Skip to main content
Antimicrobial Agents and Chemotherapy logoLink to Antimicrobial Agents and Chemotherapy
. 2017 Jun 27;61(7):e00539-17. doi: 10.1128/AAC.00539-17

Anti-influenza Activity of a Bacillus subtilis Probiotic Strain

Darya Starosila a, Svetlana Rybalko a, Ludmila Varbanetz b, Naila Ivanskaya a, Iryna Sorokulova c,✉
PMCID: PMC5487639  PMID: 28416546

ABSTRACT

Among Bacillus bacteria, B. subtilis is the species that produces the most antimicrobial compounds. In this study, we analyzed the activity of probiotic strain B. subtilis 3 against the influenza virus. The antiviral effect of this strain has been demonstrated in vitro and in vivo. A new peptide, P18, produced by the probiotic strain was isolated, purified, chemically synthesized, and characterized. Cytotoxicity studies demonstrated no toxic effect of P18 on Madin-Darby canine kidney (MDCK) cells, even at the highest concentration tested (100 μg/ml). Complete inhibition of the influenza virus in vitro was observed at concentrations of 12.5 to 100 μg/ml. The protective effect of P18 in mice was comparable to that of oseltamivir phosphate (Tamiflu). Further study will assess the potential of peptide P18 as an antiviral compound and as a promising candidate for the development of new antiviral vaccines.

KEYWORDS: Bacillus subtilis, antiviral peptide, influenza virus, probiotics

INTRODUCTION

Probiotic bacteria attract much attention from scientists and physicians as important tools for correcting the microbiota and maintaining the health status of the host. Different mechanisms are known for the beneficial effects of probiotics, such as the production of antimicrobial substances (1, 2), an upregulation of immune response and downregulation of inflammatory response (3), stimulation of mucus secretion (4) and dendritic cell maturation (5), an improvement of gut mucosal barrier function, and modulation of host gene expression (6). Probiotic bacteria show efficacy in the treatment and prevention of different gastrointestinal conditions, including inflammatory bowel disease, irritable bowel syndrome, necrotizing enterocolitis (7), acute diarrhea (8), and antibiotic-associated diarrhea (9, 10). New applications of probiotics are focused on conditions influenced by altered gut microbiota, such as metabolic syndrome, obesity, atopic dermatitis, and mood disorders (11). Probiotic bacteria were tested for the prevention and treatment of viral infections. Different strains of Bifidobacterium and Lactobacillus demonstrated beneficial effects in treating rotavirus infection in animals and humans (12–14). Some orally administered probiotic bacteria stimulate respiratory immunity and increase resistance to viral respiratory tract infections. Infected mice receiving oral or intranasal treatment with Lactobacillus strains have reduced signs of influenza infection, lower virus titers in the lungs or nasal washings, increased body weight during infection, and increased survival (15). The effectiveness of probiotic bacteria in respiratory tract infections was confirmed in clinical trials in children, adults, and elderly individuals (15). Although animal studies and clinical trials demonstrate antiviral activities of specific probiotic bacteria, the mechanisms of these effects are unclear.

Our previous study showed beneficial effects of probiotic strain Bacillus subtilis 3 in the prevention and treatment of bacterial infections in animal models (16, 17) and in clinical trials (8, 9). The antibacterial activity of this probiotic strain was associated with the production of antibiotic aminocoumacin with a broad spectrum of pathogen suppression (18) and with the stimulation of immune resistance of the host (19). Previously, we found that some bacteria can produce peptides mimicking hemagglutinin of the influenza virus (20). The mimicking of proteins provides a way to find new therapeutic compounds for the treatment of pathogens (21). Bacteria of the Bacillus genus are considered as a promising source in the search for new inhibitory substances because of their capacity to produce a large number of antimicrobial peptides (22). This study aims to evaluate the antiviral activity of the B. subtilis 3 probiotic and to characterize the compounds responsible for this activity.

RESULTS

Antiviral activity of B. subtilis 3 in vitro and in vivo.

A previous cytotoxicity study showed no toxic effect of B. subtilis UCM B-5007 on Madin-Darby canine kidney (MDCK) cells at concentrations of 107 to 109 CFU ml−1 (data not shown). The incubation of the influenza virus with B. subtilis bacteria resulted in a significant inhibition of virus replication (Fig. 1A). The B. subtilis strain was also effective in preventing influenza infection in animals. Mice challenged with a lethal dose of influenza virus began to die on day 5 and all were dead on day 8 postchallenge. Pretreatment with B. subtilis protected 30% of the animals from a deadly infection (Fig. 1B).

FIG 1.

FIG 1

Antiviral activity of B. subtilis in vitro and in vivo. (A) MDCK cells were inoculated with the influenza virus following treatment with a B. subtilis strain (106 CFU per well). Viral titers were analyzed by titration in MDCK cells. *, P < 0.05. (B) Mice (10 per group) received a single dose of B. subtilis (107 CFU per mouse) or PBS by oral gavage. After 24 h, both groups of animals were infected intranasally with influenza virus. Survival was monitored for up 14 days postinfection.

Isolation and characterization of B. subtilis peptides.

