Skip to main content
The Journal of Biological Chemistry logoLink to The Journal of Biological Chemistry
. 2016 Aug 17;291(42):21857–21868. doi: 10.1074/jbc.M116.743435

The N Terminus of the Prion Protein Mediates Functional Interactions with the Neuronal Cell Adhesion Molecule (NCAM) Fibronectin Domain*

Urška Slapšak ‡, Giulia Salzano §, Ladan Amin §, Romany N N Abskharon ¶,‖,**, Gregor Ilc ‡,‡‡, Blaž Zupančič ‡, Ivana Biljan §§, Janez Plavec ‡,‡‡,¶¶,1, Gabriele Giachin §,‖‖, Giuseppe Legname §,2
PMCID: PMC5063971  PMID: 27535221

Abstract

The cellular form of the prion protein (PrPC) is a highly conserved glycoprotein mostly expressed in the central and peripheral nervous systems by different cell types in mammals. A misfolded, pathogenic isoform, denoted as prion, is related to a class of neurodegenerative diseases known as transmissible spongiform encephalopathy. PrPC function has not been unequivocally clarified, and it is rather defined as a pleiotropic protein likely acting as a dynamic cell surface scaffolding protein for the assembly of different signaling modules. Among the variety of PrPC protein interactors, the neuronal cell adhesion molecule (NCAM) has been studied in vivo, but the structural basis of this functional interaction is still a matter of debate. Here we focused on the structural determinants responsible for human PrPC (HuPrP) and NCAM interaction using stimulated emission depletion (STED) nanoscopy, SPR, and NMR spectroscopy approaches. PrPC co-localizes with NCAM in mouse hippocampal neurons, and this interaction is mainly mediated by the intrinsically disordered PrPC N-terminal tail, which binds with high affinity to the NCAM fibronectin type-3 domain. NMR structural investigations revealed surface-interacting epitopes governing the interaction between HuPrP N terminus and the second module of the NCAM fibronectin type-3 domain. Our data provided molecular details about the interaction between HuPrP and the NCAM fibronectin domain, and revealed a new role of PrPC N terminus as a dynamic and functional element responsible for protein-protein interaction.

Keywords: cell adhesion, fibronectin, nuclear magnetic resonance (NMR), prion, protein-protein interaction, NCAM, NMR spectroscopy, prion protein, fibronectin type-3 domain, stimulated emission depletion microscopy, STED

Introduction

A misfolded form of the host-encoded cellular prion protein (PrPC)3 is the causative agent for a class of human and animal neurodegenerative diseases denoted as transmissible spongiform encephalopathies. PrPC is a sialoglycoprotein, tethered to the outer leaflet of the plasma membrane by a glycosylphosphatidylinositol (GPI) anchor. Soluble, natively α-helix-folded monomers of PrPC may adopt an aggregated protease-resistant conformation known as PrPSc (1). The mature human PrPC (HuPrP) is composed of 209 residues including a largely unstructured N-terminal part and a globular α-helix-rich C-terminal domain (2). Conversely, PrPSc is β-sheet-enriched, partially protease-resistant, insoluble, and multimeric (3). The insoluble nature of PrPSc and its propensity to aggregate have hampered the use of high-resolution techniques, and therefore different PrPSc models currently exist (4).

Despite the fact that PrPC is highly conserved among different species, its physiological function has not been fully clarified. Defining PrPC function remains one of the main challenges in prion biology, and it is also an absolute requirement for understanding prion diseases. It is now being accepted that PrPC is a pivotal molecule with diverse roles in brain development and in neural plasticity in the adult (5–8). Proposed PrPC functions range from neuronal growth and differentiation (9), synaptic plasticity (10, 11), cell signaling (12, 13), NMDA receptor regulation (14, 15), and brain metal homeostasis (16). Putative functions are based on PrPC-interacting molecules present on the cell surface, such as the 37-kDa/67-kDa laminin receptor, the stress-inducible protein 1, and vitronectin (17–19). Among the different PrPC protein interactors, the neuronal cell adhesion molecule (NCAM) has been extensively characterized in vitro, in cell-based assays, and in vivo (13, 20–23).

NCAM belongs to Ig superfamily cell adhesion molecules (CAMs), and it is present on the cell surface of neurons, astrocytes, and oligodendrocytes, where it mediates homophilic and heterophilic cell adhesion (24). NCAM is involved in neuronal migration, axon growth, and guidance, as well as in synaptic plasticity associated with learning and memory (25). Alternative splicing of the NCAM1 gene results in isoforms of three size classes that differ in their membrane attachment and cytosolic regions: NCAM-180, NCAM-140 (with intracellular domains consisting of 386 and 120 amino acids, respectively), and NCAM-120 (lacking the intracellular domain and linked to the membrane by a GPI anchor). NCAM isoforms share an extracellular domain consisting of five Igs and two fibronectin type-3 (FNIII1,2) domains. Variable use of alternative exons in the extracellular domain results in small insertions into Ig4 or between the FNIII1,2 domains. NCAM function is further regulated by an unusual posttranslational modification consisting of the addition of polysialic acid to Ig5 (26, 27). Although a complete picture has yet to emerge, it appears that NCAM physiological function is mediated by multiple modes of homophilic interaction through the NCAM Ig domains (28). Additionally, NCAM is also engaged in heterophilic interactions, i.e. NCAM can bind other protein partners modulating different functions. Different groups have investigated the structural and molecular basis governing the interaction between the NCAM FNIII1,2 domain and the fibroblast growth factor receptor 1 (FGFR1) (29, 30).

Besides the interaction with FGFR1, NCAM can bind PrPC and engages different cellular responses. PrPC-NCAM binding induces NCAM redistribution in lipid rafts, leading to FYN tyrosine kinase activation and neurite outgrowth (13). ELISA experiments using an NCAM-derived peptide library against the recombinant full-length mouse prion protein (MoPrP) have shown that the FNIII1,2 domain shares highest affinity for MoPrP (21). As revealed by in situ cross-linking of MoPrP deletion mutants expressed in cell models, the PrPC-binding site seems to be formed by the N terminus and a segment comprising α-helix 1 (21). However, PrPC-NCAM interacting surfaces have not been described at the structural and biophysical levels yet. Recently, it has been observed that PrPC controls polysialylation of NCAM during cellular morphogenesis (23). Current evidence strengthens the hypothesis that the FNIII1,2 domain plays a role for NCAM-mediated heterophilic interaction; therefore this domain may represent a useful model for structural studies aiming at understanding the molecular determinants of PrPC-NCAM interaction.

