Skip to main content
Journal of Clinical Microbiology logoLink to Journal of Clinical Microbiology
. 2017 Apr 25;55(5):1454–1468. doi: 10.1128/JCM.00100-17

Neisseria gonorrhoeae Sequence Typing for Antimicrobial Resistance, a Novel Antimicrobial Resistance Multilocus Typing Scheme for Tracking Global Dissemination of N. gonorrhoeae Strains

W Demczuk a, S Sidhu a, M Unemo b, D M Whiley c, V G Allen d, J R Dillon e, M Cole f, C Seah d, E Trembizki c, D L Trees g, E N Kersh g, A J Abrams g, H J C de Vries h,i,j, A P van Dam k,l, I Medina a, A Bharat a, M R Mulvey a, G Van Domselaar a, I Martin a,✉
Editor: Alexander J McAdamm
PMCID: PMC5405263  PMID: 28228492

ABSTRACT

A curated Web-based user-friendly sequence typing tool based on antimicrobial resistance determinants in Neisseria gonorrhoeae was developed and is publicly accessible (https://ngstar.canada.ca). The N. gonorrhoeae Sequence Typing for Antimicrobial Resistance (NG-STAR) molecular typing scheme uses the DNA sequences of 7 genes (penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA) associated with resistance to β-lactam antimicrobials, macrolides, or fluoroquinolones. NG-STAR uses the entire penA sequence, combining the historical nomenclature for penA types I to XXXVIII with novel nucleotide sequence designations; the full mtrR sequence and a portion of its promoter region; portions of ponA, porB, gyrA, and parC; and 23S rRNA sequences. NG-STAR grouped 768 isolates into 139 sequence types (STs) (n = 660) consisting of 29 clonal complexes (CCs) having a maximum of a single-locus variation, and 76 NG-STAR STs (n = 109) were identified as unrelated singletons. NG-STAR had a high Simpson's diversity index value of 96.5% (95% confidence interval [CI] = 0.959 to 0.969). The most common STs were NG-STAR ST-90 (n = 100; 13.0%), ST-42 and ST-91 (n = 45; 5.9%), ST-64 (n = 44; 5.72%), and ST-139 (n = 42; 5.5%). Decreased susceptibility to azithromycin was associated with NG-STAR ST-58, ST-61, ST-64, ST-79, ST-91, and ST-139 (n = 156; 92.3%); decreased susceptibility to cephalosporins was associated with NG-STAR ST-90, ST-91, and ST-97 (n = 162; 94.2%); and ciprofloxacin resistance was associated with NG-STAR ST-26, ST-90, ST-91, ST-97, ST-150, and ST-158 (n = 196; 98.0%). All isolates of NG-STAR ST-42, ST-43, ST-63, ST-81, and ST-160 (n = 106) were susceptible to all four antimicrobials. The standardization of nomenclature associated with antimicrobial resistance determinants through an internationally available database will facilitate the monitoring of the global dissemination of antimicrobial-resistant N. gonorrhoeae strains.

KEYWORDS: Neisseria gonorrhoeae, antimicrobial resistance, molecular epidemiology, sequence typing

INTRODUCTION

Neisseria gonorrhoeae, the causative agent of gonorrhea, is a global public health concern causing an estimated 78 million new cases of gonorrhea among adults every year (1). N. gonorrhoeae has developed resistance to almost all of the antimicrobials previously used for the treatment of gonorrhea, including penicillins, tetracyclines, and fluoroquinolones (2, 3); the remaining treatment options are now threatened by the emergence of resistance to third-generation cephalosporins and azithromycin (4–13).

The genes attributed to cephalosporin, fluoroquinolone, and azithromycin resistances have been well characterized (3); however, the lack of an internationally standardized classification nomenclature makes it difficult to compare the mutations implicated in resistance in individual gonococcal isolates. Agreement on the nomenclature of antimicrobial resistance (AMR) determinants through an internationally available, curated, user-friendly database containing sequence information and appropriate microbiological, genetic, clinical, and epidemiological data is of the utmost importance (14–16).

Variations in nucleotide sequences of penA (encoding penicillin binding protein 2 [PBP2]) are associated with resistance to cephalosporin and penicillin (2, 14, 17) and include the acquisition of penA mosaic sequences through recombination with penA genes from other Neisseria species as well as various other amino acid substitutions. Historically, the nomenclature used for the penA gene has been the assignment of PBP2 types I to XXXVIII based on amino acid substitution profiles at 82 selected amino acid positions (9) rather than nucleotide sequence differences. N. gonorrhoeae Sequence Typing for Antimicrobial Resistance (NG-STAR) uses this historical amino-acid-based nomenclature as a basis for allele numbering while creating a more convenient and easier-to-maintain naming system. Mutations in the promoter and/or coding region of the mtrR repressor may result in the overexpression of the MtrCDE efflux pump. Known mtrR mutations associated with resistance to macrolides, cephalosporins, tetracycline, and penicillin include a −35A deletion in the promoter sequence, an A39T or G45D mutation in the coding region, or the presence of N. meningitidis-like sequences (2, 14, 18–21). Variations in porB1b, encoding an outer membrane porin protein, causing amino acid substitutions at G120 and A121 (or G101 and A102, respectively, if the 19-amino-acid signal sequence is not included), also historically referred to as the penB resistance determinant, can decrease membrane permeability and the uptake of cephalosporins, tetracycline, and penicillin (2, 14, 22–25). The L421P variation caused by a mutation in ponA (PBP1) is involved in chromosomally mediated resistance to penicillins. The L421P mutation is present in many circulating N. gonorrhoeae strains, including those with elevated cephalosporin MICs; however, this mutation has not caused significantly increased cephalosporin MICs in transformation experiments (2, 3, 26). Fluoroquinolone resistance in N. gonorrhoeae is conferred via variations in gyrA (subunit A of DNA gyrase) that induce changes at amino acid positions S91 and/or D95 and those in parC (topoisomerase IV subunit C) that alter amino acids at positions D86, S87, and/or S88 (2, 3, 27). Point mutations in the peptidyl-transferase loop region in domain V of 23S rRNA confer resistance to azithromycin (2, 3, 28, 29). By convention, the locations of the 23S rRNA nucleotide mutations are based on the Escherichia coli coordinates of A2059G and C2611T, which correspond to A2045G and C2597T, respectively, of N. gonorrhoeae NCCP11945 (GenBank accession number NC_011035.1). The N. gonorrhoeae genome carries 4 gene alleles encoding 23S rRNA, and although the number of mutated alleles has been correlated with increasing resistance (28), a strain with one mutated allele can rapidly acquire mutations in all 4 alleles (29).

In the present study, a novel sequence-based molecular antimicrobial resistance typing scheme and Web-based analysis software, NG-STAR, were developed through an international collaboration. NG-STAR addresses the complex nomenclature applied to variations in multiple antimicrobial resistance genes of N. gonorrhoeae and can be used to monitor the global dissemination of antimicrobial-resistant N. gonorrhoeae strains.

RESULTS

NG-STAR currently contains 215 sequence types (STs) corresponding to unique allelic profiles consisting of concatenated allele identifications for penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA loci.

penA alleles.

NG-STAR currently includes 49 penA types, including 21 historical and 28 novel amino acid profiles, with 80 penA gene alleles (Table 1). The most allelic diversity was seen for penA type II (penA alleles 2.001 to 2.006), penA type XXII (alleles 22.001 to 22.006), and penA type XXXIV (alleles 34.001 to 34.006). There were 16 mosaic (n = 228) and 32 nonmosaic (n = 541) penA types among the 769 isolates analyzed. The most common mosaic type was penA type XXXIV (n = 197), with 79.7% (n = 157) of isolates carrying penA allele 34.001, and the most common nonmosaic type was penA type II (n = 169), where allele 2.001 accounted for 88% of the isolates (n = 149).

TABLE 1.