Extracted samples of peptides were fractionated by high-performance liquid chromatography (HPLC), and 20 fractions were obtained (Fig. 2A). Each fraction was analyzed by an enzyme-linked immunosorbent assay (ELISA) using antibodies against B. subtilis peptides. The highest activity of interaction with anti-mimetic peptide antibodies was found in fraction 11 (Fig. 2B). Further analysis of this fraction by electrophoresis showed the presence of three proteins with molecular masses of 55.1, 44.1, and 22.6 kDa (Fig. 2C). Fraction 3, with a molecular mass of 22.6 kDa and which expressed the highest activity with anti-B. subtilis peptide antibodies, was further analyzed by matrix-assisted laser desorption ionization–time of flight mass spectrometry (MALDI-TOF MS) (Fig. 3). The main proteins identified in this fraction are presented in Table 1. An analysis of the obtained protein sequences against the NCBI database revealed the full homologies of these proteins with known peptides (Table 1). One of the peptides, TVAAPSVFIFPPSDEQLK, was found to be a component of influenza A neutralizing antibody. Thus, this peptide was selected for chemical synthesis to assess its possible antiviral activity by in vitro and in vivo assays.

FIG 2.

FIG 2

Isolation and characterization of B. subtilis peptides. (A) HPLC separation of the protein fractions from B. subtilis 3. Peptides (2 mg/ml) were applied to a TSKgel DEAE-5PW column and the fractions were collected by elution with NaCl solutions of increasing ionic strength (0.01 and 1 M) with 0.01 M Tris-HCl (pH 7.4). (B) Protein fraction interactions with antibodies to peptides from B. subtilis 3. Each collected peptide fraction was dried and analyzed by ELISA using antibodies against B. subtilis peptides. Fraction 11 showed the highest activity of interaction with antibodies. (C) Gel electrophoresis analysis of fraction 11. Homogeneity of the fraction was analyzed in 12% polyacrylamide together with molecular mass standards and stained with Coomassie blue.

FIG 3.

FIG 3

MALDI-TOF mass spectrum of fraction 3 (from Fig. 2C). Spectrum was acquired using the instrument in reflectron mode and calibrated using a standard peptide mixture.

TABLE 1.

Characterization of proteins identified by MALDI-TOF MS

Molecular mass (kDa) Peptide sequence Source Accession no.
17.73 SGTASVVCLLNNFYPR Chain A, crystal structure of the non-neutralizing HIV antibody 3MNV_A (PDB)
18.11 DIQMTQSPSSLSASVGDR Immunoglobulin kappa light chain BAC01680.1 (GenBank)
19.46 TVAAPSVFIFPPSDEQLK Chain H, structure of influenza A neutralizing antibody 3ZTJ_H (PDB)
22.87 VDNALQSGNSGESVTEQDSKDSTYSLSSTLTLSK Chain L, structure of the antibody 7b2 that captures HIV-1 virions 4YDV_L (PDB)
37.38 VQWKVDNALQSGNSQESVTEQDSK Chain L, crystal structure of broadly neutralizing antibody 4NM4_L (PDB)
41.61 EAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK Chain L, crystal structure of highly potent anti-HIV antibody 3RPI_L (PDB)

Characterization and validation of the chemically synthesized peptide TVAAPSVFIFPPSDEQLK.

Peptide identification was confirmed by MALDI-TOF MS analysis (Fig. 4). Cytotoxicity studies demonstrated no toxic effect of this peptide, named P18, on MDCK cells (Fig. 5A), even at the highest concentration tested (100 μg/ml). No cell degeneration or other morphological changes were found after microscopic analysis of the monolayers. Thus, for further experiments in vitro, the peptide was used in concentrations ranging from 3.1 to 100 μg/ml. Peptide P18 was evaluated for its ability to inhibit influenza virus A/FM/1/47 (H1N1) in vitro. Complete inhibition of the virus was observed at concentrations of 12.5 to 100 μg/ml (Fig. 5B). Peptide P18 significantly reduced the viral titer at a concentration of 6.2 μg/ml. Other tested concentrations of P18 (3.1 and 1.6 μg/ml) were not effective in virus inhibition.

FIG 4.

FIG 4

MALDI-TOF mass spectrum of the chemically synthesized peptide P18. Peptide TVAAPSVFIFPPSDEQLK (P18) was synthesized at the highest available purity (90%).

FIG 5.

FIG 5

Characterization of peptide P18. (A) Cytotoxicity of P18 peptide was analyzed by MTT assay in MDCK cells. Viability of cells in the control wells (no peptide added) was scored as 100%. Other samples were normalized to this value. (B) Monolayers of MDCK cells were infected with the influenza virus. After 1 h of incubation, serial dilutions of peptide P18 were added to the wells and no peptide was added to the control wells. Viral titers were analyzed 3 days postinfection by titration in MDCK cells.

Efficacy of P18 in vivo.

The activity of the P18 peptide for the prevention and treatment of influenza infection was tested in mice. Based on the results of P18 efficacy against the influenza virus from in vitro studies, a concentration of 12.5 μg/ml was used for animal treatments. Oseltamivir phosphate (Tamiflu) was used as a positive control in these experiments. All mice treated with phosphate-buffered saline (PBS) and infected with a virus exhibited clinical signs of infection (ruffled coat, hunched posture, slowed movement, shivering, labored breathing, anorexia, little to no movement, and paralysis and were moribund) and died on day 8 of the experiment (Fig. 6). The treatment of animals with P18 and oseltamivir phosphate before the infection (Fig. 6A) resulted in significant protection in comparison to the control (30% and 80%, respectively). A significant efficacy of P18 was observed in animals that were treated after virus inoculation (Fig. 6B). A single oral application of P18 protected 80% of mice; the rate of survival after oseltamivir phosphate treatment was 70%. None of the surviving animals showed any visible signs of influenza. The viral titers in the lungs were significantly lower in mice pretreated with oseltamivir phosphate than in the controls and those treated with P18 (Fig. 6C). However, the treatment of mice with P18 after infection was more effective in the elimination of the virus than oseltamivir phosphate (Fig. 6C).