Here we have performed cell biology, biophysical, and structural investigations on the interaction between the FNIII1,2 domain and HuPrP. Despite the inherent structural disorder of the PrPC N-terminal domain, which can mediate its interaction with both metals and cellular polyanions (e.g. sulfate proteoglycans) (31), binding with physiological protein partners has not been proved yet. HuPrP segments that are able to interact with the FNIII1,2 domain were identified by SPR experiments. NMR chemical shift perturbation experiments allowed us to identify binding sites on the FNIII1,2 domain involved in the interaction with the HuPrP. The module 2 (FNIII2) of the fibronectin type-3 domain and peptides covering different parts of the HuPrP were employed as a model system. Additionally, we examined the effect of a pathological amino acid substitution, P102L, the prototypical mutation linked to a genetic form of human prion disease denoted as Gerstmann-Straussler-Scheinker disease (GSS), on binding to FNIII2. Interestingly, this mutation also unveiled a new hidden binding site corresponding to the non-octarepeat copper-binding site (32). These results may provide a structural understanding of the interaction of NCAM with PrPC and where the binding site is located. Besides, the novel insight of the effect of HuPrP bearing the pathogenic point mutation P102L on its interaction with the FNIII2 domain is introduced here.

Results

NCAM Co-localizes with PrPC

Functional interactions of PrPC with its binding partner(s) have been suggested previously (13): cis and trans interactions between NCAM and PrPC promote neurite outgrowth, and the disruption of these interactions indicates that PrPC is involved in nervous system development cooperating with NCAM as a signaling receptor.

In this study, we used stimulated emission depletion (STED) nanoscopy to confirm the association between PrPC and NCAM in mouse hippocampal culture. We determined simultaneously the cellular distribution of PrPC, NCAM, and actin (Fig. 1A). PrPC and NCAM share very similar distributions along the neurite and in hippocampal growth cones (GC). The staining for PrPC and NCAM was preferentially localized in the central domain and transition zone of the GC membrane (Fig. 1A, arrows). By using STED nanoscopy, we were able to detect very low co-localization between PrPC and NCAM, whereas treatment with 1 μm nerve growth factor (NGF) results in increased co-localization (Fig. 1B). The observed higher association between PrPC and NCAM in treated cultures suggested that these proteins might functionally cooperate to transduce signals into the cell interior, which in turn trigger the neurite growth.

FIGURE 1.

FIGURE 1.

PrP-NCAM interaction in vitro. A, STED images of GC stained for PrP, NCAM, and actin, and merge of the PrP and NCAM in control condition. Scale bar, 500 nm. A1 and A2, high-resolution images of areas indicated in A. Scale bar, 250 nm. B, as in A, except that neurons were incubated with 1 μm NGF (2 h).

FNIII1,2 Domain Binds to HuPrP N-terminal Domain with High Affinity

SPR experiments were used to analyze the binding of the FNIII1,2 domain to different HuPrP and MoPrP constructs, including full-length HuPrP and MoPrP (i.e. from residues 23 to 231 and 23 to 230, respectively), the HuPrP N-terminal domain (residues 23–144), and the truncated C-terminal HuPrP and MoPrP (residues 90–231 and 89–230, respectively). We observed strong interaction between the FNIII1,2 domain and the HuPrP N-terminal domain with Kd of 5.4 nm. Also the full-length HuPrP binds to the FNIII1,2 domain (Kd of 337 nm), whereas for the truncated HuPrP, we were not able to report any interaction. The full-length MoPrP displayed a weak affinity for the FNIII1,2 domain (Kd 3.8 μm), whereas the truncated MoPrP behaved almost identically to the truncated HuPrP, displaying no interaction with the FNIII1,2 domain (Table 1 and Fig. 2). Additionally, we confirmed that a short NCAM peptide, named BCL, corresponding to the sequence of residues 620–635 in the FNIII1,2 domain, is able to interact with HuPrP using ELISA (Fig. 3). Peptide BCL also binds to MoPrP (21), and it is considered an NCAM mimetic peptide employed as NCAM surrogate in pharmacological experiments (34). These data add more insights about the HuPrP regions involved in the interaction with the FNIII1,2 domain, showing that this binding is largely mediated by the unstructured N-terminal HuPrP domain.

TABLE 1.

Dissociation constants for the interaction between FNIII (immobilized) and different HuPrP and MoPrP constructs

NA, not applicable.

Protein Kd Kon Koff
nm 1/ms 1/s
HuPrP(23–231) 337 2.00E+05 0.0674
HuPrP(90–231) NA NA NA
HuPrP(23–144) 5.4 1.42E+06 7.66E-03
MoPrP(23–230) 3800 2.58E+04 0.0983
MoPrP(89–230) NA NA NA
FIGURE 2.

FIGURE 2.

SPR analysis of the FNIII-HuPrP or MoPrP interactions. Shown are raw sensorgrams obtained on a Biacore 2000 instrument. Selected curves are labeled with the respective analyte concentration. A–C, the binding of full-length HuPrP (A), HuPrP N terminus (B), and full-length MoPrP (C) to immobilized FNIII. RU, response units.

FIGURE 3.

FIGURE 3.

ELISA showing the interaction between BCL peptide (620-NLIKQDDGGSPIRHYL-635) and full-length HuPrP. AU, arbitrary units. Error bars indicate ± S.E.

FNIII2 Domain Was Used for NMR Characterization of Binding between HuPrP and NCAM

NMR spectroscopy is an excellent tool to evaluate and characterize the binding properties of HuPrP and NCAM in solution at atomic level. Unambiguous assignment of HuPrP(23–144) residues was not possible because of high signal overlap in the 15N HSQC spectrum, which was due to the high percentage of glycine residues, octarepeats, and intrinsically disordered properties of the unstructured N terminus (supplemental Fig. S1A). Thus, we focused of the HuPrP interaction partner instead. 15N,13C-labeled FNIII1 and FNIII2 domains of NCAM were produced to find a suitable candidate for the evaluation of HuPrP-NCAM binding properties. The 15N HSQC spectra of the FNIII1,2 (supplemental Fig. S1, B–D), FNIII1, and FNIII2 (Fig. 4) domains were recorded. The FNIII1,2 and FNIII1 domains did not exhibit suitable NMR properties for further analysis, whereas for the FNIII2 segment (with a molecular mass of 11.8 kDa), a complete NMR analysis has been carried out.

FIGURE 4.

FIGURE 4.

15N HSQC spectrum of FNIII2 domain with assignment of backbone amino acid residues indicated.

The 15N HSQC spectrum of the FNIII2 domain demonstrated good dispersion of cross-peaks, indicating the potential for detailed structure characterization (Fig. 4). The sequence-specific assignment was performed with the use of standard triple resonance NMR experiments to obtain the structure at atomic resolution. The structure of the FNIII2 domain was calculated using 778 intra-residual and sequential restraints, 108 medium-range and 772 long-range distance restraints, and 136 backbone torsion angle restraints (Table 2). The calculated three-dimensional model showed that the FNIII2 domain consists of six antiparallel β-strands, marked A–F on Fig. 5. They are arranged into two right-handed β-sheets that form a β-sandwich. The first β-sheet is composed of strands A and D (residues Ser616–Asn620 and His657–Lys661, respectively), whereas the second β-sheet is composed of strands B, C, E, and F (residues Ile631–Ala640, Ile649–Pro652, Tyr669–Asn677, and Ala685–Phe687, respectively).

TABLE 2.