Amino acid profiles of previously described and novel penA typesa

penA type by NG-STAR penA type by Onishi et al. Mosaicb Amino acid profile
0 Wild typec No MCAKDDVNYGEDQQAADRRAIVAGTDLNERLQPSPR.SRGAEFEITLNRRPAVLQIFESRENPTTAFANVAAHGGAPPKII.A
1 I No ....................................D..............................................
2 II No ....................................D.............................LV..G............
3 III No ....................................D............................VLV..G.........VNV
4 IV No ....................................D.............................LV..G..S.........
5 V No ....................................D.............................LV..G..S......VNV
6d VI No ....................................D.............................LV........L......
7 VII No ....................................D............................VLV..G..S.........
8d VIII No ....................................D............................VLV.....S..L......
9 IX No ....................................D.............................LV..G.....L......
10 X Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.ST.VQVVNV
11d XI No ....................................D............................VLV..G.....L......
12 XII No ....................................D.............................LV..G.....S......
13 XIII No ....................................D............................VLV..G.....S......
14 XIV No ....................................D.............................LV..G.N..........
15 XV No ........................................................................N..........
16d XVI No ....................................D............................VLV..G..........NV
17 XVII No ....................................D............................VLV..G..S......VNV
18 XVIII No ....................................D............................TLV..G..S......VNV
19 XIX No ....................................D.............................LV..G.N.......VNV
20d XX No ....................................D.............................LV..G.N.......VNV
21 XXI No ....................................D.....................L......VLV..G.N....VQVVNV
22 XXII No ....................................D.............................LV..G.N....VQVVNV
23d XXIII Semi ....................................D..............VEVKVIA.KKE....LVY...N..T.VQVVNV
24d XXIV No ....................................D.............................LV..G..S..S...VNV
25d XXIV Yes ....E.ASHAGE...VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.ST.VQVVNV
26d XXVI Yes ...NE...H....K..N...MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA..VLV....N..T.VQVVNV
27 XXVII Yes ......ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.ST.VQVVNV
28d XXVIII Yes ....EAASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.ST.VQVVNV
29d XXIX Yes ....E.A.HAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.ST.VQVVNV
30d XXX Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA..VLVY...N.ST.VQVVNV
31d XXXI Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY..VN.ST.VQVVNV
32d XXXII Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S.L......
33d XXXIII No ..............T.....................D............................VLV..G..S.........
34 XXXIV Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S........
35 XXXV Semi IGT.E...HAGE.K......MTS.V.ATDTFLSATQ.TMTPK.DV........................I.............
36d XXXVI Yes ...............VEKQ....E.N.......AQ....SSK.S....K..V.VKVIA.KKEA...LV....N..T.VQVVNV
37 Yes ....E.ASHAGEE..VEKQVMPS.V.TTDTFL.ATQ.TMTPK.DVSV.K..VEVKVIA.KKEASI.LVY...N.ST.VQVVNV
38 Yes IGT.E...H....K.........E.N.......AQ....SSKL..SA.K..VEVKVIA.KKEA...LV....N..T....V..
39 Semi ....................................D.MTPK.DV..S.QKVEVKVIA.KKEA...LV....N..T....V..
40 No ....................................D.............S................................
41 No ........HAGEE.......................D.............................LV..G..S......VNV
42 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA..PLVY...N.S........
43 No ....................................D............................VLV..G............
44 No ....................................D............................TLV..G.....L......
45 No ..................................................................LV..G.N....VQVVNV
46 No ....................................D.............................LV..G....V.......
47 Yes ....................MTS.V.ATDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LV....N..T....V..
48 No ....................................D.............................LV..G.N....GQVVNV
49 No ....................................D...V........................TLV..G............
50 No ....................................D.............................LV..G.....A......
51 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S....NF.P
52 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S.....F.P
53 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S.A......
54 No ....................................D............................VLV..G.....A......
55 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S....N...
56 No ....................................D............................VLV..G.P..GG...F.P
57 No ....................................D............................VLV..G.....A...F..
58 Yes ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LVY...N.S.A.....P
59 Yes ....E.A.R...KK.V.QQVMTS.V.PTDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEASI.LVY...N.ST.VQVVNV
60 Yes ...................VMTS.V.PTDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEASI.LVY...N.ST.VQVVNV
61 No ....E...............................D.............................LV..G.....L.....
62 Yes IGT.E...H....K...........N.......AQ....SSKL..SA.K....V...A..QE....LVY...N..T....V..
63 Yes IGT.....H....K......MTS.V.ATDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEA...LV....N..T....V..
64 Yes ....E.ASHAGEE......VMTS.V.PTDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEASI.LVY...N.ST.VQVVNV
a

penA types correspond to historical amino acid profiles that consisted of 85 of 576 total protein amino acid residues and include penA types I to XXXVI (9) and novel penA types 37 to 59.

b

Semimosaic (Semi) structures correspond to penA sequences with alterations of either the first or second half of the gene only.

c

The wild-type PBP2 profile from N. gonorrhoeae strain M32091 (9).

d

PBP2 amino acid profiles awaiting submission to NG-STAR.

mtrR alleles.

There are currently 51 mtrR allele types in the database (Table 2), with 6 alleles having the −35A deletion in the promoter region, 19 having either the A39T or G45D substitution in MtrR, 6 having an N. meningitidis-like mosaic sequence, and 20 alleles having none of these mutations. The mtrR1 allele, which has −35A promoter deletion only, accounted for 43.2% (n = 332) of the isolates included in this study.

TABLE 2.

Molecular antimicrobial resistance determinants present in NG-STAR mtrR, porB, ponA, gyrA, parC, and 23S rRNA alleles

Allele Resistance determinant(s) for NG-STAR allelea
mtrR porB ponA gyrA parC 23S rRNA
0 WT WT WT WT WT WT
1 −35A deletion None L421P S91F, D95G None A2059G
2 −35A deletion A121D WT S91F, D95N None C2611T
3 None A121S L421P S91Y S87R None
4 None G120D L421P None D86N None
5 None G120D, A121D L421P S91F S87R, S88P None
6 None G120D, A121N None None None
7 None G120K, A121D S91F, D95A None C2611T
8 None G120K, A121D WT S87N None
9 A39T G120R, A121D S91F D86N None
10 A39T G120K, A121D None None None
11 A39T G120K, A121N D86N, S88P
12 None G120K, A121G S87I
13 None porB1a S87N
14 None porB1a S87R
15 None A120K, A121Vb S87N
16 −35A deletion G120N S87R
17 None None
18 None D86N
19 −35A deletion, G45D None
20 A39T S87N
21 None None
22 −35A deletion
23 A39T
24 A39T
25 G45D
26 A39T
27 N. meningitidis-like
28 N. meningitidis -like
29 None
30 N. meningitidis -like
31 None
32 WHO-P-like
33 None
34 −35A deletion
35 A39T
36 −35A deletion
37 −35A deletion, A39T,G45D
38 A39T
39 N. meningitidis -like
40 A39T
41 A39T
42 A39T
43 A39T
44 N. meningitidis -like
45 None
46 N. meningitidis -like
47 A39T
48 None
49 A39T
50 None
51 None
a

WT signifies the allelic wild-type DNA sequence lacking known antimicrobial resistance molecular markers.

b

A 2-codon deletion results in a 2-amino-acid frameshift.

porB alleles.

There are currently 16 porB allele types in the database, 14 of which are porB1b and 2 of which correspond to porB1a sequences. Of the porB1b sequences, 13 have the corresponding G120 and/or A121 amino acid substitution in PorB1b. The porB11 allele (with G120K/A121N) was most common among the isolates tested, representing 30.8% (n = 237) of the porB alleles, followed by porB1 (wild type at G120/A121), with 16.8% (n = 129), and porB8 (G120K/A121D), with 16.6% (n = 128).

ponA alleles.

Six ponA alleles are currently present in NG-STAR, four of which have the PBP1 L421P substitution present. The ponA1 allele (L421P) was predominant among the strains tested, representing 52.8% (n = 406) of the isolates.

gyrA alleles.

There are 10 gyrA alleles listed in NG-STAR so far, 5 of which possess a S91 and/or a D95 substitution in GyrA. Among the strains analyzed, 47.7% (n = 367) harbored gyrA0 (wild type with no mutations), and 39.5% (n = 304) harbored gyrA1 (S91F/D95G).

parC alleles.

NG-STAR currently includes 21 parC alleles, and 13 have substitutions at amino acid positions D86, S87, and/or S88 in ParC. The most predominant allele among the strains in this study was parC3 (S87R), in 37.3% (n = 287) of the isolates, followed by parC0 and parC1 (both wild type at D86, S87, and S88), in 16.8% (n = 129) and 15.0% (n = 115) of the strains, respectively.

23S rRNA alleles.