FIG 6.

FIG 6

Efficacy of peptide P18 in vivo. Mice were treated with PBS, P18, or oseltamivir phosphate before infection with influenza virus (A) or after infection (B). On day 4 postinfection, the lungs from three mice in each group before infection (solid bars) and postinfection (open bars) were removed, and viral titers were evaluated in each supernatant by TCID50 analysis in MDCK cells (C). *, P < 0.05.

DISCUSSION

Influenza is still a significant health problem that results in high morbidity and mortality in the United States and worldwide (23). The therapeutic approaches used for the prevention and treatment of influenza infection include amantadine, neuraminidase inhibitors (24), and vaccines (25). However, some of the adverse effects of the antiviral compounds used and the drawbacks of vaccination indicate the need for improved therapies and preventive treatment of influenza infection. Different alternatives have been tested to combat the influenza virus. For example, China's Ministry of Health recommended using extracts from some natural herbs that have beneficial immunomodulatory effects (26). More and more scientific data suggest that probiotic bacteria can be effectively used to decrease the risk or duration of influenza symptoms. The beneficial effects of Lactobacillus and Bifidobacterium strains have been shown in animal models and in clinical trials (15).

Our study was aimed to evaluate the antiviral efficacy of a B. subtilis probiotic strain. The bacteria significantly inhibited influenza virus replication in vitro and increased the survival rate of mice challenged with the virus after a single dose of probiotic bacteria. The protection of mice against the influenza virus by oral pretreatment with Lactobacillus rhamnosus M21 was reported by Song et al. (27). The authors orally treated animals with lactobacilli for 2 weeks before challenging them with a lethal dose of virus. In another study, a 2-week treatment using killed spores of B. subtilis PY79 protected mice from influenza infection (28). The rate of protection with a single dose of live B. subtilis 3 cells was comparable with results presented by Song et al. (27) for L. rhamnosus M21.

Previously, we found that some bacteria can produce peptides mimicking hemagglutinin of the influenza virus (20). Thus, we decided to analyze whether the mechanism of B. subtilis 3 antiviral activity is associated with the production of antiviral peptides. Mimetic peptides were isolated from the culture medium after 24-h growth of the probiotic strain. HPLC analysis revealed 20 fractions that were further tested with specific antibodies. The fraction with the highest activity was analyzed by MALDI-TOF MS. Only one peptide from the six identified was found to be a component of influenza A neutralizing antibody. This peptide (P18) was chemically synthesized and tested in vitro and in animals. Complete inhibition of virus in vitro was observed at concentrations of 12.5 to 100 μg/ml. Bacillus bacteria are one of the largest producers of antimicrobials. More than 795 different antibiotics, mostly of a peptidic nature, were identified from these bacteria (29). These peptide antibiotics have a wide spectrum of activity, and some of them demonstrated antiviral activity. Thus, Torres et al. (30) characterized the virucidal effect of the bacteriocin subtilosin, produced by B. amyloliquefaciens, against herpes simplex virus. Surfactin and biosurfactants produced by B. subtilis inhibit a broad spectrum of viruses, including Semliki Forest virus, herpes simplex virus, suid herpesvirus, vesicular stomatitis virus, simian immunodeficiency virus, feline calicivirus, and murine encephalomyocarditis virus (31). The authors postulated that the antiviral action of these compounds was due to a physicochemical interaction of the membrane-active surfactant with the virus lipid membrane.

High antiviral in vitro activity of surfactin and fengycin was also confirmed by other scientists (32). The testing of antiviral compounds produced by Bacillus bacteria have only been performed in vitro.

We studied the efficacy of synthesized peptide P18 for prophylaxis and treatment of influenza infection in animals. Pretreatment of mice with P18 resulted in a significant improvement in survival rate, but oseltamivir phosphate was more effective, showing protection in 80% of mice. The therapeutic efficacy of P18 was highly pronounced compared with that of oseltamivir phosphate activity (in 80% and 70% of mice protection, accordingly). A novel 20-amino-acid peptide (EB) derived from the signal sequence of fibroblast growth factor 4 demonstrated a protective effect in mice after intranasal treatment 6 h postinoculation with influenza virus (33). Intranasal administration of EB peptide resulted in a significant delay in mortality and clinical signs in treated mice, but all mice were dead on day 11 postinfection. An increased survival of mice infected with influenza virus was found after intravenous treatment with a recombinant human serum albumin-thioredoxin 1 fusion protein (HSA-Trx) (34). The tested protein had no effect on pulmonary virus replication in influenza-infected mice. The authors assumed that the therapeutic value of HSA-Trx results from inhibiting inflammatory cell responses and suppressing the overproduction of nitric oxide (NO) in the lungs. In our experiments, pretreatment and posttreatment of mice with peptide P18 significantly decreased influenza virus titers in the lungs of mice. The results obtained demonstrated that peptide P18 inhibits the replication of influenza virus in vitro and in vivo. To our knowledge, it is the first report about the isolation and identification of a Bacillus peptide with strong activity against the influenza virus. Peptide P18 has complete homology with the structure of influenza A neutralizing antibody. We can speculate that the mechanism of antiviral activity of this peptide is in its similarity to neutralizing antibodies. This is confirmed by the results of in vivo testing, where P18 showed a higher protective effect for animals in the treatment mode of application. The study of molecular mimicry provides a novel concept for the development of new antiviral drugs and vaccine development (35).