NMR restraints and structural statistics for the ensemble of 20 lowest-energy structures of the FNIII2 domain

NOE upper distance limitsa
    Total 1658
    Intra-residue (|i − j| = 0) 337
    Sequential (|i − j| = 1) 441
    Medium-range (1 < |i − j| < 5) 108
    Long-range (|i − j| > = 5) 772

Torsion angle restraints
    Backbone (ϕ/ψ) 136

RMSD to the mean coordinates (Å)
    Ordered backbone atoms (595–691) 0.28 ± 0.09
    Ordered heavy atoms (595–691) 0.78 ± 0.08

Ramachandran plot (595–691)b
    Residues in most favored regions (%) 88.8
    Residues in additional allowed regions (%) 11.2

Structure Z-scoresb
    1st generation packing quality −0.419 ± 0.568
    2nd generation packing quality 7.386 ± 2.149
    Ramachandran plot appearance −3.376 ± 0.339
    χ-1/χ-2 rotamer normality −6.283 ± 0.259
    Backbone conformation −0.441 ± 0.137

RMS Z-scoresb
    Bond lengths 1.201 ± 0.004
    Bond angles 0.581 ± 0.008
    ω angle restraints 0.758 ± 0.030
    Side chain planarity 0.437 ± 0.029
    Improper dihedral distribution 0.779 ± 0.016
    Inside/Outside distribution 1.029 ± 0.011

a None of the 20 structures exhibit distance violations over 0.2 Å and torsion angle violation over 5°.

b Ensemble of structures was analyzed by the PROCHECK-NMR and WhatIF programs incorporated in the CING structure evaluation package (54) and PSVS (55).

FIGURE 5.

FIGURE 5.

Ensemble of 20 lowest-energy structures of FNIII2 domain (residues 595–691). The β-strands are highlighted using letter codes (Protein Data Bank ID 5LKN).

NMR approaches of biomolecular complexes are usually challenging because of the increase of molecular weight due to the interaction between partners. Clearly, a large number of similar cross-peaks will be observed and will result in the overlapped spectra and increased linewidths associated with the slower tumbling of a high molecular mass complex. Note that increased line widths of cross-peaks are also expected in the spectrum. Moreover, sometimes, macromolecular interactions lead to several line broadenings through the enhanced relaxation that resulted in decrease and even loss of cross-peaks of interest (35, 36). Multidimensional heteronuclear NMR experiments were used to evaluate binding properties between the FNIII2 domain and N-terminal HuPrP(23–144). Interestingly, no amide chemical shift changes (Δδ(H,N)) were observed in the 15N HSQC spectrum of the FNIII2 domain during a titration experiment with HuPrP(23–144) at pH 7.0 (Fig. 6A). However, the FNIII2 sample became blurred upon rising concentration of HuPrP(23–144), presumably because of interactions between partners that also led to insoluble aggregates. Analysis of cross-peak linewidths and absence of chemical shift changes in the 15N HSQC spectra of FNIII2 resulted in the conclusion that cross-peaks correspond to the unbound state of the labeled FNIII2 domain. Additionally, we tried to thermally disrupt multimeric complex at 45 °C to gain the monomeric form of the complex. Although the sample cleared up, indicating that the multimers fell apart, the 15N HSQC spectrum did not improve after thermal treatment. Certainly, even smaller multimeric complexes were still too big to be observed by NMR. Titration was replicated at pH 6. The pH was decreased to achieve favorable conditions where the complex would not precipitate and would be stable often enough that we could observe chemical shift changes of the recorded the 15N HSQC spectra of FNIII2 upon rising concentration of HuPrP peptides. Δδ(H,N) were observed in the 15N HSQC spectra of the FNIII2 domain at a ratio 1:0.5 for residues Arg599, Glu600, Gly614, Arg639, Ser642, Asp656, Ser664, Tyr669, Tyr672, Gln678, Lys683, His686, and Val688 (Fig. 7A). However, the cross-peaks in the 15N HSQC spectra of the FNIII2 domain disappeared at the ratio 1:2, most likely because of the stacking and forming of aggregates, similarly as observed at higher pH.

FIGURE 6.

FIGURE 6.

15N HSQC spectra of FNIII2 domain overlaid with 15N HSQC spectra of FNIII2 domain titrated with peptides originating from HuPrP. A, HuPrP(23–144). B, HuPrP(60–68). C, HuPrP(93–114), HuPrP(93–114). D, HuPrP(23–50). The HuPrP peptide to FNIII2 equivalents and pH values are indicated with the corresponding spectra.

FIGURE 7.

FIGURE 7.

Overlays of 15N HSQC spectra of FNIII2 domain in the presence of peptides originating from HuPrP at pH 6. A, HuPrP(23–144). B, HuPrP(23–89). C, HuPrP(93–114, P102L). The HuPrP peptide to FNIII2 equivalents are indicated with the corresponding spectra.

Interactions between FNIII2 Domain and Peptides Originate from HuPrP N Terminus

To determine the epitope on HuPrP, its N-terminal part was divided into smaller fragments. Gradual titrations of the FNIII2 domain with individual peptides HuPrP(23–89), HuPrP(23–50), HuPrP(60–68), HuPrP(93–114), and HuPrP(93–114, P102L) were performed to the final ratio between the protein and peptides of 1:2. Upon titrations with HuPrP(23–89), HuPrP(93–114), and HuPrP(93–114, P102L), the Δδ(H,N) values were observed in the 15N HSQC spectra of the FNIII2 domain (Figs. 6C and 7, B and C). In contrast, we did not identify any Δδ(H,N) values of the FNIII2 domain with peptide HuPrP(60–68) and negligible ones with peptide HuPrP(23–50) (Fig. 6, B and D, respectively). For all titration studies, the Δδ(H,N) values of the FNIII2 domain were calculated using Equation 1 (see “Experimental Procedures”). Titrations with peptides HuPrP(23–144), HuPrP(23–89), and HuPrP(93–114, P102L) resulted in the biggest Δδ(H,N) values of the FNIII2 domain. Interestingly, the biggest Δδ(H,N) values were observed for residues Tyr669, Val673, His686, Phe687, and Val688 of the FNIII2 domain. Other cross-peaks of the FNIII2 domain exhibit negligible chemical shift changes. Detailed analysis of the Δδ(H,N) values for the FNIII2 domain presented in Fig. 8 led us to conclude that residues Tyr669, Val673, His686, Phe687, and Val688 of the FNIII2 domain are involved in the interaction with HuPrP.

FIGURE 8.

FIGURE 8.

Chemical shift changes Δδ(H,N) for FNIII2 domain upon interaction with peptides originating from HuPrP at pH 6. 0. A, HuPrP(23–144) peptide at ratio 1:0.5. B, HuPrP(93–114, P102L) at ratio 1:2. C, HuPrP(23–89) at ratio 1:2. The Δδ(H,N) values were calculated using Equation 1 (see “Experimental Procedures”).