There are currently 10 23S rRNA alleles in the NG-STAR database, with 2 having a C2611T mutation that is associated with low to moderate resistance (MIC = 2 to 32 μg/ml depending upon the number of alleles mutated) and 1 having an A2059G mutation that causes high-level resistance (MIC ≥ 256 μg/ml with more than 2 mutated alleles). The 23S rRNA wild-type allele 23S-0 accounted for 64.6% (n = 497), 23S-2 (with C2611T) accounted for 21.7% (n = 167), and 23S-1 (A2059G) accounted for 1.2% (n = 9) of the isolates tested.

Sequence types.

Analysis of 768 N. gonorrhoeae isolates identified 215 NG-STAR STs (see Table S1 in the supplemental material). goeBURST analysis of the NG-STAR allelic profiles (Fig. S1) grouped 660 isolates into 28 clonal complexes (CCs) of 215 NG-STAR STs having single-locus variations, and 109 isolates were identified as 76 singleton NG-STAR STs having ≥2 locus variations, which generated a Simpson's diversity index value of 96.5% (95% confidence interval [CI] = 0.959 to 0.969). Sixteen NG-STAR STs were composed of 10 or more isolates (Table S2) (n = 439; 57.1%), and 134 NG-STAR STs consisted of a single isolate (n = 134; 17.4%). Multilocus sequence typing (MLST) analysis produced 86 MLST STs, with 435 isolates grouping into 6 CCs, and 39 MLST STs were singletons (n = 222), producing a Simpson's diversity index value of 86.6% (95% CI = 0.846 to 0.886). Analysis by N. gonorrhoeae multiantigen sequence typing (NG-MAST) produced 209 NG-MAST STs, grouping 537 isolates into 20 CCs and 181 isolates into 103 singleton NG-MAST STs, resulting in a Simpson's diversity index value of 97.0% (95% CI = 0.964 to 0.975). The congruence of the three typing methods was determined with the adjusted Wallace coefficient (AW), with AWNG-STAR→MLST equaling 0.780 (95% CI = 0.712 to 0.848) and AWNG-STAR→NG-MAST equaling 0.368 (95% CI = 0.321 to 0.416), meaning that isolates grouped by NG-STAR have a 78% chance of grouping by MLST and a 37% chance of grouping by NG-MAST.

The most common NG-STAR ST was ST-90 (n = 100; 13.0%), followed by ST-42 and ST-91 (each n = 45; 5.9%), ST-64 (n = 44; 5.72%), and ST-139 (n = 42; 5.5%). NG-STAR ST-90 was also the most diverse ST (see Table S2 in the supplemental material) and consisted of 7 MLST and 24 NG-MAST STs (n = 96). NG-STAR ST-91 had 2 MLST and 7 NG-MAST STs (n = 42), NG-STAR ST-42 had 1 MLST and 2 NG-MAST STs (n = 45), NG-STAR ST-64 had 3 MLST and 2 NG-MAST STs (n = 42), and ST-139 had 1 MLST and 10 NG-MAST STs (n = 42).

Some NG-STAR STs were correlated geographically with Brazilian isolates grouping into 8 NG-STAR STs, 5 of which were unique to Brazil (n = 5), whereas 22 NG-STAR STs were observed among isolates from the Netherlands having 15 unique NG-STAR STs (n = 23), 20 NG-STAR STs (n = 31) were unique to the United States out of a total of 28, and all Chinese isolates (n = 10) were associated with 7 unique NG-STAR STs (Table 3).

TABLE 3.

Geographical distribution of NG-STAR sequence types

NG-STAR sequence type(s) (total no. of isolates) No. of isolates
Brazil Canada China Netherlands USA
26 (15) 14 1
46 (2) 1 1
56 (2) 1 1
57 (8) 7 1
58 (10) 9 1
63 (16) 9 6 1
64 (44) 34 4 6
90 (100) 1 59 5 35
91 (44) 2 40 2
127 (3) 2 1
139 (42) 36 3 3
158 (10) 6 4
209 (1), 210 (1), 214 (1), 216 (1), 217 (1) 5
199 (1), 200 (2), 201 (1), 202 (1), 203 (2), 204 (1), 221 (2) 10
177 (2), 178 (2), 179 (1), 180 (2), 181 (1), 182 (3), 183 (1), 184 (1), 185 (3), 186 (1), 187 (1), 188 (1), 189 (1), 190 (2), 191 (1) 23
192 (1), 193 (6), 194 (1), 195 (1), 196 (4), 197 (1), 198 (3), 205 (1), 206 (1), 207 (1), 208 (1), 211 (2), 212 (1), 213 (1), 215 (1), 218 (1), 219 (1), 220 (1), 222 (1), 223 (1) 31
Other (382)a 382
Totalb 9 600 10 47 81
a

Including 138 sequence types and a total of 382 isolates.

b

Excludes 21 NCBI reference strains.

NG-STAR STs, allelic profiles, and antimicrobial MICs for a selection of internationally available reference strains are presented in Table 4, and the characteristics of prevalent NG-STAR STs are presented in Table 5. Specific NG-STAR STs were associated with characteristic antimicrobial resistance levels. Among the common NG-STAR STs consisting of 10 or more isolates, 92.3% of isolates with NG-STAR ST-61, ST-64, ST-79, ST-91, or ST-139 (n = 156) had an azithromycin MIC of ≥2.0 μg/ml, compared to 6.2% (n = 17) of isolates of other prevalent STs (P < 0.001) (Table 5). Similarly, 86.1% (n = 142) of NG-STAR ST-90, ST-91, or ST-97 isolates had a ceftriaxone MIC of ≥0.06 μg/ml (P < 0.001), and 92.1% (n = 165) had a cefixime MIC of ≥0.125 μg/ml (P < 0.001). Concurrently reduced susceptibilities to azithromycin and cephalosporins were present among NG-STAR ST-91 strains, where 86.7% (n = 39) had an azithromycin MIC of ≥2.0 μg/ml and a ceftriaxone MIC of ≥0.06 μg/ml (P < 0.001). NG-STAR ST-26, ST-90, ST-91, ST-97, ST-150, and ST-158 were associated with ciprofloxacin resistance, with an MIC of ≥1.0 μg/ml (98.0%; n = 196; P < 0.001), whereas NG-STAR ST-42, ST-43, ST-63, ST-81, and ST-160 (n = 106) were susceptible to all four antimicrobials. Minimum spanning tree analysis using goeBURST further illustrated the association of NG-STAR STs with antimicrobial susceptibilities (Fig. 1). NG-STAR STs with reduced susceptibilities to ciprofloxacin (Fig. 1A), ceftriaxone (Fig. 1C), and cefixime (Fig. 1D) clustered together, and highly susceptible NG-STAR STs clustered oppositely in the minimum spanning tree, while those with intermediate MIC ranges were located in between. This pattern was not as evident for azithromycin susceptibility, where clusters of resistant NG-STAR STs were scattered throughout the tree (Fig. 1B).

TABLE 4.

NG-STAR sequence types of select Neisseria gonorrhoeae reference strains with MICs and molecular antimicrobial resistance determinant profiles