In summary, we showed the activity of probiotic strain B. subtilis 3 against the influenza virus in vitro and in animals. A new peptide, P18, produced by the probiotic strain was isolated and characterized. P18 inhibited the influenza virus in vitro, and its protective effect in mice was comparable with that of oseltamivir phosphate. Further study will assess the potential of peptide P18 as an antiviral compound and as a promising candidate for the development of new antiviral vaccines.

MATERIALS AND METHODS

Ethics statement.

All animal procedures were approved by the internal review board of the Gromashevsky Institute of Epidemiology and Infectious Diseases, National Academy of Medical Sciences of Ukraine, Kiev, Ukraine.

Animals.

Four- to 6-week-old BALB/c mice (BMS, Kiev, UA) were used. The animals were housed under specific-pathogen-free conditions and were acclimatized for 2 days to the room temperature (21 ± 1°C), humidity (50% ± 5%), and lighting (12-h day/12-h night), with free access to water and food.

Cell cultures.

Madin-Darby canine kidney (MDCK) cells were obtained from the Ivanovsky Institute of Virology (Moscow, Russia). MDCK cells were cultured in Dulbecco's modified Eagle medium (DMEM) (Thermo Fisher Scientific, Waltham, MA, USA) with 10% fetal bovine serum (Corning, Manassas, VA, USA) at 37°C in an incubator with 5% CO2.

Microorganisms.

Bacillus subtilis 3 (UCM B-5007) was obtained from the Ukrainian Collection of Microorganisms (Kiev, Ukraine) and propagated on nutrient agar (HiMedia, Mumbai, India). Influenza virus A/FM/1/47 (H1N1) was obtained from the Ivanovsky Institute of Virology (Moscow, Russia) and adapted to mice by serial lung passage. Influenza virus was propagated in MDCK cells. After 72 h, cells infected with virus were harvested and stored at −80°C. Viral titers were determined by 50% tissue culture infective dose (TCID50) analysis. The influenza virus was titrated in mice prior to use. The doses necessary to achieve 50% mortality (LD50) 10 days after infection were determined after intranasal infection of 20 BALB/c mice per group.

Peptide isolation.

B. subtilis strain UCM B-5007 was cultivated in nutrient broth (HiMedia, Mumbai, India) on a rotary shaker (400 rpm) at 37°C for 24 h. After centrifugation at 4,000 × g for 15 min at 4°C, 200 ml of the supernatant was treated with 96% ethanol at a ratio of 1:1.5 for 20 h at 4°C. The obtained sample was centrifuged at 5,000 × g for 15 min and the supernatant was discarded. The pellet was resuspended in 40 ml of 60% ethanol, centrifuged at 5,000 × g for 15 min, and washed with PBS. This procedure was repeated three times. The probe in PBS was heated at 100°C for 10 min in a water bath and then centrifuged at 5,000 × g for 15 min. The protein content in supernatants was analyzed by a Lowry assay. Supernatants were used as the peptides for the immunization of animals and further purification.

Antibodies against B. subtilis peptides.

Mice were immunized with isolated peptides by a subcutaneous injection of 100 μg in 0.1 ml of PBS with a subsequent boost injection after 4 weeks. Total IgG immunoglobulins were purified by protein A Sepharose affinity chromatography (36).

Purification of peptides.

Peptides were analyzed and purified by Beckman System Gold HPLC (Beckman Coulter GmbH, Krefeld, Germany). Peptides (2 mg/ml) were applied to a TSKgel DEAE-5PW column (7.5 mm by 75 mm). The fractions were collected by elution with NaCl solutions of increasing ionic strength (0.01 and 1 M) with 0.01 M Tris-HCl (pH 7.4). Each collected peptide fraction was dried, and the most active fractions were identified by ELISA using antibodies against B. subtilis peptides. The most active fraction was analyzed in 12% polyacrylamide together with molecular mass standards and stained with Coomassie blue, as described elsewhere (37).

In-gel enzymatic digestion was performed according to published protocols (38, 39). Briefly, protein bands were excised from the gel, stained with Coomassie blue, and cut into cubes (1 mm by 1 mm). The gel cubes were destained by incubating with 100 μl of 40% acetonitrile in 0.05 M ammonium bicarbonate for 30 min at 37°C with occasional vortexing. Pure acetonitrile (500 μl) was added to the samples, and they were incubated at room temperature until destaining was complete. The acetonitrile was removed and gel pieces were dried. The dried gel pieces were covered with digestion buffer (12 μg/ml of trypsin in 0.05 M ammonium bicarbonate) and allowed to proceed 12 h at 37°C. The extraction buffer (50% [vol/vol] acetonitrile, 1% [vol/vol] trifluoroacetic acid [TFA], 49% H2O) was added to achieve the approximate ratio of 1:2 between volumes of the digest and the extraction, and samples were incubated for 20 min at room temperature.