Interactions between FNIII2 Domain and HuPrP(93–114, P102L)

Because peptide HuPrP(93–114, P102L) exhibited the strongest interactions with the FNIII2 domain, we examined the effects of the interaction on the peptide as well. The 15N HSQC, NOESY, TOCSY, and 13C HSQC spectra of aliphatic and aromatic regions were used for chemical shift assignment of unlabeled peptide. 13C-15N ω1-filtered 2D NOESY/TOCSY and 13C-15N ω1-filtered 3D 15N HSQC-NOESY were used to determine inter- and intramolecular contacts in complex. Upon binding, no intermolecular contacts were observed in 13C-15N ω1-filtered 2D NOESY. The largest intramolecular chemical shift changes were observed for cross-peaks in 13C-15N ω1-filtered 2D TOCSY of amino acids Trp99, His111, Met112, and Ala113 of HuPrP(93–114, P102L).

Experimental data therefore indicate that amino acid residues Tyr669, Val673, His686, Phe687, and Val688 of the FNIII2 domain and Trp99, His111, Met112, and Ala113 of HuPrP(93–114, P102L) are most probably involved in the interaction of the NCAM domain and WT HuPrP. These data were used as docking restraints for HADDOCK calculation (37, 38). 131 lowest-energy structures were grouped into 13 clusters according to RMSD values. The numbers of structures in the 10 best clusters varied from 4 to 34 with their HADDOCK scores ranging from 71.8 to 53.5. The clusters could be split into two groups of similar size. The first model describes the interactions between Trp99 on HuPrP(93–114, P102L) and the FNIII2 domain, whereas the second one describes the interactions of His111–Ala113 with HuPrP(93–114, P102L) and the FNIII2 domain (Fig. 9).

FIGURE 9.

FIGURE 9.

Low-resolution model of complex between FNIII2 domain and HuPrP(93–114, P102L). A, ensemble of 40 models of the complex between the FNIII2 domain (pink) and HuPrP(93–114, P102L) (green or orange depending on whether it interacts with His111–Ala113 or Trp99, respectively) clustered by the HADDOCK program (4 models from each of 10 clusters). B, enlarged binding region of the best HADDOCK model of the FNIII2 domain-HuPrP(93–114, P102L) complex. Amino acids involved in the interaction are presented with balls and sticks (FNIII2 domain in blue, HuPrP(93–114, P102L) in green).

Discussion

Among the variety of PrPC protein interactors (37), PrPC associates with NCAM in vivo. Both molecules have been independently implicated in nervous system development and may play a role in neural stem cells (9, 38, 40). PrPC recruits to and stabilizes the transmembrane NCAM isoforms (NCAM-180 and NCAM-140) in lipid-rich microdomains. This activates FYN kinase and promotes neurite outgrowth by cis and trans interactions (13, 41). The interaction of these two molecules and their relation to specific signaling pathways during neurodevelopment merits further investigation at the structural and molecular level, not the least because the physiological role of PrPC may provide novel insights into the neuropathology of prion diseases.

Along this line, the structural basis of the cross-talk between PrPC and NCAM has not been previously investigated. In this study, we have performed a structural investigation on the interaction between the recombinant FNIII2 domain of NCAM and different peptides originating from N-terminal human PrPC using different experimental approaches.

The in vitro experiments designed to confirm the co-localization of PrPC and NCAM in hippocampal neuron cultures led us toward a better understanding of this interaction. We have identified the HuPrP and MoPrP segments able to interact with the FNIII1,2 domain by means of SPR experiments. These experiments have unveiled that the N-terminal HuPrP domain mediates the FNIII1,2 domain binding with high affinity.

X-ray approaches have been previously applied to better understand the structural properties of the FNIII1,2 domain (42). Interestingly, the comparison between the FNIII2 NMR structure and the corresponding x-ray structure revealed local structural differences in the length of β-strands. In particular, although the NMR structure features two short β-strands (A and D) on one protein side and four β-strands (B, C, E, and F) on the other, the x-ray structure is characterized by seven β-strands (supplemental Fig. S2). Structural discrepancies between diffraction and NMR data are to be expected considering the differences of the two methods in terms of spatial distribution of the molecules in the sample and time scales accessible to each method. Notably, solution NMR data represent an average over semi-randomly oriented molecules in solution detected in a nanosecond-to-second time regime, whereas diffraction data represent an average over molecules arranged in a periodic crystal lattice acquired in a seconds time scale.

We have performed NMR experiments designed to identify the binding sites on the FNIII2 domain and HuPrP N terminus responsible for the interaction. The implications of our findings are important in prion biology as we provide the first structural evidence that NCAM mediates the interaction with the N-terminal domain of HuPrP through its FNIII1,2 domain. We propose a model where this largely unstructured segment acts as a dynamic element able to recruit NCAM molecules and to mediate physiological processes. We found that the WT HuPrP mediates binding with the FNIII2 domain via its N-terminal segment (residues 23–144). Interestingly, the N terminus contains a glycosaminoglycan (GAG)-binding motif. The binding of GAG is important in prion diseases. This idea is supported by evidence that mutant recombinant PrP binds more GAG, which promotes the aggregation of mutant recombinant PrP more efficiently than HuPrP wild type (43). Thus, our present data corroborate the idea that besides binding metal ions and GAG, the N-terminal domain also mediates cis interactions with the NCAM fibronectin domain.

As opposed to WT HuPrP, the P102L mutant seems to possess an extra binding site localized in the segment 93–114, also denoted as the non-octarepeat copper-binding site (32, 44). Peptides HuPrP(93–114) and HuPrP(93–114, P102L) have the same position in HuPrP N terminus except for the proline-to-leucine substitution at residue 102. Comparison of the Δδ(H,N) values for the FNIII2 domain after titration with both HuPrP(93–114) and HuPrP(93–114, P102L) led to a conclusion that the interaction of the latter with the FNIII2 domain is stronger. Thus, we argue that P102L mutation may affect binding with the FNIII2 domain, presumably leading to a stronger interaction with NCAM, which in turn may lead to abnormal Src family kinase activation.

These findings about the interaction between HuPrP and NCAM may have biological relevance on prion conversion. Different compounds, including antibodies or chemical drugs, with high affinity for PrPC have been employed as candidates for therapeutic approaches aimed at inhibiting prion replication. This approach postulates that any PrPC ligand acts as molecular chaperone able to stabilize the protein folding, thus limiting the conversion to PrPSc. NCAM does not play a direct role during prion formation as observed in NCAM knock-out mice showing the same incubation period when compared with wild-type mice infected by prions (21). It is plausible that any interference with NCAM-mediated signaling in the diseased brain may favor cell death and inhibit synaptic plasticity. The interactions between PrPC and NCAM could therefore be reduced by accumulation of PrPSc in the diseased nervous system. Thus, it is conceivable that the association of NCAM to PrPC favors functional signaling pathways through FYN, which is also implicated in synaptic functions. Furthermore, PrPC-NCAM crosstalk is crucial for the coordinated regulation of cell cycle progression and the differentiation of neuronal precursors toward different neuronal phenotypes (40). We found that this interaction is mediated by the PrPC N terminus, particularly in the segment from residues 23 to 50. This includes four positively charged residues (i.e. KKRPK) known to play a role in the PrPC endocytic trafficking and in its localization to lipid rafts (45, 46). Our study suggests that the interaction between residues 23–50 and the NCAM fibronectin domain may determine the fate of PrPC in the cell surface raft domain. Here PrPC participates in the complex molecular networks and signaling mechanisms, both cell-intrinsic and cell-extrinsic, that influence cell fate and differentiation.