Straina NG-STAR type Allelic profile (penA, mtrR, porB, ponA, gyrA, parC, 23S rRNA)b MIC (μg/ml)c
penA
Resistance markerd
PEN CRO CIP CFM AZM Type Mosaic mtrR
porB
ponA L421P gyrA
parC
23S rRNA
−35A A39 G45 MEN G120 A121 S91 D95 D86 S87 S88 A2059 C2611
ATCC 49226 1 22.001, 10, 13, 0, 0, 2, 0 1 0.016 0.004 0.016 0.5 XXII No WT A39T WT WT NA NA WT WT WT WT WT WT WT WT
WHO-F 2 15.001, 14, 14, 0, 0, 7, 0 0.032 0.002 0.004 0.016 0.125 XV No WT WT WT WT NA NA WT WT WT WT WT WT WT WT
WHO-G 3 2.001, 1, 13, 1, 5, 1, 0 0.5 0.008 0.125 0.016 0.25 II No Del WT WT WT NA NA L421P S91F WT WT WT WT WT WT
WHO-K 4 10.001, 19, 8, 1, 2, 5, 0 2 0.064 >32 0.5 0.25 X Yes Del WT G45D WT G120K A121D L421P S91F D95N WT S87R S88P WT WT
WHO-L 5 7.001, 25, 8, 1, 2, 11, 0 2 0.125 >32 0.25 0.5 VII No WT WT G45D WT G120K A121D L421P S91F D95N D86N WT S88P WT WT
WHO-M 6 2.001, 19, 8, 1, 1, 1, 0 8 0.012 2 0.016 0.25 II No Del WT G45D WT G120K A121D L421P S91F D95G WT WT WT WT WT
WHO-N 7 2.001, 26, 13, 1, 1, 12, 0 8 0.004 4 0.016 0.125 II No WT A39T WT WT NA NA L421P S91F D95G WT S87I WT WT WT
WHO-O 8 12.001, 1, 8, 1, 0, 7, 0 >32 0.032 0.008 0.016 0.25 XII No Del WT WT WT G120K A121D L421P WT WT WT WT WT WT WT
WHO-P 9 2.001, 32, 2, 0, 0, 0, 0 0.25 0.004 0.004 0.016 2 II No WT WT WT WT WT A121D WT WT WT WT WT WT WT WT
NCCP11945 10 5.003, 1, 12, 1, 1, 3, 0 ND ND ND ND ND V No Del WT WT WT G120K A121G L421P S91F D95G WT S87R WT WT WT
FA1090 11 1.002, 5, 0, 0, 0, 0, 0 ND ND ND ND ND I No WT WT WT WT WT WT WT WT WT WT WT WT WT WT
MS11 12 22.001, 10, 5, 1, 0, 1, 0 ND ND ND ND ND XXII No WT A39T WT WT G120D A121D L421P WT WT WT WT WT WT WT
FA19 13 15.001, 5, 14, 0, 0, 2, 0 ND ND ND ND ND XV No WT WT WT WT NA NA WT WT WT WT WT WT WT WT
FA6140 14 12.001, 22, 8, 1, 0, 1, 0 ND ND ND ND ND XII No Del WT WT WT G120K A121D L421P WT WT WT WT WT WT WT
35/02 15 10.001, 19, 8, 1, 5, 2, 0 ND ND ND ND ND X Yes Del WT G45D WT G120K A121D L421P S91F WT WT WT WT WT W
32867 30 12.001, 1, 8, 3, 1, 3, 1 4 0.125 32 0.063 ≥512 XII No Del WT WT WT G120K A121D L421P S91F D95G WT S87R WT A2059G WT
38202 64 2.001, 9, 1, 0, 0, 0, 2 0.25 0.008 0.004 0.016 8 II No WT A39T WT WT WT WT WT WT WT WT WT WT WT C2611T
WHO-U 224 2.001, 50, 1, 1, 0, 1, 2 0.125 0.002 0.004 <0.016 4 II No WT WT WT WT WT WT L421P WT WT WT WT WT WT C2611T
WHO-V 225 5.002, 1, 8, 1, 1, 3, 1 >32 0.064 >32 <0.016 >256 V No Del WT WT WT G120K A121D L421P S91F D95G WT S87R WT A2059G WT
WHO-W 4 10.001, 19, 8, 1, 2, 5, 0 4 0.064 >32 0.25 0.5 X Yes Del WT G45D WT G120K A121D L421P S91F D95N WT S87R S88P WT WT
WHO-X 226 37.001, 1, 8, 1, 2, 5, 0 4 2 >32 4 0.5 37 Yes Del WT WT WT G120K A121D L421P S91F D95N WT S87R S88P WT WT
WHO-Y 16 42.001, 1, 11, 1, 1, 3, 0 1 1 >32 2 1 42 Yes Del WT WT WT G120K A121N L421P S91F D95G WT S87R WT WT WT
WHO-Z 227 64.001, 51, 8, 1, 2, 5, 0 2 0.5 >32 2 1 64 Yes WT WT WT WT G120K A121D L421P S91F D95N WT S87R S88P WT WT
a

Strains corresponding to WHO-F to -Z were reported previously by Unemo et al. (38); strains NCCP11945 (GenBank accession number NC_011035.1), FA1090 (accession number NC_002946.2), MS11 (accession number NC_022240.1), FA19 (accession number NZ_CP012026.1), FA6140 (accession number NZ_CP012027.1), and 35/02 (accession number NZ_CP012028.1) were obtained from the NCBI; and strains 32867 and 38202 were clinical strains submitted to the National Microbiology Laboratory (NML), Winnipeg, Canada, for routine reference testing purposes.

b

Alleles in the profile correspond to penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA sequences, respectively.

c

PEN, penicillin; CRO, ceftriaxone; CIP, ciprofloxacin; CFM, cefixime; AZM, azithromycin. MIC values for NCCP11945, FA1090, MS11, FA19, FA6140, and 35/02 were not determined (ND) in this study.

d

Presence of antimicrobial molecular resistance markers including the mtrR −35A promoter nucleotide deletion (Del) and Neisseria meningitidis-like mosaic sequences (MEN); molecular antimicrobial resistance determinants of mtrR, porB, ponA, gyrA, and parC; and nucleotide point mutations of 23S rRNA. WT signifies the wild-type DNA sequence lacking currently recognized antimicrobial resistance molecular markers. NA for porB molecular markers indicates the presence of porB1a alleles for which porB1b amino acid substitutions are not applicable.

TABLE 5.

Characterization of predominant NG-STAR sequence types

NG-STAR sequence type (no. of isolates) % of isolates with MIC(μg/ml)a
Allelic profile (penA, mtrR, porB, ponA, gyrA, parC, 23S rRNA)b penA typec Resistance markerd
≥0.63 for CRO ≥0.125 for CFM ≥2 for AZM ≥1 for CIP mtrR
porB
ponA gyrA
parC
23S rRNA
−35A A39 G45 MEN G120 A121 S91 D95 D86 S87 S88 A2059 C2611
26 (15) 57 29 21 100 12.001, 1, 8, 1, 1, 3, 0 XII Del WT WT WT G120K A121D L421P S91F D95G WT S87R WT WT WT
42 (45) 2 0 0 0 14.001, 10, 3, 0, 0, 1, 0 XIV WT A39T WT WT WT A121S WT WT WT WT WT WT WT WT
43 (14) 0 0 0 0 14.001, 10, 3, 0, 0, 1, 6 XIV WT A39T WT WT WT A121S WT WT WT WT WT WT WT WT
58 (10) 0 0 90 0 2.001, 27, 1, 0, 0, 0, 0 II WT WT WT MEN WT WT WT WT WT WT WT WT WT WT
61 (17) 0 0 100 0 2.001, 5, 3, 0, 0, 0, 2 II WT WT WT WT WT A121S WT WT WT WT WT WT WT C2611T
63 (16) 0 0 0 0 2.001, 9, 1, 0, 0, 0, 0 II WT A39T WT WT WT WT WT WT WT WT WT WT WT WT
64 (44) 2 2 98 2 2.001, 9, 1, 0, 0, 0, 2 II WT A39T WT WT WT WT WT WT WT WT WT WT WT C2611T
79 (11) 0 0 91 0 22.001, 0, 3, 0, 0, 1, 2 XXII WT WT WT WT WT A121S WT WT WT WT WT WT WT C2611T
81 (10) 0 0 0 0 22.002, 11, 0, 0, 0, 2, 0 XXII WT A39T WT WT WT WT WT WT WT WT WT WT WT WT
90 (100) 84 94 4 97 34.001, 1, 11, 1, 1, 3, 0 XXXIV Del WT WT WT G120K A121N L421P S91F D95G WT S87R WT WT WT
91 (45) 88 88 98 100 34.001, 1, 11, 1, 1, 3, 2 XXXIV Del WT WT WT G120K A121N L421P S91F D95G WT S87R WT WT C2611T
97 (27) 89 93 0 100 34.002, 1, 11, 1, 1, 3, 0 XXXIV Del WT WT WT G120K A121N L421P S91F D95G WT S87R WT WT WT
139 (42) 21 7 79 7 9.001, 1, 8, 1, 0, 2, 0 IX Del WT WT WT G120K A121D L421P WT WT WT WT WT WT WT
150 (11) 36 0 9 91 41.001, 1, 11, 1, 1, 3, 0 41 Del WT WT WT G120K A121N L421P S91F D95G WT S87R WT WT WT
158 (10) 10 0 0 100 44.001, 16, 10, 1, 1, 10, 0 44 Del WT WT WT G120K A121D L421P S91F D95G WT WT WT WT WT
160 (22) 0 0 0 0 14.002, 41, 1, 0, 0, 7, 6 XIV WT WT WT WT WT WT WT WT WT WT WT WT WT WT
a

Percentage of isolates with the indicated MICs for ceftriaxone (CRO), cefixime (CFM), azithromycin (AZM), and ciprofloxacin (CIP).

b

Alleles in the profile correspond to penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA sequences, respectively.

c

penA sequence types correspond to amino acid profiles as described previously by Ohnishi et al. (9). penA type XXXIV, in boldface type, is a mosaic allele.

d

Presence of antimicrobial molecular resistance markers including the mtrR −35A promoter nucleotide deletion (Del) and Neisseria meningitidis-like mosaic sequences (MEN); molecular antimicrobial resistance determinants of mtrR, porB, ponA, gyrA, and parC; and nucleotide point mutations of 23S rRNA. WT signifies the wild-type DNA sequence lacking currently recognized antimicrobial resistance molecular markers.