Sample preparation for matrix-assisted laser desorption ionization (MALDI) mass spectrometry (MS) was performed using the dried-droplet method according to a published protocol (40). Briefly, 1 μl of the sample was pipetted to the sample plate, mixed with 0.3 μl of matrix, and air dried. The matrix solution was prepared by mixing a saturated solution of 2,5-dihydroxybenzoic acid in 50:50 H2O to acetonitrile with 0.1% TFA.

Determination of amino acid sequence of the purified peptide.

The molecular mass and the amino acid sequence of the purified peptide was determined with MALDI-TOF MS (Ultraflex II, Bruker, Germany) as described elsewhere (40). Spectra were acquired using the instrument in reflectron mode and calibrated using a standard peptide mixture.

Database search and peptide identification.

The identification of peptides was performed using a Mascot program (Matrix Science, USA) searching against the NCBI database.

Peptide synthesis.

The selected peptide sequence TVAAPSVFIFPPSDEQLK was synthesized by Metabion GmbH (Planegg, Germany) at the highest available purity (90%) using an automated synthesizer (Applied Biosystems 433A). The synthesizer was programmed for a standard fluorenylmethyloxycarbonyl (Fmoc)-based solid-phase peptide synthesis protocol. After the completion of the synthesis, the peptide was cleaved from the resin with trifluoroacetic acid, purified by reversed phase HPLC, and analyzed by MALDI mass spectrometry.

ELISA.

Wells of a 96-well ELISA dish were coated overnight at 4°C with protein fractions (2 μg/ml in bicarbonate-carbonate buffer, pH 9.6), were blocked with sterile fat-free milk for 1 h at room temperature, were reacted with anti-peptide antibodies for 1 h at room temperature, and were washed 4 times with buffer (PBS plus 0.05% Tween 20). Goat anti-mouse IgG (gamma) antibody (human serum adsorbed and peroxidase labeled; Kirkegaard &Perry Laboratories, Gaithersburg, MD) was added and incubated 30 min at 37°C, and the dish was washed 6 times and tetramethylbenzidine (TMB) and hydrogen peroxide in citrate buffer (pH 5.0) was added. The reaction was stopped by 2 M H2SO4. The optical density was measured at 492/630 nm. All samples were tested in triplicates.

Cytotoxicity test.

The cytotoxicity of the P18 peptide was analyzed by an MTT [3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide] assay on MDCK cells in 96-well plates. Cells were seeded at 1 × 104 cells per well and incubated for 24 h at 37°C in a humidified 5% CO2 incubator. Increasing amounts of peptide (3.1 to 100 μg/ml) were added to each well. No peptide was added to the control wells. After 5 days of treatment with the peptide, MTT (25 μl at 5 mg/ml in PBS) was added to each well and the plate was incubated for 3 h at 37°C in a humidified chamber. After the incubation, the MTT solution was removed to stop the reaction and 150 μl of dimethyl sulfoxide was added to each well. The optical density was measured at 570 nm using a microplate reader (Bio-Tek, Winooski, VT). The viability of cells in the control wells was scored as 100%. Other samples were normalized to this value. To confirm the MTT results, the monolayers were also observed microscopically to estimate rounding and other morphological changes in comparison to those of control cells.

Antiviral activity in vitro.

Monolayers of MDCK cells in 96-well plates were washed three times with DMEM containing 2 μg/ml of tosylsulfonyl phenylalanyl chloromethyl ketone (TPCK) trypsin and were infected with the influenza virus (100 IU/well). After 1 h of incubation at room temperature, nonadsorbed virus was discarded and medium without serum was added to each well. Serial dilutions of peptide or the B. subtilis strain (106 CFU per well) were added to the wells and incubated at 37°C for 3 days in the incubator with 5% CO2. After incubating, viral titers in the medium were analyzed by titration in MDCK cells.

Antiviral activity in vivo. (i) B. subtilis UCM B-5007.

Two groups of mice (10 mice in each group) were used in this study. One group received a single dose of B. subtilis (107 CFU in 0.1 ml PBS per mouse) by oral gavage, while mice of the second group received 0.1 ml PBS per mouse. After 24 h, animals from both groups were infected intranasally with influenza virus (25 μl for each nostril, 10LD50). Survival rates were monitored for up to 14 days postinoculation.

(ii) Peptide P18.

Animals were allocated into six groups (13 mice in each group): (i) control, PBS pretreatment; (ii) control, oseltamivir phosphate pretreatment; (iii) P18 pretreatment; (iv) control, PBS posttreatment; (v) control, oseltamivir phosphate posttreatment; (vi) P18 posttreatment. One day before the infection with virus, mice in the PBS pretreatment control group received 0.2 ml PBS per os, and mice in the oseltamivir phosphate pretreatment control group received oseltamivir phosphate (1 mg/kg) by gavage. Animals in the P18 pretreatment group received P18 (0.1 mg/kg) by oral gavage. Mice from the posttreatment groups were infected with influenza virus and, after 24 h, were treated with PBS, oseltamivir phosphate, or P18 (Fig. 7). To induce the infection, mice were lightly anesthetized by isoflurane inhalation and intranasally inoculated with influenza virus (25 μl for each nostril, 10LD50). Mice were observed for mortality for 14 days. On day 15, mice were euthanized by CO2 asphyxiation. On day 4 postinfection, the lungs from three mice in each group were removed, weighed, and homogenized in cold DMEM. The homogenates were centrifuged at 3,200 × g for 5 min at 4°C, and viral titers were evaluated in each supernatant by TCID50 analysis in MDCK cells.

FIG 7.

FIG 7

Experimental design. Animals were allocated to six groups (13 mice in each group): (i) control, PBS pretreatment; (ii) control, oseltamivir phosphate pretreatment; (iii) P18 pretreatment; (iv) control, PBS posttreatment; (v) control, oseltamivir phosphate posttreatment; (vi) P18 posttreatment. One day before the infection with virus, PBS pretreatment control mice received 0.2 ml PBS per os; oseltamivir phosphate pretreatment control mice received oseltamivir phosphate (1 mg/kg) by gavage. P18 pretreatment animals received P18 (0.1 mg/kg) by oral gavage. Mice from the posttreatment groups were infected with influenza virus and, after 24 h, were treated with PBS, oseltamivir phosphate, or P18.

Statistical analysis.

All results are presented as means and standard deviations. The differences between groups were analyzed by two-sample t tests or one-way analysis of variance (ANOVA) followed by Bonferroni's correction. Survival analysis was performed using Kaplan-Meier curves and a log-rank test. The significance level was set at 0.05 to define statistical significance. Statistical calculations and graph plotting were being carried out using Microcal Origin version 9.0 (Northampton, MA) and 2010 Microsoft Excel.

ACKNOWLEDGMENTS

This work was supported by the National Academy of Medical Sciences of Ukraine (to D.S., S.R., and N.I.), the National Academy of Sciences of Ukraine (to L.V.), and the Auburn University fund FOP 101002-139294-2050 (to I.S.).