The mechanisms that recruit and assemble different transmembrane signaling molecules to distinct membrane subdomains have only started to emerge. In these environments, signaling and scaffolding proteins can self-associate and form dimeric or multimeric assemblies. Protein dimerization has been reported as a common mechanism to cluster downstream signaling components and thereby enhance the signaling cascade (47). According to a recent model, NCAM is present on the cell surface as cis dimers, formed by the interactions between the Ig1 and Ig2 domains (48, 49). The role of cis dimerization in NCAM dimerization is debated, but it is a prerequisite for NCAM clustering on the cell surface, which in turn results in cell-cell adhesion via trans interactions between NCAM clusters.

We described a strong interaction between HuPrP N terminus and FNIII1,2 and the formation of multimeric complexes formed upon the addition of FNIII2 to HuPrP(23–144). This may have important physiological implications as PrPC may act as a scaffolding protein able to facilitate the FNIII1,2-mediated NCAM self-assembly and clustering in the lipid raft.

In conclusion, we provide structural evidence that NCAM mediates a heterophilic interaction through FNIII1,2 and the N-terminal domain of HuPrP. Importantly, we propose that this largely unstructured segment acts as dynamic element able to recruit NCAM molecules and to mediate physiological processes.

Experimental Procedures

Cell Culture

P1-P2 FVB WT mice were sacrificed by decapitation in accordance with the guidelines of the Italian Animal Welfare Act.

Immunostaining

Cells were fixed in 4% paraformaldehyde containing 0.15% picric acid in PBS, saturated with 0.1 m glycine, permeabilized with 0.1% Triton X-100, saturated with 0.5% BSA (all from Sigma-Aldrich) in PBS, and then incubated for 1 h with primary antibodies followed by a 30-min incubation with secondary antibodies conjugated with STAR580 or STAR635P (Abberior, Göttingen, Germany). All incubations were performed at room temperature (20–22 °C).

STED Microscopy

Two-color STED microscopy was performed at the NanoBiophotonics Department (Max Plank Institute for Biophysical Chemistry, Göttingen, Germany) (50) equipped with 561- and 640-nm pulsed excitation lasers, a pulsed 775-nm STED laser, and a 100× oil immersion objective lens (NA 1.4).

Plasmid Construction

The FNIII1,2 and FNIII2 domains were PCR-amplified from pCEP-Pu vector encoding for FNIII1,2 (kindly provided by Dr. Federico Carafoli, Imperial College London, London, UK) and inserted into a modified pET11a vector (i.e. carrying a C-terminal uncleavable His tag) using a restriction-free cloning protocol. Our FNIII1,2 and FNIII1 numbering schemes correspond to Carafoli et al. (42).

Protein Expression and Purification

A freshly transformed overnight culture of Escherichia coli BL21 (DE3) cells (Stratagene) transformed with pET11a encoding for FNIII1,2 or FNIII2 was added at 37 °C to 2 liters of minimal medium. For isotope labeling, 4 g/liter [13C6]glucose and 1 g/liter [15N]ammonium chloride were added. At 0.8 A600, expression was induced with isopropyl-β-d-galactopyranoside to a final concentration of 0.25 mm. Cells were grown in a BIOSTAT B plus 2-liter vessel (Sartorius) and harvested 18 h after inoculation. Bacterial paste was resuspended in 25 mm Tris-HCl, 0.8% Triton X-100, 1 mm PMSF, pH 8, and lysed by a Panda homogenizer. Crude extract was loaded onto a 5-ml HisTrap column (GE Healthcare) equilibrated in PBS buffer, pH 7.45 (140 mm NaCl, 10 mm Na2PO4, and 3 mm KCl), and then eluted with 500 mm imidazole in PBS. The protein was then dialyzed against TBS buffer, pH 7.45, using a Spectra/Por membrane (molecular weight, 10,000).

The HuPrP(23–231), HuPrP(90–231), and HuPrP(23–144) were expressed, purified, and in vitro refolded according to our previous protocols (32). Peptides HuPrP(23–89), HuPrP(23–50), HuPrP(60–68), HuPrP(93–114), and HuPrP(93–114, P102L) (Table 3) were purchased from Chematek SpA.

TABLE 3.

Amino acid sequences of peptides originating from N-terminal HuPrP that were used for characterization of binding properties between HuPrP and NCAM

Names of peptides Amino acidic sequences
HuPrP(23–144) KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSD
HuPrP(23–89) KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGW
HuPrP(23–50) KKRPKPGGWNTGGSRYPGQGSPGGNRYP
HuPrP(93–114) GGTHSQWNKPSKPKTNMKHMAG
HuPrP(93–114, P102L) GGTHSQWNKLSKPKTNMKHMAG
HuPrP(60–68) PHGGGWGQ
NCAM-PrP Affinities Were Determined Using Surface Plasmon Resonance

Binding kinetics were determined on Biacore 2000 (GE Healthcare). Ten μg of NCAM was diluted in 10 mm NaOAc, pH 5.2, and immobilized on a CM5 chip activated with NHS and N-ethyl-N-(3-dimethylaminopropyl) carbodiimide (EDC), using a flow rate of 5 μl/min. A steady signal of about 400 response units was obtained after immobilization and blocking with ethanol amine. All kinetic SPR analyses were run at a flow rate of 30 μl/min in PBS, 0.05% Tween 20, and 3 mm EDTA at 25 °C. After each cycle, the surface was regenerated with a 60-s pulse of 100 mm glycine, pH 1.5. Association rates (Kon) and dissociation rates (Koff) were obtained using a 1:1 Langmuir binding model (Biacore evaluation software version 4.1). The equilibrium dissociation constant (Kd) was calculated from the ratio Koff/Kon.

Confirming BCL-HuPrP Interaction with ELISA

BCL was immobilized at 0.5 μm and titrated with full-length HuPrP (0–5 μm). Antigen was detected using anti-PrPC SAF34 antibody that recognizes an epitope corresponding to the octapeptide repeat region (residues 60–91) (51).

NMR Spectroscopy

All NMR experiments used for structure determination were performed on 13C,15N isotopically labeled FNIII2 domain on the Varian VNMRS 800-MHz NMR spectrometer equipped with a triple 1H/13C/15N resonance cryogenic probe head with inverse detection at 298 K. The NMR sample contained 0.9 mm FNIII2 domain in 50 mm TBS buffer, pH 7.45, and 150 mm NaCl. NMR experiments for HN and HC detection were performed in 90%/10% H2O/D2O and 100% deuterated buffer, respectively. The sequence-specific assignment of the backbone resonances for the FNIII2 domain was obtained using standard double resonance 15N HSQC and triple resonance NMR experiments HNCO, HN(CO)CA, HNCA, HN(CO)CACB, and HNCACB. 1H and 13C resonances of aliphatic and aromatic side chains were assigned using 13C HSQC and HAHB(CO)NH, CC(CO)NH, (H)CCH-TOCSY, and 13C-edited HSQC-NOESY experiments. NOE contacts were determined in 3D 15N- and 13C-edited HSQC-NOESY experiments to perform structure calculation. The structure modeling of the FNIII2 domain was performed using the program CYANA 3.0 (52). Structure refinement using the explicit solvent model was performed by the YASARA program (53). An ensemble of 20 lowest-energy structures of the FNIII2 domain was validated by the web server software ICing (54) and PSVS (55).

Titration of 13C,15N isotopically labeled FNIII2 domain with unlabeled HuPrP(23–144) was performed in 25 mm HEPES buffer, pH 7.00. Titrations of labeled FNIII2 domain were also done with unlabeled HuPrP(23–50), HuPrP(23–89), HuPrP(60–68), HuPrP(93–114), and HuPrP(93–114, P102L) peptides at pH 6.00 (20 mm NaOAc buffer, 0.35 mm labeled FNIII2 domain per titration experiment). Titrations were followed by analysis of the Δδ(H,N) of the FNIII2 domain in 15N HSQC experiments. All recorded spectra were processed by the NMRPipe (56) software and analyzed with the CARA (57) and SPARKY (58) software.

Amide chemical shift changes were calculated for each non-overlapped cross-peak in the 15N HSQC spectrum of the FNIII2 domain according to Equations 1 and 2

graphic file with name zbc04216-5343-m01.jpg
graphic file with name zbc04216-5343-m02.jpg

where ΔδH and ΔδN are defined as the difference in the 1H and 15N amide chemical shifts between the protein-peptide complex and the free state of the FNIII2 domain (59).

Modeling the Complex between FNIII2 Domain and HuPrP(93–114, P102L)

Modeling of the complex between the FNIII2 domain and HuPrP(93–114, P102L) was made with the HADDOCK software (33, 39).

Author Contributions

U. S., G. S., G. G., G. I., and B. Z. performed the NMR experiments. U. S., G. I., B. Z., I. B., and J. P. analyzed NMR data. G. L., G. S., and G. G. provided protein samples. L. A. performed and analyzed STED nanoscopy experiments. R. N. N. A. performed and analyzed SPR data. U. S., G. S., G. G., and G. L. wrote the paper. G. L., J. P., and G. G. conceived and designed the experiments. All authors read and approved the final manuscript.

Supplementary Material

Supplemental Data

Acknowledgments

Access to NMR spectrometers was funded partially through CERIC-ERIC. We acknowledge Dr. Federico Carafoli (Imperial College London, London, UK) for providing the plasmid encoding for FNIII1,2 and Dr. Dan Cojoc (IOM-CNR, Trieste, Italy) for technical support. We are grateful to Jan Steyaert (VUB, Brussels, Belgium) for providing valuable information and suggestions.

Note Added in Proof

Supplemental Fig. S1 was mistakenly duplicated as Fig. 6 in the version of this article published as a Paper in Press on August 17, 2016. This error has now been corrected and does not affect the results or conclusions of this work.

*

This work was supported by the EC through FP7 222887 “Priority” (to G. L.). This work was also supported by a fellowship from the S.H.A.R.M. project (Supporting Human Assets in Research and Mobility, funded by the Friuli Venezia Giulia autonomous Region (Italy) through the Operational Program of the European Social Fund 2007/2013; Grant agreement number FP1123744003) (to G. G.), and by the Slovenian Research Agency (ARRS) Grant P1-242. The authors declare that they have no conflicts of interest with the contents of this article.

Inline graphic

This article contains supplemental Figs. S1 and S2.

The atomic coordinates and structure factors (code 5LKN) have been deposited in the Protein Data Bank (http://wwpdb.org/).

3
The abbreviations used are:
PrP
prion protein
HuPrP
human prion protein
MoPrP
mouse prion protein
BCL
short peptide from neuronal cell adhesion molecule
FNIII1,2
two fibronectin type-3 domains
FNIII1
first module of fibronectin type-3 domain
FNIII2
second module of fibronectin type-3 domain
NCAM
neuronal cell adhesion molecule
GAG
glycosaminoglycan
GPI
glycosylphosphatidylinositol
GC
growth cone(s)
STED
stimulated emission depletion nanoscopy
HSQC
heteronuclear single quantum correlation
TOCSY
total correlation spectroscopy
RMSD
root mean square deviation.

References

  • 1. Colby D. W., and Prusiner S. B. (2011) Prions. Cold Spring Harb. Perspect. Biol. 3, a006833. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2. Zahn R., Liu A., Lührs T., Riek R., von Schroetter C., López García F., Billeter M., Calzolai L., Wider G., and Wüthrich K. (2000) NMR solution structure of the human prion protein. Proc. Natl. Acad. Sci. U.S.A. 97, 145–150 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3. Prusiner S. B. (1982) Novel proteinaceous infectious particles cause scrapie. Science 216, 136–144 [DOI] [PubMed] [Google Scholar]
  • 4. Requena J. R., and Wille H. (2014) The structure of the infectious prion protein: experimental data and molecular models. Prion 8, 60–66 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5. Collinge J., Whittington M. A., Sidle K. C. L., Smith C. J., Palmer M. S., Clarke A. R., and Jefferys J. G. R. (1994) Prion protein is necessary for normal synaptic function. Nature 370, 295–297 [DOI] [PubMed] [Google Scholar]
  • 6. Bremer J., Baumann F., Tiberi C., Wessig C., Fischer H., Schwarz P., Steele A. D., Toyka K. V., Nave K. A., Weis J., and Aguzzi A. (2010) Axonal prion protein is required for peripheral myelin maintenance. Nat. Neurosci. 13, 310–318 [DOI] [PubMed] [Google Scholar]
  • 7. Devanathan V., Jakovcevski I., Santuccione A., Li S., Lee H. J., Peles E., Leshchyns'ka I., Sytnyk V., and Schachner M. (2010) Cellular form of prion protein inhibits Reelin-mediated shedding of Caspr from the neuronal cell surface to potentiate Caspr-mediated inhibition of neurite outgrowth. J. Neurosci. 30, 9292–9305 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8. Lee Y. J., and Baskakov I. V. (2013) The cellular form of the prion protein is involved in controlling cell cycle dynamics, self-renewal, and the fate of human embryonic stem cell differentiation. J. Neurochem. 124, 310–322 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9. Steele A. D., Emsley J. G., Ozdinler P. H., Lindquist S., and Macklis J. D. (2006) Prion protein (PrPc) positively regulates neural precursor proliferation during developmental and adult mammalian neurogenesis. Proc. Natl. Acad. Sci. U.S.A. 103, 3416–3421 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10. Maglio L. E., Perez M. F., Martins V. R., Brentani R. R., and Ramirez O. A. (2004) Hippocampal synaptic plasticity in mice devoid of cellular prion protein. Brain Res. Mol. Brain Res. 131, 58–64 [DOI] [PubMed] [Google Scholar]
  • 11. Caiati M. D., Safiulina V. F., Fattorini G., Sivakumaran S., Legname G., and Cherubini E. (2013) PrPC controls via protein kinase A the direction of synaptic plasticity in the immature hippocampus. J. Neurosci. 33, 2973–2983 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12. Mouillet-Richard S., Ermonval M., Chebassier C., Laplanche J. L., Lehmann S., Launay J. M., and Kellermann O. (2000) Signal transduction through prion protein. Science 289, 1925–1928 [DOI] [PubMed] [Google Scholar]
  • 13. Santuccione A., Sytnyk V., Leshchyns'ka I., and Schachner M. (2005) Prion protein recruits its neuronal receptor NCAM to lipid rafts to activate p59fyn and to enhance neurite outgrowth. J. Cell Biol. 169, 341–354 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14. Gasperini L., Meneghetti E., Pastore B., Benetti F., and Legname G. (2015) Prion protein and copper cooperatively protect neurons by modulating NMDA receptor through S-nitrosylation. Antioxid. Redox Signal. 22, 772–784 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15. Khosravani H., Zhang Y., Tsutsui S., Hameed S., Altier C., Hamid J., Chen L., Villemaire M., Ali Z., Jirik F. R., and Zamponi G. W. (2008) Prion protein attenuates excitotoxicity by inhibiting NMDA receptors. J. Cell Biol. 181, 551–565 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16. Pushie M. J., Pickering I. J., Martin G. R., Tsutsui S., Jirik F. R., and George G. N. (2011) Prion protein expression level alters regional copper, iron and zinc content in the mouse brain. Metallomics 3, 206–214 [DOI] [PubMed] [Google Scholar]
  • 17. Santos T. G., Silva I. R., Costa-Silva B., Lepique A. P., Martins V. R., and Lopes M. H. (2011) Enhanced neural progenitor/stem cells self-renewal via the interaction of stress-inducible protein 1 with the prion protein. Stem Cells 29, 1126–1136 [DOI] [PubMed] [Google Scholar]
  • 18. Gauczynski S., Peyrin J. M., Haïk S., Leucht C., Hundt C., Rieger R., Krasemann S., Deslys J. P., Dormont D., Lasmézas C. I., and Weiss S. (2001) The 37-kDa/67-kDa laminin receptor acts as the cell-surface receptor for the cellular prion protein. EMBO J. 20, 5863–5875 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19. Hajj G. N. M., Lopes M. H., Mercadante A. F., Veiga S. S., da Silveira R. B., Santos T. G., Ribeiro K. C. B., Juliano M. A., Jacchieri S. G., Zanata S. M., and Martins V. R. (2007) Cellular prion protein interaction with vitronectin supports axonal growth and is compensated by integrins. J. Cell Sci. 120, 1915–1926 [DOI] [PubMed] [Google Scholar]
  • 20. Schmitt-Ulms G., Hansen K., Liu J., Cowdrey C., Yang J., DeArmond S. J., Cohen F. E., Prusiner S. B., and Baldwin M. A. (2004) Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues. Nat. Biotechnol. 22, 724–731 [DOI] [PubMed] [Google Scholar]
  • 21. Schmitt-Ulms G., Legname G., Baldwin M. A., Ball H. L., Bradon N., Bosque P. J., Crossin K. L., Edelman G. M., DeArmond S. J., Cohen F. E., and Prusiner S. B. (2001) Binding of neural cell adhesion molecules (N-CAMs) to the cellular prion protein. J. Mol. Biol. 314, 1209–1225 [DOI] [PubMed] [Google Scholar]
  • 22. Watts J. C., Huo H., Bai Y., Ehsani S., Jeon A. H. W., Won A. H., Shi T., Daude N., Lau A., Young R., Xu L., Carlson G. A., Williams D., Westaway D., and Schmitt-Ulms G. (2009) Interactome analyses identify ties of PrP and its mammalian paralogs to oligomannosidic N-glycans and endoplasmic reticulum-derived chaperones. PLoS Pathog. 5, e1000608. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23. Mehrabian M., Brethour D., Wang H., Xi Z., Rogaeva E., and Schmitt-Ulms G. (2015) The Prion protein controls polysialylation of neural cell adhesion molecule 1 during cellular morphogenesis. PLoS One 10, e0133741. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24. Crossin K. L., and Krushel L. A. (2000) Cellular signaling by neural cell adhesion molecules of the immunoglobulin superfamily. Dev. Dyn. 218, 260–279 [DOI] [PubMed] [Google Scholar]
  • 25. Schachner M. (1997) Neural recognition molecules and synaptic plasticity. Curr. Opin. Cell Biol. 9, 627–634 [DOI] [PubMed] [Google Scholar]
  • 26. Boutin C., Schmitz B., Cremer H., and Diestel S. (2009) NCAM expression induces neurogenesis in vivo. Eur. J. Neurosci. 30, 1209–1218 [DOI] [PubMed] [Google Scholar]
  • 27. Frei T., von Bohlen und Halbach F., Wille W., and Schachner M. (1992) Different extracellular domains of the neural cell adhesion molecule (N-CAM) are involved in different functions. J. Cell Biol. 118, 177–194 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28. Soroka V., Kasper C., and Poulsen F. M. (2010) Structural biology of NCAM. in Structure and Function of the Neural Cell Adhesion Molecule NCAM (Berezin V., ed), pp 3– 22, Springer; New York [Google Scholar]
  • 29. Kiselyov V. V., Skladchikova G., Hinsby A. M., Jensen P. H., Kulahin N., Soroka V., Pedersen N., Tsetlin V., Poulsen F. M., Berezin V., and Bock E. (2003) Structural basis for a direct interaction between FGFR1 and NCAM and evidence for a regulatory role of ATP. Structure 11, 691–701 [DOI] [PubMed] [Google Scholar]
  • 30. Kiselyov V. V., Soroka V., Berezin V., and Bock E. (2005) Structural biology of NCAM homophilic binding and activation of FGFR. J. Neurochem. 94, 1169–1179 [DOI] [PubMed] [Google Scholar]
  • 31. Taubner L. M., Bienkiewicz E. A., Copié V., and Caughey B. (2010) Structure of the flexible amino-terminal domain of prion protein bound to a sulfated glycan. J. Mol. Biol. 395, 475–490 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32. Giachin G., Mai P. T., Tran T. H., Salzano G., Benetti F., Migliorati V., Arcovito A., Della Longa S., Mancini G., D'Angelo P., and Legname G. (2015) The non-octarepeat copper binding site of the prion protein is a key regulator of prion conversion. Sci. Rep. 5, 15253. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33. Wassenaar T. A., van Dijk M., Loureiro-Ferreira N., van der Schot G., de Vries S. J., Schmitz C., van der Zwan J.., Boelens R., Giachetti A., Ferella L., Rosato A., Bertini I., Herrmann T., Jonker H. R. A., Bagaria A., et al. (2012) WeNMR: structural biology on the grid. J. Grid Comput. 10, 743–767 [Google Scholar]
  • 34. Jacobsen J., Kiselyov V., Bock E., and Berezin V. (2008) A peptide motif from the second fibronectin module of the neural cell adhesion molecule, NCAM, NLIKQDDGGSPIRHY, is a binding site for the FGF receptor. Neurochem. Res. 33, 2532–2539 [DOI] [PubMed] [Google Scholar]
  • 35. McElroy C., Manfredo A., Wendt A., Gollnick P., and Foster M. (2002) TROSY-NMR studies of the 91 kDa TRAP protein reveal allosteric control of a gene regulatory protein by ligand-altered flexibility. J. Mol. Biol. 323, 463–473 [DOI] [PubMed] [Google Scholar]
  • 36. Cavanagh J., Fairbrother W. J., Palmer A. G. III, and Skelton N. J. (1995) Protein NMR Spectroscopy: Principles and Practice, Academic Press [Google Scholar]
  • 37. Aguzzi A., Baumann F., and Bremer J. (2008) The prion's elusive reason for being. Annu. Rev. Neurosci. 31, 439–477 [DOI] [PubMed] [Google Scholar]
  • 38. Amoureux M. C., Cunningham B. A., Edelman G. M., and Crossin K. L. (2000) N-CAM binding inhibits the proliferation of hippocampal progenitor cells and promotes their differentiation to a neuronal phenotype. J. Neurosci. 20, 3631–3640 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39. de Vries S. J., van Dijk M., and Bonvin A. M. J. J. (2010) The HADDOCK web server for data-driven biomolecular docking. Nat. Protoc. 5, 883–897 [DOI] [PubMed] [Google Scholar]
  • 40. Prodromidou K., Papastefanaki F., Sklaviadis T., and Matsas R. (2014) Functional cross-talk between the cellular prion protein and the neural cell adhesion molecule is critical for neuronal differentiation of neural stem/precursor cells. Stem Cells 32, 1674–1687 [DOI] [PubMed] [Google Scholar]
  • 41. Bodrikov V., Leshchyns'ka I., Sytnyk V., Overvoorde J., den Hertog J., and Schachner M. (2005) RPTPα is essential for NCAM-mediated p59fyn activation and neurite elongation. J. Cell Biol. 168, 127–139 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42. Carafoli F., Saffell J. L., and Hohenester E. (2008) Structure of the tandem fibronectin type 3 domains of neural cell adhesion molecule. J. Mol. Biol. 377, 524–534 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43. Silva J. L., Vieira T. C., Gomes M. P., Rangel L. P., Scapin S. M., and Cordeiro Y. (2011) Experimental approaches to the interaction of the prion protein with nucleic acids and glycosaminoglycans: modulators of the pathogenic conversion. Methods 53, 306–317 [DOI] [PubMed] [Google Scholar]
  • 44. D'Angelo P., Della Longa S., Arcovito A., Mancini G., Zitolo A., Chillemi G., Giachin G., Legname G., and Benetti F. (2012) Effects of the pathological Q212P mutation on human prion protein non-octarepeat copper-binding site. Biochemistry 51, 6068–6079 [DOI] [PubMed] [Google Scholar]
  • 45. Taylor D. R., Watt N. T., Perera W. S. S., and Hooper N. M. (2005) Assigning functions to distinct regions of the N-terminus of the prion protein that are involved in its copper-stimulated, clathrin-dependent endocytosis. J. Cell Sci. 118, 5141–5153 [DOI] [PubMed] [Google Scholar]
  • 46. Walmsley A. R., Zeng F., and Hooper N. M. (2003) The N-terminal region of the prion protein ectodomain contains a lipid raft targeting determinant. J. Biol. Chem. 278, 37241–37248 [DOI] [PubMed] [Google Scholar]
  • 47. Marianayagam N. J., Sunde M., and Matthews J. M. (2004) The power of two: protein dimerization in biology. Trends Biochem. Sci. 29, 618–625 [DOI] [PubMed] [Google Scholar]
  • 48. Kulahin N., Grunnet L. G., Lundh M., Christensen D. P., Jorgensen R., Heding A., Billestrup N., Berezin V., Bock E., and Mandrup-Poulsen T. (2011) Direct demonstration of NCAM cis-dimerization and inhibitory effect of palmitoylation using the BRET2 technique. FEBS Lett. 585, 58–64 [DOI] [PubMed] [Google Scholar]
  • 49. Soroka V., Kolkova K., Kastrup J. S., Diederichs K., Breed J., Kiselyov V. V., Poulsen F. M., Larsen I. K., Welte W., Berezin V., Bock E., and Kasper C. (2003) Structure and interactions of NCAM Ig1–2-3 suggest a novel zipper mechanism for homophilic adhesion. Structure 11, 1291–1301 [DOI] [PubMed] [Google Scholar]
  • 50. Göttfert F., Wurm C. A., Mueller V., Berning S., Cordes V. C., Honigmann A., and Hell S. W. (2013) Coaligned dual-channel STED nanoscopy and molecular diffusion analysis at 20 nm resolution. Biophys. J. 105, L01–03 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51. Perrier V., Solassol J., Crozet C., Frobert Y., Mourton-Gilles C., Grassi J., and Lehmann S. (2004) Anti-PrP antibodies block PrPSc replication in prion-infected cell cultures by accelerating PrPC degradation. J. Neurochem. 89, 454–463 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52. Güntert P. (2004) Automated NMR structure calculation with CYANA. Methods Mol. Biol. 278, 353–378 [DOI] [PubMed] [Google Scholar]
  • 53. Krieger E., Koraimann G., and Vriend G. (2002) Increasing the precision of comparative models with YASARA NOVA: a self-parameterizing force field. Proteins 47, 393–402 [DOI] [PubMed] [Google Scholar]
  • 54. Doreleijers J. F., Sousa da Silva A. W., Krieger E., Nabuurs S. B., Spronk C. A. E. M., Stevens T. J., Vranken W. F., Vriend G., and Vuister G. W. (2012) CING: an integrated residue-based structure validation program suite. J. Biomol. NMR 54, 267–283 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55. Bhattacharya A., Tejero R., and Montelione G. T. (2007) Evaluating protein structures determined by structural genomics consortia. Proteins 66, 778–795 [DOI] [PubMed] [Google Scholar]
  • 56. Delaglio F., Grzesiek S., Vuister G. W., Zhu G., Pfeifer J., and Bax A. (1995) NMRPipe: a multidimensional spectral processing system based on UNIX pipes. J. Biomol. NMR 6, 277–293 [DOI] [PubMed] [Google Scholar]
  • 57. Keller R. L. J. (2004) The Computer Aided Resonance Assignment Tutorial, Institute for Molecular Biology and Biophysics, The Swiss Federal Institute of Technology, Zurich, Switzerland [Google Scholar]
  • 58. Goddard T. D., and Kneller D. G. (2008) SPARKY 3, University of California, San Francisco [Google Scholar]
  • 59. Mulder F. A., Schipper D., Bott R., and Boelens R. (1999) Altered flexibility in the substrate-binding site of related native and engineered high-alkaline Bacillus subtilisins. J. Mol. Biol. 292, 111–123 [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplemental Data

Articles from The Journal of Biological Chemistry are provided here courtesy of American Society for Biochemistry and Molecular Biology

RESOURCES