FIG 1.

FIG 1

Antimicrobial resistance and genetic relatedness of 768 Neisseria gonorrhoeae isolates determined by goeBURST minimum spanning tree analysis of NG-STAR allelic profiles of seven antimicrobial resistance-related genes. Colored nodes indicate MICs of ciprofloxacin, azithromycin, ceftriaxone, and cefixime. The size of a node is proportional to the number of isolates, and branches are not to scale.

Specific NG-STAR alleles were also associated with levels of resistance. Isolates with the 23S rRNA allele 23S-1 (with an A2059T mutation) were the only isolates that also had azithromycin MICs of ≥256 μg/ml (n = 8). Allele 23S-2 with a C2611T mutation as the sole known azithromycin resistance determinant (not having an mtrR −35A deletion or A39T or G45D mutation, an N. meningitidis-like promoter, or a 23S rRNA A2059T mutation) was identified in 33 of 34 azithromycin-resistant isolates, whereas only 2 of the 70 isolates with no known determinants were resistant (P < 0.001). The mtrR27, mtrR28, mtrR30, mtrR39, mtrR44, and mtrR46 alleles contain an N. meningitidis-like mtrR promoter sequence, which was the sole determinant in 17 azithromycin-resistant isolates and only 2 susceptible isolates (P < 0.001). Similarly, 24 of 27 isolates with only the gyrA S91 and D95 ciprofloxacin resistance determinants, corresponding to the gyrA1 and gyrA7 alleles, respectively, were ciprofloxacin resistant (MIC ≥ 1 μg/ml), whereas only 4 of 399 isolates with no resistance determinants (both wild-type gyrA S91/D95 and wild type parC D86/S87/S88) were resistant (P < 0.001).

DISCUSSION

The emergence of extensively antimicrobial-resistant gonococcal infections together with the increased use of nucleic acid amplification tests for diagnosis have highlighted the need for rapid and standardized molecular-based methods to enhance surveillance of this disease. NG-STAR is a novel molecular typing scheme developed to facilitate the standardization and organization of the nomenclature of N. gonorrhoeae loci commonly associated with resistance to macrolides, cephalosporins, penicillins, and fluoroquinolones. NG-STAR is intended as an adjunct typing scheme to integrate antimicrobial resistance information with existing successful molecular epidemiological typing schemes such as MLST and NG-MAST. Although AMR profiles have been indirectly associated with particular NG-MAST genotypes, several problems exist, including the fact that AMR associations with NG-MAST genotypes are not fully definitive, rare or infrequent types may have little associated interpretative data available, and the approach requires continual data updating (16). The association of AMR and NG-MAST genotypes may also differ regionally, and it is important for each region to test the hypothesis that NG-MAST genotypes are predictive of AMR (30). Furthermore, susceptibility of N. gonorrhoeae to third-generation cephalosporins has been shown to be associated with specific combined penA-mtrR-porB mutation patterns (31). NG-STAR has the flexibility to directly associate resistance-determining mutations of the major genes with AMR profiles and to capture novel resistance mutations within these genes.

NG-STAR was validated with a wide selection of reference strains and internationally collected clinical isolates and produced a desirable high Simpson's diversity index value (32) comparable to that of NG-MAST and better than that of MLST. Specific NG-STAR STs are defined by mutations within antimicrobial resistance-determining alleles; therefore, each distinctive allelic profile is directly associated with a characteristic antimicrobial resistance profile. Each allele number relates to specific molecular antimicrobial resistance determinants, and consequently, each allelic profile will represent a composite of such determinants, creating an NG-STAR ST that should have a characteristic antimicrobial resistance phenotype. NG-STAR ST-90, ST-91, and ST-97 isolates possess mosaic penA type XXXIV and porB mutations that cause substitutions in amino acids G120 and A121, and these STs exhibit the expected reduced susceptibility to extended-spectrum cephalosporins (3, 33, 34). Similarly reduced cephalosporin susceptibilities were also observed among NG-STAR STs with nonmosaic penA alleles with an A501V substitution, such as penA 43.001, 43.002, and 13.001. Nonmosaic penA type IX, XIII, XVII, or XVIII with combinations of the A501V, P551S, G542S, and/or P551S/L mutation has been shown to be associated with N. gonorrhoeae isolates with cefixime and ceftriaxone MICs of ≥0.03 µg/ml (31, 35). In addition to the cephalosporin resistance determinants, NG-STAR ST-91 also had 23S rRNA allele 23S-2 with a C2611T point mutation, which confers concurrent resistance to macrolides. High-level azithromycin resistance (MIC ≥ 256 μg/ml) is associated with NG-STAR ST-30, ST-36, ST-69, ST-192, ST-202, ST-223, and ST-225, all of which possess the 23S rRNA A2059G mutation of allele 23S-1. Previous molecular studies have shown that these isolates possessed the A2059G mutation in all 4 alleles (36). Although more than a single mutated 23S rRNA gene in the genome is required to confer elevated azithromycin MICs (28, 36), the acquisition of a single mutated allele facilitates the rapid acquisition of a full complement of mutated alleles under selective pressures (3, 29); therefore, the presence of a single mutation may be considered a precursor to full resistance, especially if inappropriate treatment adds to this selective pressure. It is for this reason that NG-STAR records the presence of a mutation, even if present in a single allele, as being sufficient to identify the potential for full azithromycin resistance and to recommend an alternative treatment. Azithromycin-resistant STs did not cluster to the same extent as those with decreased susceptibility to other antimicrobials in the minimum spanning tree (Fig. 1B), potentially reflecting the more sporadic, nonclonal nature of the acquisition of azithromycin resistance among many N. gonorrhoeae strains (3, 29, 34, 36), although some subsequent clonal dissemination has been documented (37).

A Web-based user-friendly typing tool based on the well-characterized antimicrobial resistance genes of N. gonorrhoeae was developed, where nucleotide sequences of penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA may be queried against curated allelic libraries employing a standardized nomenclature. Although NG-STAR provides a satisfactory discriminatory molecular typing scheme for N. gonorrhoeae, it would be more useful in combination with other epidemiological typing schemes such as NG-MAST to enhance the molecular surveillance of antimicrobial resistance. Future planned enhancements of NG-STAR include interrogation of whole-genome sequence data and improved analytical functionality such as built-in sequence alignment and protein translation tools and bulk querying mechanisms. NG-STAR will enable public health practitioners and researchers around the world to communicate in a common “molecular language” to facilitate improved responses and monitoring of emerging drug-resistant clones of N. gonorrhoeae and to provide an enhanced understanding of the dissemination, transmission, and dynamics of gonorrhea, which will inform public health interventions and reduce the burden of this disease.

MATERIALS AND METHODS

N. gonorrhoeae isolates and antimicrobial susceptibility testing.

This study examined 768 N. gonorrhoeae isolates, which included 600 isolates from Canada, 47 from the Netherlands, 31 from the United States, 10 from China, and 9 from Brazil. Additional international reference strains WHO-F, WHO-G, WHO-K, WHO-L, WHO-M, WHO-N, WHO-O, WHO-P, WHO-U, WHO-V, WHO-W, WHO-X, WHO-Y, and WHO-Z (38) and strains ATCC 49226, NCCP11945 (GenBank accession number NC_011035.1), FA1090 (accession number NC_002946.2), MS11 (accession number NC_022240.1), FA19 (accession number NZ_CP012026.1), FA6140 (accession number NZ_CP012027.1), and 35/02 (accession number NZ_CP012028.1) from the NCBI were also included. Fifty genomes downloaded from the CDC Neisseria gonorrhoeae Antimicrobial Resistance Bank (available at http://www.cdc.gov/drugresistance/resistance-bank/currently-available.html [accessed December 2016]) were included to provide a broader range of strains. The WHO and CDC Neisseria gonorrhoeae Antimicrobial Resistance Bank strains are representative of the known antimicrobial resistance determinants for N. gonorrhoeae.