REFERENCES

  • 1.Suskovic J, Kos B, Beganovic J, Pavunc AL, Habjanic K, Matoic S. 2010. Antimicrobial activity – the most important property of probiotic and starter lactic acid bacteria. Food Technol Biotechnol 48:296–307. [Google Scholar]
  • 2.Sorokulova I. 2013. Modern status and perspectives of Bacillus bacteria as probiotics. J Probiotics Health 1:e106. doi: 10.4172/2329-8901.1000e106. [DOI] [Google Scholar]
  • 3.Aureli P, Capurso L, Castellazzi AM, Clerici M, Giovannini M, Morelli L, Poli A, Pregliasco F, Salvini F, Zuccotti GV. 2011. Probiotics and health: an evidence-based review. Pharmacol Res 63:366–376. doi: 10.1016/j.phrs.2011.02.006. [DOI] [PubMed] [Google Scholar]
  • 4.Caballero-Franco C, Keller K, De Simone C, Chadee K. 2007. The VSL#3 probiotic formula induces mucin gene expression and secretion in colonic epithelial cells. Am J Physiol Gastrointest Liver Physiol 292:G315–G322. doi: 10.1152/ajpgi.00265.2006. [DOI] [PubMed] [Google Scholar]
  • 5.Smits HH, Engering A, van der Kleij D, de Jong EC, Schipper K, van Capel TMM, Zaat BAJ, Yazdanbakhsh M, Wierenga EA, van Kooyk Y, Kapsenberg ML. 2005. Selective probiotic bacteria induce IL-10-producing regulatory T cells in vitro by modulating dendritic cell function through dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin. J Allergy Clin Immunol 115:1260–1267. doi: 10.1016/j.jaci.2005.03.036. [DOI] [PubMed] [Google Scholar]
  • 6.Reid G, Younes JA, Van der Mei HC, Gloor GB, Knight R, Busscher HJ. 2011. Microbiota restoration: natural and supplemented recovery of human microbial communities. Nat Rev Microbiol 9:27–38. doi: 10.1038/nrmicro2473. [DOI] [PubMed] [Google Scholar]
  • 7.Sanders ME, Guarner F, Guerrant R, Holt PR, Quigley EMM, Sartor RB, Sherman PM, Mayer EA. 2013. An update on the use and investigation of probiotics in health and disease. Gut 62:787–796. doi: 10.1136/gutjnl-2012-302504. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Gracheva NM, Gavrilov AF, Solov'eva AI, Smirnov VV, Sorokulova IB, Reznik SR, Chudnovskaia NV. 1996. The efficacy of the new bacterial preparation biosporin in treating acute intestinal infections. Zh Mikrobiol Epidemiol Immunobiol 1996:75–77. (In Russian.) [PubMed] [Google Scholar]
  • 9.Horosheva T, Vodyanoy V, Sorokulova I. 2014. Efficacy of Bacillus probiotics in prevention of antibiotic-associated diarrhoea: a randomized, double-blind, placebo-controlled clinical trial. JMM Case Rep 2014:1. doi: 10.1099/jmmcr.0.004036. [DOI] [Google Scholar]
  • 10.Szajewska H, Kolodziej M. 2015. Systematic review with meta-analysis: Lactobacillus rhamnosus GG in the prevention of antibiotic-associated diarrhoea in children and adults. Aliment Pharmacol Ther 42:1149–1157. doi: 10.1111/apt.13404. [DOI] [PubMed] [Google Scholar]
  • 11.Reid G. 2015. The growth potential for dairy probiotics. Int Dairy J 49:16–22. doi: 10.1016/j.idairyj.2015.04.004. [DOI] [Google Scholar]
  • 12.Kandasamy S, Vlasova AN, Fischer D, Kumar A, Chattha KS, Rauf A, Shao L, Langel SN, Rajashekara G, Saif LJ. 2016. Differential Effects of Escherichia coli Nissle and Lactobacillus rhamnosus strain GG on human rotavirus binding, infection, and B celliImmunity. J Immunol 196:1780–1789. doi: 10.4049/jimmunol.1501705. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Shornikova AV, Casas IA, Mykkanen H, Salo E, Vesikari T. 1997. Bacteriotherapy with Lactobacillus reuteri in rotavirus gastroenteritis. Pediatr Infect Dis J 16:1103–1107. doi: 10.1097/00006454-199712000-00002. [DOI] [PubMed] [Google Scholar]
  • 14.Lee DK, Park JE, Kim MJ, Seo JG, Lee JH, Ha NJ. 2015. Probiotic bacteria, B longum and L acidophilus inhibit infection by rotavirus in vitro and decrease the duration of diarrhea in pediatric patients. Clin Res Hepatol Gastroenterol 39:237–244. doi: 10.1016/j.clinre.2014.09.006. [DOI] [PubMed] [Google Scholar]
  • 15.Lehtoranta L, Pitkaranta A, Korpela R. 2014. Probiotics in respiratory virus infections. Eur J Clin Microbiol Infect Dis 33:1289–1302. doi: 10.1007/s10096-014-2086-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Sorokulova IB, Kirik DL, Pinchuk IV. 1997. Probiotics against Campylobacter pathogens. J Travel Med 4:167–170. doi: 10.1111/j.1708-8305.1997.tb00813.x. [DOI] [PubMed] [Google Scholar]
  • 17.Sorokulova I. 2008. Preclinical testing in the development of probiotics: a regulatory perspective with Bacillus strains as an example. Clin Infect Dis 46:S92–S95. doi: 10.1086/523334. [DOI] [PubMed] [Google Scholar]
  • 18.Pinchuk IV, Bressollier P, Verneuil B, Fenet B, Sorokulova IB, Megraud F, Urdaci MC. 2001. In vitro anti-Helicobacter pylori activity of the probiotic strain Bacillus subtilis 3 is due to secretion of antibiotics. Antimicrob Agents Chemother 45:3156–3161. doi: 10.1128/AAC.45.11.3156-3161.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Rybalko SL, Khristova ML, Shapiro AV, Varbanets LD, Zubkova NL, Zadorozhna VI, Ivans'ka NV, Sorokulova IB, Grytsak TF, Furzikova TM, Pinchuk IV, Patskovski YV, Diadiun ST, Smirnov VV, Urdaci MA. 2003. Usage of new bacterial adjuvants for vaccination by anti-influenza and anti-poliomyelitis vaccines. Biopolym Cell 19:262–269. doi: 10.7124/bc.00065A. [DOI] [Google Scholar]
  • 20.Rybalko SL, Maximenok EV, Khristova ML, Shapiro AV, Varbanets LD. 2005. Carbohydrates biopolymers of bacteria mimic peptides of influenza virus and HIV. Lab Diagn 2:26–30. [Google Scholar]
  • 21.Johnson MA, Pinto BM. 2008. Structural and functional studies of peptide-carbohydrate mimicry, p 55–116. In Peters T. (ed), Bioactive conformation II, vol 273. Springer-Verlag Berlin, Berlin. [DOI] [PubMed] [Google Scholar]
  • 22.Sumi CD, Yang BW, Yeo IC, Hahm YT. 2015. Antimicrobial peptides of the genus Bacillus: a new era for antibiotics. Can J Microbiol 61:93–103. doi: 10.1139/cjm-2014-0613. [DOI] [PubMed] [Google Scholar]
  • 23.Shah NS, Greenberg JA, McNulty MC, Gregg KS, Riddell J, Mangino JE, Weber DM, Hebert CL, Marzec NS, Barron MA, Chaparro-Rojas F, Restrepo A, Hemmige V, Prasidthrathsint K, Cobb S, Herwaldt L, Raabe V, Cannavino CR, Hines AG, Bares SH, Antiporta PB, Scardina T, Patel U, Reid G, Mohazabnia P, Kachhdiya S, Le BM, Park CJ, Ostrowsky B, Robicsek A, Smith BA, Schied J, Bhatti MM, Mayer S, Sikka M, Murphy-Aguilu I, Patwari P, Abeles SR, Torriani FJ, Abbas Z, Toya S, Doktor K, Chakrabarti A, Doblecki-Lewis S, Looney DJ, David MZ. 2016. Bacterial and viral co-infections complicating severe influenza: incidence and impact among 507 U.S. patients, 2013-14. J Clin Virol 80:12–19. doi: 10.1016/j.jcv.2016.04.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Abraham MK, Perkins J, Vilke GM, Coyne CJ. 2016. Influenza in the emergency department: vaccination, diagnosis, and treatment: clinical practice paper approved by American Academy of Emergency Medicine clinical guidelines committee. J Emerg Med 50:536–542. doi: 10.1016/j.jemermed.2015.10.013. [DOI] [PubMed] [Google Scholar]
  • 25.Belongia EA, Simpson MD, King JP, Sundaram ME, Kelley NS, Osterholm MT, McLean HQ. 2016. Variable influenza vaccine effectiveness by subtype: a systematic review and meta-analysis of test-negative design studies. Lancet Infect Dis 16:942–951. doi: 10.1016/S1473-3099(16)00129-8. [DOI] [PubMed] [Google Scholar]
  • 26.Li JH, Wang RQ, Guo WJ, Li JS. 2016. Efficacy and safety of traditional Chinese medicine for the treatment of influenza A (H1N1): a meta-analysis. J Chin Med Assoc 79:281–291. doi: 10.1016/j.jcma.2015.10.009. [DOI] [PubMed] [Google Scholar]
  • 27.Song JA, Kim HJ, Hong SK, Lee DH, Lee SW, Song CS, Kim KT, Choi IS, Lee JB, Park SY. 2016. Oral intake of Lactobacillus rhamnosus M21 enhances the survival rate of mice lethally infected with influenza virus. J Microbiol Immunol Infect 49:16–23. doi: 10.1016/j.jmii.2014.07.011. [DOI] [PubMed] [Google Scholar]
  • 28.Song M, Hong HA, Huang JM, Colenutt C, Khang DD, Thi VAN, Park SM, Shim BS, Song HH, Cheon IS, Jang JE, Choi JA, Choi YK, Stadler K, Cutting SM. 2012. Killed Bacillus subtilis spores as a mucosal adjuvant for an H5N1 vaccine. Vaccine 30:3266–3277. doi: 10.1016/j.vaccine.2012.03.016. [DOI] [PubMed] [Google Scholar]
  • 29.Berdy J. 2005. Bioactive microbial metabolites. A personal view. J Antibiot (Tokyo) 58:1–26. doi: 10.1038/ja.2005.1. [DOI] [PubMed] [Google Scholar]
  • 30.Torres NI, Noll KS, Xu S, Li J, Huang Q, Sinko PJ, Wachsman MB, Chikindas ML. 2013. Safety, formulation, and in vitro antiviral activity of the antimicrobial peptide subtilosin against herpes simplex virus type 1. Probiotics Antimicrob Proteins 5:26–35. doi: 10.1007/s12602-012-9123-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Vollenbroich D, Ozel M, Vater J, Kamp RM, Pauli G. 1997. Mechanism of inactivation of enveloped viruses by the biosurfactant surfactin from Bacillus subtilis. Biologicals 25:289–297. doi: 10.1006/biol.1997.0099. [DOI] [PubMed] [Google Scholar]
  • 32.Huang XQ, Lu ZX, Zhao HZ, Bie XM, Lu FX, Yang SJ. 2006. Antiviral activity of antimicrobial lipopeptide from Bacillus subtilis fmbj against pseudorabies virus, porcine parvovirus, Newcastle disease virus and infectious bursal disease virus in vitro. Int J Pept Res Ther 12:373–377. doi: 10.1007/s10989-006-9041-4. [DOI] [Google Scholar]
  • 33.Jones JC, Turpin EA, Bultmann H, Brandt CR, Schultz-Cherry S. 2006. Inhibition of influenza virus infection by a novel antiviral peptide that targets viral attachment to cells. J Virol 80:11960–11967. doi: 10.1128/JVI.01678-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Tanaka R, Ishima Y, Enoki Y, Kimachi K, Shirai T, Watanabe H, Chuang VTG, Maruyama T, Otagiri M. 2014. Therapeutic impact of human serum albumin-thioredoxin fusion protein on influenza virus-induced lung injury mice. Front Immunol 5:561. doi: 10.3389/fimmu.2014.00561. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Murphy PM. 2001. Viral exploitation and subversion of the immune system through chemokine mimicry. Nat Immunol 2:116–122. doi: 10.1038/84214. [DOI] [PubMed] [Google Scholar]
  • 36.Bell AW, Ward MA, Blackstock WP, Freeman HNM, Choudhary JS, Lewis AP, Chotai D, Fazel A, Gushue JN, Paiement J, Palcy S, Chevet E, Lafreniere-Roula M, Solari R, Thomas DY, Rowley A, Bergeron JJM. 2001. Proteomics characterization of abundant Golgi membrane proteins. J Biol Chem 276:5152–5165. doi: 10.1074/jbc.M006143200. [DOI] [PubMed] [Google Scholar]
  • 37.Laemmli UK. 1970. Cleavage of structural proteins during assembly of head of bacteriophage-T4. Nature 227:680–685. doi: 10.1038/227680a0. [DOI] [PubMed] [Google Scholar]
  • 38.Shevchenko A, Tomas H, Havlis J, Olsen JV, Mann M. 2006. In-gel digestion for mass spectrometric characterization of proteins and proteomes. Nat Protoc 1:2856–2860. doi: 10.1038/nprot.2006.468. [DOI] [PubMed] [Google Scholar]
  • 39.Gundry R, White M, Murray C, Kane L, Fu Q, Stanley B, Van Eyk J. 2009. Preparation of proteins and peptides for mass spectrometry analysis in a bottom-up proteomics workflow. Curr Protoc Mol Biol Chapter 10:Unit10.25. doi: 10.1002/0471142727.mb1025s88. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Lewis JK, Wei J, Siuzdak G. 2000. Matrix-assisted laser desorption/ionization mass spectrometry in peptide and protein analysis, p 5880–5894. In Meyers RA. (ed), Encyclopedia of analytical chemistry. John Wiley & Sons Ltd., Chichester, UK. [Google Scholar]

Articles from Antimicrobial Agents and Chemotherapy are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES