Tsai M-F, Phillips CB, Ranaghan M, Tsai C-W, Wu Y, Williams C, Miller C. 2016. Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex. eLife 5:e15545. doi: 10.7554/eLife.15545.
Published 21, April 2016
The protein sequence of EMRE from D. melanogaster, sequence #13 in Supplementary file 1, was incorrect due to a mistaken copy-and-paste while preparing the manuscript. The correct D. melanogaster sequence is now entered in the corrected Supplementary file 1. We are grateful to J. Agapite, a curator of FlyBase, who noticed the error and reported it to the senior author.
This error did not affect any results or conclusions of the paper.
Incorrect sequence:
MTSKTVFQNAFKTFLDFAINSLPSTQGGLNITATAPGGVGQRPFTNKAGVLKLIFVSASSLYIGGLIAHKGASYLEENEIFVPTDEDDDD
Corrected sequence:
MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED
The article has been corrected accordingly.
Additional files
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.