Susceptibilities to azithromycin, ciprofloxacin, ceftriaxone, and cefixime (Sigma-Aldrich Canada Ltd., Oakville, Ontario, Canada) were determined by using the agar dilution method and quality control strains as previously described (39, 40).

NG-MAST, MLST, and NG-STAR typing.

NG-MAST, MLST, and NG-STAR sequence typing was performed by using gene sequences extracted in silico from whole-genome sequencing (WGS) data and submitted to the NG-MAST (http://www.ng-mast.net/), Neisseria MLST (http://pubmlst.org/neisseria/), and NG-STAR (https://ngstar.canada.ca) websites to determine the respective STs. The relatedness of allelic profiles was visualized by using PHYLOViZ 2.0 (41, 42) to produce a full goeBURST minimum spanning tree. MLST and NG-STAR CCs were defined by a single-locus variation in allelic profiles from a founding ST, while an NG-MAST CC was determined by 5 or more single-nucleotide polymorphisms of concatenated and aligned porB and tbpB sequences.

NG-STAR software platform.

The NG-STAR analysis platform was written in Perl with the Perl Catalyst Model-View-Controller (MVC) framework (http://www.catalystframework.org/). It uses the MariaDB database and Apache Web server software on main and backup servers. The system is available to the research community as a virtual machine image running the CentOS 7 operating system. The software is released under the Apache 2.0 open-source license (available at https://github.com/phac-nml/ngstar). The NG-STAR Web service is publicly available (https://ngstar.canada.ca).

NG-STAR takes the full set of user-submitted locus sequences (trimmed or untrimmed) and first looks for exact matches by using SQL queries. If exact matches are found for all loci, NG-STAR returns the allele type and corresponding NG-STAR type (sequence type) if it exists. If the allele type combination is not associated with an NG-STAR type, the system will report the allele types and give an option to submit the novel allele type combination for curation and possible inclusion in the NG-STAR allele schema. Submitted sequences without exact matches in the schema are aligned against its corresponding set of alleles by using nucleotide-level BLAST+ (43); high-scoring segment pairs above a similarity of 90% and any match length are reported as a partial match. If one or more of the submitted sequences have partial matches, the user is given an option to submit the sequence for curation, although the system will not report a sequence type. Novel alleles (full length) and profiles may be submitted for manual curation through a curator notification functionality, where the submitter provides the DNA sequence; trace file; contact information (e-mail); and, ideally, additional background information such as isolation date, clinical source, country of origin, and antimicrobial MICs.

NG-STAR loci.

The DNA sequences of 7 genes commonly associated with resistance to β-lactam antimicrobials (e.g., cephalosporins and penicillins), macrolides, or fluoroquinolones (14) were used, including penA, mtrR, porB, ponA, gyrA, parC, and 23S rRNA. Primers recommended for PCR and conventional Sanger sequencing and amplicon sizes and fragment sizes used for typing are listed in Table 6.

TABLE 6.

Gene targets and suggested primers utilized in the NG-STAR typing scheme

Target (reference) Primer Nucleotide sequence (5′–3′) Size of PCR amplicon (bp) Allele size in NG-STAR (bp) Approximate size of full gene (bp)
penA (17) PenA-A1 (forward) CGGGCAATACCTTTATGGTGGAAC 669 1,746–1,752 1,746–1,752
PenA-B1 (reverse) AACCTTCCTGACCTTTGCCGTC
PenA-A2 (forward) AAAACGCCATTACCCGATGGG 581
PenA-B2 (reverse) TAATGCCGCGCACATCCAAAG
PenA-A3 (forward) GCCGTAACCGATATGATCGA 863
PenA-B3 (reverse) CGTTGATACTCGGATTAAGACG
PenA-A4 (forward) AATTGAGCCTGCTGCAATTGGC
mtrR (18) MTR1 (forward) AACAGGCATTCTTATTTCAG 916 698–708 (includes promoter region) Gene, 633; promoter, 251
MTR2 (reverse) TTAGAAGAATGCTTTGTGTC
ponA (26) ponA1-f (forward) CGCGGTGCGGAAAACTATATCGAT 1,240 75 2,397
ponA1-r (reverse) AGCCCGGATCGGTTACCATACGTT
porB1b (22) por-NGMAST-F (forward) CAAGAAGACCTCGGCAA 737 30 1,047
por-NGMAST-R (reverse) CCGACAACCACTTGGT
gyrA (27) GYRA-1 (forward) AACCCTGCCCGTCAGCCTTGA 270 264 2,751
GYRA-2 (reverse) GGACGAGCCGTTGACGAGCAG
parC (47) parC F (forward) GTTTCAGACGGCCAAAAGCC 332 332 2,304
parC R (reverse) GGCATAAAATCCACCGTCCCC
23S rRNA (28) gonrRNAF (forward) ACGAATGGCGTAACGATGGCCACA 712 567 2,890
gonrRNAR2 (reverse) TTCGTCCACTCCGGTCCTCTCGTA

NG-STAR uses the historical 82-amino-acid-based penA nomenclature developed by Ohnishi et al. (9) as a basis for allele numbering. This includes penA types I to XXXVIII (now penA types 1 to 38 in Arabic numerals) and sequentially adds novel types as they are submitted, beginning with penA type 39 (Table 1). When a novel amino acid substitution profile is detected, a sequential whole number is assigned to the allele. Novel whole-gene DNA sequences with synonymous mutations coding for a preexisting penA type will be indicated by an incremental decimal number. For example, the 12th unique whole-gene DNA sequence for the historical penA type XXXIV amino acid profile would be assigned allele number 34.012. For the remainder of the loci, each unique sequence is assigned a sequential allele number. NG-STAR mtrR alleles include a portion of the promoter starting approximately 66 to 68 bp before the ATG start codon of the coding region and extending the length of mtrR. To limit a potentially very large number of alleles of the hypervariable porB gene, a small 60-bp segment is used in NG-STAR that includes the G120- and A121-encoding region associated with antimicrobial resistance. Although the G120/A121 mutations apply only to porB1b, due to the high level of homology of porB1a sequences, and for enhanced typing purposes, both genes are included in NG-STAR. NG-STAR uses a 75-bp portion of ponA spanning amino acid L421; a 264-bp portion of gyrA spanning amino acids S91 and D95; and a 332-bp portion of parC spanning amino acids D86, S87, and S88. 23S rRNA mutations of interest include A2059G and/or C2611T (E. coli coordinates, corresponding to A2045G and C2597T, respectively, of N. gonorrhoeae NCCP11945 [GenBank accession number NC_011035.1]). Of the four 23S rRNA alleles present in the N. gonorrhoeae genome, only a single 567-nucleotide sequence is analyzed by NG-STAR. If no mutated alleles are present (wild type), any one of the alleles may be submitted; however, if a mutation is present in any one of the alleles, the sequence with a mutation is submitted, even if it is in the minority. The combination of allele numbers for all 7 genes (allelic profile) corresponds to a unique NG-STAR type.

Information for a representative reference strain for each allele and NG-STAR type, such as the level of antimicrobial resistance and relevant clinical and epidemiological data, is available. Allelic queries with sequences longer than those stored in the library are automatically trimmed to give an exact allele type match if present in the database, whereas shorter sequences will return possible allele type matches (hits), and users are encouraged to submit a longer DNA sequence to accurately identify an allele. An NG-STAR type is returned only with a complete allelic profile generated from exact allelic matches. Novel alleles (full-length queries containing mismatches) and profiles may be submitted through curator notification functionality, where the submitter provides the DNA sequence(s); contact information (e-mail); and, ideally, additional background information such as isolation date, clinical source, country of origin, epidemiological background information, and antimicrobial MICs. Curator comments for each allele and NG-STAR type will be presented, which may include characteristic mutations or other items of interest for that allele.

Statistical comparisons and calculations.

The measure of association was determined by using χ2 or Fisher's exact test using OpenEpi version 3.01 (44). Two-tailed differences with P values of <0.05 at a 95% CI were considered statistically significant. The discriminatory power of the NG-STAR, NG-MAST, and MLST schemes was calculated by using Simpson's diversity index (32, 45), and congruence of the methods was determined by using the adjusted Wallace coefficient (46) (calculated by using the online tool available at http://comparingpartitions.info).

Supplementary Material

Supplemental material

ACKNOWLEDGMENTS

We thank Pam Sawatzky, Gary Liu, Karla Montes, and Shelley Peterson from the Streptococcus and Sexually Transmitted Diseases Unit at the NML for their laboratory technical assistance; the NML Science Technology Cores and Services Division for their genomics infrastructure, software tools, technical support, and guidance; and the NML Genomics Core Facility for their next-generation sequencing and analytical expertise. We acknowledge receipt of U.S. isolates and associated data from the Gonococcal Isolate Surveillance Project (GISP).

The findings and conclusions in this report are those of the authors and do not necessarily represent the views of the CDC.

Funding for this project was provided by a grant from the Government of Canada's Genomics Research and Development Initiative program.

Footnotes

Supplemental material for this article may be found at https://doi.org/10.1128/JCM.00100-17.

REFERENCES

  • 1.Newman L, Rowley J, Hoorn SV, Wijesooriya NS, Unemo M, Low N, Stevens G, Gottlieb S, Kiarie J, Temmerman M. 2015. Global estimates of the prevalence and incidence of four curable sexually transmitted infections in 2012 based on systematic review and global reporting. PLoS One 10:e0143304. doi: 10.1371/journal.pone.0143304. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Lewis DA. 2010. The gonococcus fights back: is this time a knock out? Sex Transm Infect 86:415–421. doi: 10.1136/sti.2010.042648. [DOI] [PubMed] [Google Scholar]
  • 3.Unemo M, Shafer WM. 2014. Antimicrobial resistance in Neisseria gonorrhoeae in the 21st century: past, evolution, and future. Clin Microbiol Rev 27:587–613. doi: 10.1128/CMR.00010-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Allen VG, Mitterni L, Seah C, Rebbapragada A, Martin IE, Lee C, Siebert H, Towns L, Melano RG, Lowe DE. 2013. Neisseria gonorrhoeae treatment failure and susceptibility to cefixime in Toronto, Canada. JAMA 309:163–170. doi: 10.1001/jama.2012.176575. [DOI] [PubMed] [Google Scholar]
  • 5.Ison CA, Hussey J, Sankar KN, Evans J, Alexander S. 2011. Gonorrhoea treatment failures to cefixime and azithromycin in England, 2010. Euro Surveill 16(14):pii=19833 http://www.eurosurveillance.org/ViewArticle.aspx?Articled=19833. [PubMed] [Google Scholar]
  • 6.Lewis DA, Sriruttan C, Müller EE, Golparian D, Gumede L, Fick D, de Wet J, Maseko V, Coetzee J, Unemo M. 2013. Phenotypic and genetic characterization of the first two cases of extended-spectrum-cephalosporin-resistant Neisseria gonorrhoeae infection in South Africa and association with cefixime treatment failure. J Antimicrob Chemother 68:1267–1270. doi: 10.1093/jac/dkt034. [DOI] [PubMed] [Google Scholar]
  • 7.Unemo M, Golparian D, Stary A, Eigentler A. 2011. First Neisseria gonorrhoeae strain with resistance to cefixime causing gonorrhoea treatment failure in Austria, 2011. Euro Surveill 16(43):pii=19998 http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=19998. [PubMed] [Google Scholar]
  • 8.Unemo M, Golparian D, Syversen G, Vestrheim DF, Moi H. 2010. Two cases of verified clinical failures using internationally recommended first-line cefixime for gonorrhoea treatment, Norway, 2010. Euro Surveill 15(47):pii=19721 http://www.eurosurveillance.org/ViewArticle.aspx?ArticleId=19721. [DOI] [PubMed] [Google Scholar]
  • 9.Ohnishi M, Golparian D, Shimuta K, Saika T, Hoshina S, Iwasaku K, Nakayama S, Kitawaki J, Unemo M. 2011. Is Neisseria gonorrhoeae initiating a future era of untreatable gonorrhea? Detailed characterization of the first strain with high-level resistance to ceftriaxone. Antimicrob Agents Chemother 55:3538–3545. doi: 10.1128/AAC.00325-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Gratrix J, Bergman J, Egan C, Drews SJ, Read R, Singh AE. 2013. Retrospective review of pharyngeal gonorrhea treatment failures in Alberta, Canada. Sex Transm Dis 40:877–879. doi: 10.1097/OLQ.0000000000000033. [DOI] [PubMed] [Google Scholar]
  • 11.Unemo M, Golparian D, Nicholas R, Ohnishi M, Gallay A, Sednaouie P. 2012. High-level cefixime- and ceftriaxone-resistant Neisseria gonorrhoeae in France: novel penA mosaic allele in a successful international clone causes treatment failure. Antimicrob Agents Chemother 56:1273–1280. doi: 10.1128/AAC.05760-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Allen VG, Seah C, Martin I, Melano RG. 2014. Azithromycin resistance is coevolving with reduced susceptibility to cephalosporins in Neisseria gonorrhoeae in Ontario, Canada. Antimicrob Agents Chemother 58:2528–2534. doi: 10.1128/AAC.02608-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Cole MJ, Spiteri G, Jacobsson S, Pitt R, Grigorjev V, Unemo M. 2015. Is the tide turning again for cephalosporin resistance in Neisseria gonorrhoeae in Europe? Results from the 2013 European surveillance. BMC Infect Dis 15:321. doi: 10.1186/s12879-015-1013-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Unemo M, Golparian D, Shafer WM. 2014. Challenges with gonorrhea in the era of multi-drug and extensively drug resistance—are we on the right track? Expert Rev Anti Infect Ther 12:653–656. doi: 10.1586/14787210.2014.906902. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Whiley DM, Goire N, Lahra MM, Donovan B, Limnios AE, Nissen MD, Sloots TP. 2012. The ticking time bomb: escalating antibiotic resistance in Neisseria gonorrhoeae is a public health disaster in waiting. J Antimicrob Chemother 67:2059–2061. doi: 10.1093/jac/dks188. [DOI] [PubMed] [Google Scholar]
  • 16.Goire N, Lahra MM, Chen M, Donovan B, Fairley CK, Guy R, Kaldor J, Regan D, Ward J, Nissen MD, Sloots TP, Whiley DM. 2014. Molecular approaches to enhance surveillance of gonococcal antimicrobial resistance. Nat Rev Microbiol 12:223–229. doi: 10.1038/nrmicro3217. [DOI] [PubMed] [Google Scholar]
  • 17.Ito M, Deguchi T, Mizutani KS, Yasuda M, Yokoi S, Ito SI, Takahashi Y, Ishihara S, Kawamura Y, Ezaki T. 2005. Emergence and spread of Neisseria gonorrhoeae clinical isolates harboring mosaic-like structure of penicillin-binding protein 2 in central Japan. Antimicrob Agents Chemother 49:137–143. doi: 10.1128/AAC.49.1.137-143.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Mavroidi A, Tzouvelekis LS, Kyriakis KP, Avgerinou H, Daniilidou M, Tzelepi E. 2001. Multidrug-resistant strains of Neisseria gonorrhoeae in Greece. Antimicrob Agents Chemother 45:2651–2654. doi: 10.1128/AAC.45.9.2651-2654.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Warner DM, Shafer WM, Jerse AE. 2008. Clinically relevant mutations that cause derepression of the Neisseria gonorrhoeae MtrC-MtrD-MtrE Efflux pump system confer different levels of antimicrobial resistance and in vivo fitness. Mol Microbiol 70:462–478. doi: 10.1111/j.1365-2958.2008.06424.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Cousin SL Jr, Whittington WLH, Roberts MC. 2003. Acquired macrolide resistance genes and the 1 bp deletion in the mtrR promoter in Neisseria gonorrhoeae. J Antimicrob Chemother 51:131–133. doi: 10.1093/jac/dkg040. [DOI] [PubMed] [Google Scholar]
  • 21.Zarantonelli L, Borthagaray G, Lee EH, Shafer WM. 1999. Decreased azithromycin susceptibility of Neisseria gonorrhoeae due to mtrR mutations. Antimicrob Agents Chemother 43:2468–2472. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Martin IMC, Ison CA, Aanensen DM, Fenton KA, Spratt BG. 2004. Rapid sequence-based identification of gonococcal transmission clusters in a large metropolitan area. J Infect Dis 189:1497–1505. doi: 10.1086/383047. [DOI] [PubMed] [Google Scholar]
  • 23.Lindberg R, Fredlund H, Nicholas R, Unemo M. 2007. Neisseria gonorrhoeae isolates with reduced susceptibility to cefixime and ceftriaxone: association with genetic polymorphisms in penA, mtrR, porB1b, and ponA. Antimicrob Agents Chemother 51:2117–2122. doi: 10.1128/AAC.01604-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Olesky M, Hobbs M, Nicholas RA. 2002. Identification and analysis of amino acid mutations in porin IB that mediate intermediate-level resistance to penicillin and tetracycline in Neisseria gonorrhoeae. Antimicrob Agents Chemother 46:2811–2820. doi: 10.1128/AAC.46.9.2811-2820.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Olesky M, Zhao S, Rosenberg RL, Nicholas RA. 2006. Porin-mediated antibiotic resistance in Neisseria gonorrhoeae: ion, solute, and antibiotic permeation through PIB proteins with penB mutations. J Bacteriol 188:2300–2308. doi: 10.1128/JB.188.7.2300-2308.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Ropp PA, Hu M, Olesky M, Nicholas RA. 2002. Mutations in ponA, the gene encoding penicillin-binding protein 1, and a novel locus, penC, are required for high-level chromosomally mediated penicillin resistance in Neisseria gonorrhoeae. Antimicrob Agents Chemother 46:769–777. doi: 10.1128/AAC.46.3.769-777.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Lindback E, Rahman M, Jalal S, Wretlind B. 2002. Mutations in gyrA, gyrB, parC, and parE in quinolone-resistant strains of Neisseria gonorrhoeae. APMIS 110:651–657. doi: 10.1034/j.1600-0463.2002.1100909.x. [DOI] [PubMed] [Google Scholar]
  • 28.Ng LK, Martin I, Liu G, Bryden L. 2002. Mutation in 23S rRNA associated with macrolide resistance in Neisseria gonorrhoeae. Antimicrob Agents Chemother 46:3020–3025. doi: 10.1128/AAC.46.9.3020-3025.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Chisholm SA, Dave J, Ison CA. 2010. High-level azithromycin resistance occurs in Neisseria gonorrhoeae as a result of a single point mutation in the 23S rRNA genes. Antimicrob Agents Chemother 54:3812–3816. doi: 10.1128/AAC.00309-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Thakur SD, Levett PN, Horsman GB, Dillon JR. 2014. Molecular epidemiology of Neisseria gonorrhoeae isolates from Saskatchewan, Canada: utility of NG-MAST in predicting antimicrobial susceptibility regionally. Sex Transm Infect 90:297–302. doi: 10.1136/sextrans-2013-051229. [DOI] [PubMed] [Google Scholar]
  • 31.Thakur SD, Starnino S, Horsman GB, Levett PN, Dillon JR. 2014. Unique combined penA/mtrR/porB mutations and NG-MAST strain types associated with ceftriaxone and cefixime MIC increases in a ‘susceptible’ Neisseria gonorrhoeae population. J Antimicrob Chemother 69:1510–1516. doi: 10.1093/jac/dkt543. [DOI] [PubMed] [Google Scholar]
  • 32.Dillon JR, Rahman M, Yeung K. 1993. Discriminatory power of typing schemes based on Simpson's index of diversity for Neisseria gonorrhoeae. J Clin Microbiol 31:2831–2833. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Demczuk W, Lynch T, Martin I, Van Domselaar G, Graham M, Bharat A, Allen V, Hoang L, Lefebvre B, Tyrrell G, Horsman G, Haldane D, Garceau R, Wylie J, Wong T, Mulvey MR. 2015. Whole-genome phylogenomic heterogeneity of Neisseria gonorrhoeae isolates with decreased cephalosporin susceptibility collected in Canada between 1989 and 2013. J Clin Microbiol 53:191–200. doi: 10.1128/JCM.02589-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Grad YH, Harris SR, Kirkcaldy RD, Green AG, Marks DS, Bentley SD, Trees D, Lipsitch M. 2016. Genomic epidemiology of gonococcal resistance to extended-spectrum cephalosporins, macrolides and fluoroquinolones in the United States, 2000-2013. J Infect Dis 214:1579–1587. doi: 10.1093/infdis/jiw420. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Liao M, Gu WM, Yang Y, Dillon JA. 2011. Analysis of mutations in multiple loci of Neisseria gonorrhoeae isolates reveals effects of PIB, PBP2 and MtrR on reduced susceptibility to ceftriaxone. J Antimicrob Chemother 66:1016–1023. doi: 10.1093/jac/dkr021. [DOI] [PubMed] [Google Scholar]
  • 36.Demczuk W, Martin I, Peterson S, Bharat A, Van Domselaar G, Graham M, Lefebvre B, Allen V, Hoang L, Tyrrell G, Horsman G, Wylie J, Haldane D, Archibald C, Wong T, Unemo M, Mulvey MR. 2016. Genomic epidemiology and molecular resistance mechanisms of azithromycin-resistant Neisseria gonorrhoeae in Canada from 1997 to 2014. J Clin Microbiol 54:1304–1313. doi: 10.1128/JCM.03195-15. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Jacobsson S, Golparian D, Cole M, Spiteri G, Martin I, Bergheim T, Borrego MJ, Crowley B, Crucitti T, Van Dam AP, Hoffmann S, Jeverica S, Kohl P, Mlynarczyk-Bonikowska B, Pakarna G, Stary A, Stefanelli P, Pavlik P, Tzelepi E, Abad R, Harris SR, Unemo M. 2016. WGS analysis and molecular resistance mechanisms of azithromycin-resistant (MIC >2 mg/L) Neisseria gonorrhoeae isolates in Europe from 2009 to 2014. J Antimicrob Chemother 71:3109–3116. doi: 10.1093/jac/dkw279. [DOI] [PubMed] [Google Scholar]
  • 38.Unemo M, Golparian D, Sánchez-Busó L, Grad Y, Jacobsson S, Ohnishi M, Lahra MM, Limnios A, Sikora AE, Wi T, Harris SR. 2016. The novel 2016 WHO Neisseria gonorrhoeae reference strains for global quality assurance of laboratory investigations: phenotypic, genetic and reference genome characterization. J Antimicrob Chemother 71:3096–3108. doi: 10.1093/jac/dkw288. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Clinical and Laboratory Standards Institute. 2016. Performance standards for antimicrobial susceptibility testing. Twenty-sixth informational supplement. CLSI document, approved standard M100-S26. Clinical and Laboratory Standards Institute, Wayne, PA. [Google Scholar]
  • 40.Public Health Agency of Canada National Microbiology Laboratory. 2015. National surveillance of antimicrobial susceptibilities of Neisseria gonorrhoeae annual summary 2014. http://healthycanadians.gc.ca/publications/drugs-products-medicaments-produits/2014-neisseria/index-eng.php Accessed 1 May 2016.
  • 41.Francisco AP, Vaz C, Monteiro PT, Melo-Cristino J, Ramirez M, Carriço JA. 2012. PHYLOViZ: phylogenetic inference and data visualization for sequence based typing methods. BMC Bioinformatics 13:87. doi: 10.1186/1471-2105-13-87. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Nascimento M, Sousa A, Ramirez M, Francisco AP, Carriço JA, Vaz C. 2017. PHYLOViZ 2.0: providing scalable data integration and visualization for multiple phylogenetic inference methods. Bioinformatics 33:128–129. doi: 10.1093/bioinformatics/btw582. [DOI] [PubMed] [Google Scholar]
  • 43.Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. 1990. Basic local alignment search tool. J Mol Biol 215:403–410. doi: 10.1016/S0022-2836(05)80360-2. [DOI] [PubMed] [Google Scholar]
  • 44.Dean A, Sullivan K, Soe M. 2013. OpenEpi: Open Source Epidemiologic Statistics for Public Health version 3.01. http://www.openepi.com Accessed 8 August 2014.
  • 45.Hunter PR, Gaston MA. 1988. Numerical index of the discriminatory ability of typing systems: an application of Simpson's index of diversity. J Clin Microbiol 26:2465–2466. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Serviano A, Pinto FR, Ramirez M, Carriço JA. 2011. Adjusted Wallace coefficient as a measure of congruence between typing methods. J Clin Microbiol 49:3997–4000. doi: 10.1128/JCM.00624-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Ng LK, Sawatzky P, Martin IE, Booth S. 2002. Characterization of ciprofloxacin resistance in Neisseria gonorrhoeae isolates in Canada. Sex Transm Dis 29:780–788. doi: 10.1097/00007435-200212000-00008. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplemental material

Articles from Journal of Clinical Microbiology are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES