a concentration of 15 mg ml−1 and 0.2 µl reservoir solution using a dispensing robot (Zinsser Analytics) and equilibrating against 70 µl reservoir solution. Crystals appeared after 5–8 d using a precipitant consisting of 3 M NaCl, 0.1 M HEPES pH 7.5. Well diffracting crystals were obtained by mixing 1 µl AibC protein solution (15 mg ml−1) and 1 µl reservoir solution consisting of 3 M NaCl, 0.1 M HEPES pH 7.4, which was equilibrated against 500 µl reservoir solution in a hanging-drop setup. Reservoir solution supplemented with 20%(v/v) glycerol was used as cryoprotectant (Table 2 ▸).
Table 2. Crystallization.
| Method | Hanging-drop vapour diffusion |
| Plate type | 24-well VDXm Plate (Hampton Research) |
| Temperature (K) | 293 |
| Protein concentration (mg ml−1) | 15 |
| Buffer composition of protein solution | 0.1 M HEPES pH 7, 100 mM NaCl |
| Composition of reservoir solution | 3 M NaCl, 0.1 M HEPES pH 7.4 |
| Volume and ratio of drop | 1 µl protein solution and 1 µl reservoir solution |
| Volume of reservoir (µl) | 500 |
2.3. Data collection and processing
Since our sequence analysis predicted that AibC binds Zn2+, despite previous work showing that AibC is metal-independent (Li et al., 2013 ▸), we collected single anomalous diffraction (SAD) data at a wavelength of 1.2779 Å on beamline BL14.1 operated by the Helmholtz-Zentrum Berlin (HZB) at the BESSY II electron-storage ring (Berlin-Adlershof, Germany). These data were indexed and integrated with XDS (Kabsch, 2010 ▸) and scaled with AIMLESS (Evans & Murshudov, 2013 ▸) from the CCP4 package (Winn et al., 2011 ▸). Data-collection and processing statistics are summarized in Table 3 ▸.
Table 3. Data collection and processing.
Values in parentheses are for the outer shell.
| Diffraction source | Beamline BL14.1, BESSY II |
| Wavelength (Å) | 1.2779 |
| Temperature (K) | 100 |
| Detector | Pilatus 6M |
| Crystal-to-detector distance (mm) | 300 |
| Rotation range per image (°) | 0.1 |
| Total rotation range (°) | 360 |
| Exposure time per image (s) | 0.2 |
| Space group | P212121 |
| a, b, c (Å) | 77.3, 77.4, 309.6 |
| α, β, γ (°) | 90, 90, 90 |
| Mosaicity (°) | 0.10 |
| Resolution range (Å) | 48.36–2.55 (2.62–2.55) |
| Total No. of reflections | 800735 (60642) |
| No. of unique reflections | 61786 (4473) |
| Completeness (%) | 100 (100) |
| Anomalous completeness† (%) | 100 (100) |
| Multiplicity | 13.0 (13.6) |
| 〈I/σ(I)〉 | 16.60 (1.9‡) |
| R anom (%) | 3.8 |
| R r.i.m. | 0.152 (1.646) |
| R p.i.m. | 0.042 (0.446) |
| Overall B factor from Wilson plot§ (Å2) | 54 |
Calculated at 3.0 Å (anomalous resolution cutoff).
The mean I/σ(I) in the outer shell is <2.0 when the resolution reaches 2.60 Å.
No anomalies were observed in the Wilson plot.
2.4. Structure solution and refinement
Anomalous differences were used to locate Zn2+ cations and derive initial phases for preliminary model building with the AutoSol routine of the PHENIX software suite (Adams et al., 2010 ▸; Terwilliger et al., 2009 ▸). The structure was refined using alternating steps of manual adjustment in Coot (Emsley et al., 2010 ▸) and maximum-likelihood and TLS (translation/libration/screw motion) refinement in PHENIX (Adams et al., 2010 ▸; Schomaker & Trueblood, 1968 ▸). MolProbity was used for final structure validation (Chen et al., 2010 ▸). Refinement statistics are summarized in Table 4 ▸.
Table 4. Structure solution and refinement.
Values in parentheses are for the outer shell.
| Resolution range (Å) | 42.94–2.55 (2.59–2.55) |
| Completeness (%) | 100 (100) |
| No. of reflections, working set | 58603 (2619) |
| No. of reflections, test set | 3087 (146) |
| Final R cryst | 0.234 (0.3503) |
| Final R free | 0.269 (0.3732) |
| No. of non-H atoms | |
| Protein | 9842 |
| Ion | 8 |
| Solvent | 107 |
| Total | 19596 |
| R.m.s. deviations | |
| Bonds (Å) | 0.002 |
| Angles (°) | 0.437 |
| Average B factors (Å2) | |
| Protein | 87 |
| Ion | 91 |
| Ramachandran plot | |
| Most favoured (%) | 95.03 |
| Allowed (%) | 4.82 |
| Disallowed (%) | 0.15 |
3. Results and discussion
Sequence alignment of AibC with related enzymes shows that AibC contains motifs that are characteristic for the binding of a structural and a catalytic Zn2+ cation as well as for NADPH binding, which is in line with its initial annotation as a Zn2+-dependent MDR (Fig. 1 ▸ b; Bode et al., 2009 ▸). In contrast to this, Li and coworkers later proposed that AibC functions as a metal-independent and NADH-utilizing enzyme, based on the finding that IV-CoA formation was observed in the presence of 1 mM NADH and 5 mM EDTA (Li et al., 2013 ▸).
To resolve this contradiction, we determined the crystal structure of His6-tagged AibC to 2.55 Å resolution using the single anomalous diffraction of Zn2+ cations that had been trapped during protein expression. The final structure was refined to R values of R cryst = 23.4 and R free = 26.9. AibC crystallized in space group P212121 with four chains and eight Zn2+ cations in the asymmetric unit. According to the interaction surface of 2520 Å2 (10% of the total surface area) analyzed using PDBePISA (Krissinel & Henrick, 2007 ▸), the stable oligomeric state of AibC is a dimer. The same oligomer was observed during size-exclusion chromatography, in which AibC eluted with a retention volume characteristic of the dimeric form. Interestingly, MDR dimers are usually only found in higher plants or mammals, but not in bacteria (Korkhin et al., 1998 ▸).
At the structural level, AibC resembles other members of the MDR family with its characteristic length of 345 amino acids, two bound Zn2+ cations and a cofactor-binding domain and a catalytic domain separated by α-helices α4–α5. Both the cofactor-binding and catalytic domain form a deep cleft in the central region of the protein. The cofactor-binding domain consists of α-helices α5, α6, α7, α9, α10 and α11 and β-strands β8–β14 arranged in a Rossmann fold with six parallel β-strands surrounded by five α-helices, whereas the catalytic domain comprises α-helices α1–α4, α9, α10 and β-strands β1–β7, β15 and β16 (Fig. 2 ▸ a).
Figure 2.
Overall dimeric structure of AibC and crystal-contact interaction with the purification tag. (a) Dimeric arrangement and secondary-structure assignment of AibC. Monomers A and B are shown. The left monomer is coloured according to its domains (cofactor-binding domain, blue; catalytic domain, orange; purification tag, magenta). The second monomer is shown in grey. (b) Interaction with the purification tag. Monomer A (surface representation, magenta) and its symmetry mate from the crystal lattice (cartoon representation, grey) are shown. (c) Comparison of open, tag-bound monomer A (magenta) and closed, tag-free monomer C (yellow). The two most strongly differing regions are highlighted by black circles. (d) Close-up view of the active site (magenta) occupied by the tag (grey). All molecular representations were prepared with PyMOL (Schrödinger; http://www.pymol.org).
We made extensive attempts to crystallize AibC without a purification tag and in the presence of DMA-CoA or potential cofactors. Although several different affinity tags, protease-cleavage sites and solubility helpers were used, only the TEV protease-cleavable His6-tagged construct led to crystal formation, which is based on crystal contacts mediated by the purification tag. In the structure, we found one active site of each dimer to be occupied by the TEV-protease cleavage site and the His6 tag of another symmetry mate in the crystal (residues −2 to −13; Fig. 2 ▸ b) such that His−9* (where * indicates a symmetry mate) directly coordinates the catalytic Zn2+ cation (Fig. 2 ▸ d). Further interactions between the tag and AibC involve π–π contacts of His−13 and Tyr41, backbone interactions of His−11* and Val264, and side chain–backbone interactions of Asp−6* and Asn50, together with hydrogen bonds between Gln−2* and Arg24 and Glu70.
The purification tag induces two different conformations of AibC in the crystal lattice. Monomers A and C show the purification tag at the N-terminus and interact with the same chain from a symmetry mate. In contrast, monomers B and D lack electron density for the tag, and the active site is free. In addition, these two chains are much more flexible, characterized by high B factors and regions of uninterpretable electron density. Superposition of the two conformations reveals that chains B and D adopt a conformation in which the active site is closed, whereas monomers A and C represent a more open form. Differences between these conformations are mainly rooted in two loops connecting β11 and α9 and β12 and α10, located around the active site (Fig. 2 ▸ c). However, this seems to be a crystallization artefact and a consequence of the interaction with the purification tag. Typically, the apo form is open and more flexible compared with the compact cofactor-bound or substrate-bound state of MDR members (Meijers & Cedergren-Zeppezauer, 2006 ▸).
Two Zn2+ cations are found in each monomer of AibC. The structural Zn2+ also found in other MDRs is coordinated by Cys92, Cys95, Cys98 and Cys106 in the typical tetrahedral geometry (Fig. 3 ▸ b). The second Zn2+ cation is part of the catalytic domain; it is located in the active site and is coordinated by Cys40, His62 and Cys149. It shows the typical location and coordination observed for metals involved in MDR catalysis (Meijers & Cedergren-Zeppezauer, 2006 ▸). The binding site is further surrounded by His42 and Gln68, which do not directly interact with the active-site Zn2+ (Fig. 3 ▸ a).
Figure 3.
Zn2+-binding and hypothetical NADPH-binding sites of AibC. Green meshes show σA-weighted |F o − F c| difference electron density of Zn2+ cations before their incorporation into the model, displayed at 3σ. (a) Catalytic Zn2+ coordination site. (b) Structural Zn2+ coordination site. (c) Model of AibC in complex with NADPH (cyan), based on superimposition with the AtCAD5–NADPH complex (PDB entry 2cf6; Youn et al., 2006 ▸). Residues potentially involved in NADPH binding are shown as sticks.
MDRs are known utilize both NADH and NADPH, with the preference for NADH being mediated by an aspartic acid residue and that for NADPH by the presence of a specific serine residue (Powell et al., 2000 ▸; Pereira et al., 2001 ▸; Youn et al., 2006 ▸). AibC lacks the aspartic acid but has the typical Ser199 in a motif comprising Thr198, Ser199 and Ser200 (Figs. 1 ▸ b and 3 ▸ c), suggesting a preference for NADPH in line with the anabolic function of AibC in IV-CoA biosynthesis. While we did not succeed in obtaining the structure of a complex of AibC with NADH or NADPH, superimposition with the structure of the related AtCAD5 allows the identification of amino acids that are possibly involved in cofactor binding in AibC (Fig. 3 ▸ c). According to this model, the pyrophosphate group interacts with Arg337, the backbone amide of Val179 and the side chain of Tyr41, which would have to rotate to occupy a position suitable for interaction. The adenine moiety could interact with Glu268 and the ribose group with Lys203. The carboxyamide moiety probably binds to Thr153 and the backbone atoms of Ala289 and Ala291.
A critical step during ADH-catalyzed reactions is proton shuttling between the substrate and the solvent. It has been shown that the cofactor, a threonine and a histidine residue are involved in this transfer in MDRs related to AibC (Youn et al., 2006 ▸; Levin et al., 2004 ▸). In AtCAD5, for example, Thr49, His52 and Asp57 together with the O2′ and O3′ hydroxyl groups of the NADPH ribose ring are perfectly oriented to enable proton shuttling from the solvent to the substrate ligated to the catalytic Zn2+ (Youn et al., 2006 ▸). In AibC, these residues are replaced by His42, Ile45 and Asn50, indicating a different proton-shuttle system or mechanism that will only be identifiable when the structures of potentially rearranged complexes of substrate complexes become available.
4. Conclusion
Here, we have determined the crystal structure of AibC, the terminal enzyme in de novo IV-CoA biosynthesis by M. xanthus, and have shown that it is a Zn2+-dependent MDR, resolving a contradiction between previous reports. AibC shows structural features that are typical of NADPH-dependent enzymes and we identified residues potentially involved in cofactor binding. Our findings provide the first structural insights into the conversion of 3,3-dimethylacrylyl coenzyme A to isovaleryl coenzyme A, the last reaction in a pathway with potential applications in biotechnology and in green energy production.
Supplementary Material
PDB reference: AibC, 5kis
Acknowledgments
We thank the BESSY II synchrotron (Helmholtz-Zentrum Berlin, Berlin) for beamline access and support during data collection and the X-ray community at HZI in Braunschweig for data collection. TB is supported by the HZI Graduate School for Infection Research.
References
- Adams, P. D. et al. (2010). Acta Cryst. D66, 213–221.
- Altschul, S. F., Gish, W., Miller, W., Myers, E. W. & Lipman, D. J. (1990). J. Mol. Biol. 215, 403–410. [DOI] [PubMed]
- Baker, P. J., Britton, K. L., Fisher, M., Esclapez, J., Pire, C., Bonete, M. J., Ferrer, J. & Rice, D. W. (2009). Proc. Natl Acad. Sci. USA, 106, 779–784. [DOI] [PMC free article] [PubMed]
- Bock, T., Kasten, J., Müller, R. & Blankenfeldt, W. (2016). Chembiochem, 17, 1257–1262. [DOI] [PubMed]
- Bode, H. B., Ring, M. W., Schwär, G., Altmeyer, M. O., Kegler, C., Jose, I. R., Singer, M. & Müller, R. (2009). Chembiochem, 10, 128–140. [DOI] [PubMed]
- Bode, H. B., Ring, M. W., Schwär, G., Kroppenstedt, R. M., Kaiser, D. & Müller, R. (2006). J. Bacteriol. 188, 6524–6528. [DOI] [PMC free article] [PubMed]
- Chen, V. B., Arendall, W. B., Headd, J. J., Keedy, D. A., Immormino, R. M., Kapral, G. J., Murray, L. W., Richardson, J. S. & Richardson, D. C. (2010). Acta Cryst. D66, 12–21. [DOI] [PMC free article] [PubMed]
- Colonna-Cesari, F., Perahia, D., Karplus, M., Eklund, H., Brändén, C. I. & Tapia, O. (1986). J. Biol. Chem. 261, 15273–15280. [PubMed]
- Deltour, L., Foglio, M. H. & Duester, G. (1999). J. Biol. Chem. 274, 16796–16801. [DOI] [PubMed]
- Downward, J. & Toal, D. (1995). Mol. Microbiol. 16, 171–175. [DOI] [PubMed]
- Emsley, P., Lohkamp, B., Scott, W. G. & Cowtan, K. (2010). Acta Cryst. D66, 486–501. [DOI] [PMC free article] [PubMed]
- Evans, P. R. & Murshudov, G. N. (2013). Acta Cryst. D69, 1204–1214. [DOI] [PMC free article] [PubMed]
- Hoiczyk, E., Ring, M. W., McHugh, C. A., Schwär, G., Bode, E., Krug, D., Altmeyer, M. O., Lu, J. Z. & Bode, H. B. (2009). Mol. Microbiol. 74, 497–517. [DOI] [PMC free article] [PubMed]
- Kabsch, W. (2010). Acta Cryst. D66, 125–132. [DOI] [PMC free article] [PubMed]
- Korkhin, Y., Kalb (Gilboa), A. J., Peretz, M., Bogin, O., Burstein, Y. & Frolow, F. (1998). J. Mol. Biol. 278, 967–981. [DOI] [PubMed]
- Krissinel, E. & Henrick, K. (2007). J. Mol. Biol. 372, 774–797. [DOI] [PubMed]
- Levin, I., Meiri, G., Peretz, M., Burstein, Y. & Frolow, F. (2004). Protein Sci. 13, 1547–1556. [DOI] [PMC free article] [PubMed]
- Li, Y., Luxenburger, E. & Müller, R. (2013). Angew. Chem. Int. Ed. 52, 1304–1308. [DOI] [PubMed]
- Littlechild, J. A., Guy, J. E. & Isupov, M. N. (2004). Biochem. Soc. Trans. 32, 255–258. [DOI] [PubMed]
- Meijers, R. & Cedergren-Zeppezauer, E. S. (2006). In Handbook of Metalloproteins, Part 8. Chichester John Wiley & Sons. 10.1002/0470028637.met001.
- Michal, G. (1999). Biochemical Pathways. Heidelberg: Spektrum.
- Pereira, P. J. B., Macedo-Ribeiro, S., Párraga, A., Pérez-Luque, R., Cunningham, O., Darcy, K., Mantle, T. J. & Coll, M. (2001). Nature Struct. Biol. 8, 215–220. [DOI] [PubMed]
- Persson, B., Krook, M. & Jörnvall, H. (1991). Eur. J. Biochem. 200, 537–543. [DOI] [PubMed]
- Persson, B., Zigler, J. S. & Jörnvall, H. (1994). Eur. J. Biochem. 226, 15–22. [DOI] [PubMed]
- Powell, A. J., Read, J. A., Banfield, M. J., Gunn-Moore, F., Yan, S. D., Lustbader, J., Stern, A. R., Stern, D. M. & Brady, R. L. (2000). J. Mol. Biol. 303, 311–327. [DOI] [PubMed]
- Radianingtyas, H. & Wright, P. C. (2003). FEMS Microbiol. Rev. 27, 593–616. [DOI] [PubMed]
- Ring, M. W., Schwär, G., Thiel, V., Dickschat, J. S., Kroppenstedt, R. M., Schulz, S. & Bode, H. B. (2006). J. Biol. Chem. 281, 36691–36700. [DOI] [PubMed]
- Sanghani, P. C., Stone, C. L., Ray, B. D., Pindel, E. V., Hurley, T. D. & Bosron, W. F. (2000). Biochemistry, 39, 10720–10729. [DOI] [PubMed]
- Schomaker, V. & Trueblood, K. N. (1968). Acta Cryst. B24, 63–76.
- Terwilliger, T. C., Adams, P. D., Read, R. J., McCoy, A. J., Moriarty, N. W., Grosse-Kunstleve, R. W., Afonine, P. V., Zwart, P. H. & Hung, L.-W. (2009). Acta Cryst. D65, 582–601. [DOI] [PMC free article] [PubMed]
- Toal, D. R., Clifton, S. W., Roe, B. A. & Downard, J. (1995). Mol. Microbiol. 16, 177–189. [DOI] [PubMed]
- Vitale, A., Rosso, F., Barbarisi, A., Labella, T. & D’Auria, S. (2010). Gene, 461, 26–31. [DOI] [PubMed]
- Vitale, A., Thorne, N., Lovell, S., Battaile, K. P., Hu, X., Shen, M., D’Auria, S. & Auld, D. S. (2013). PLoS One, 8, e63828. [DOI] [PMC free article] [PubMed]
- Winn, M. D. et al. (2011). Acta Cryst. D67, 235–242.
- Youn, B., Camacho, R., Moinuddin, S. G. A., Lee, C., Davin, L. B., Lewis, N. G. & Kang, C. (2006). Org. Biomol. Chem. 4, 1687–1697. [DOI] [PubMed]
- Zheng, Q., Song, Y., Zhang, W., Shaw, N., Zhou, W. & Rao, Z. (2015). FEBS J. 282, 2697–2707. [DOI] [PubMed]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
PDB reference: AibC, 5kis



