Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2017 Jul 7;7:4887. doi: 10.1038/s41598-017-05216-0

MALDI-TOF MS as a Novel Tool for the Estimation of Postmortem Interval in Liver Tissue Samples

Chengzhi Li 1,2,#, Zhengdong Li 2,#, Ya Tuo 3, Dong Ma 4, Yan Shi 4, Qinghua Zhang 4, Xianyi Zhuo 4, Kaifei Deng 2, Yijiu Chen 2, Zhenyuan Wang 1,✉, Ping Huang 2,✉
PMCID: PMC5501804  PMID: 28687792

Abstract

Estimation of the postmortem interval (PMI) is a complicated task in forensic medicine, especially during homicide and unwitnessed death investigations. Many biological, chemical, and physical indicators can be used to determine the postmortem interval, but most are not accurate. Here, we present a novel matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) method that can be used for the estimation of PMI using molecular images and multivariate analyses. In this study, we demonstrate that both rat and human liver tissues of various PMIs (0, 2, 4, and 6days) can be discriminated using MALDI imaging and principal component analysis (PCA). Using genetic algorithm (GA), supervised neural network (SNN), and quick classifier (QC) methods, we built 6 classification models, which showed high recognition capability and good cross-validation. The histological changes in all the samples at different time points were also consistent with the changes seen in MALDI imaging. Our work suggests that MALDI-TOF MS, along with multivariate analysis, can be used to determine intermediate PMIs.

Introduction

Postmortem interval (PMI) estimation is an important task in daily forensic casework.

The physical changes that occur after death, including the cooling of the body, rigor mortis, and the development of lividity, have long been recognized as early postmortem phenomena1. These signs continue to be the main basis for estimating the PMI1. For many years, various approaches have been used to determine the PMI, including examinations of thanatochemistry2, 3, DNA/RNA degradation4, 5, and forensic entomology6, 7. However, these methods estimate the postmortem interval using a few—or even just one—specific parameters, and their precision and time-frame of applicability are often limited. In recent years, studies of postmortem microbial communities8–11, and postmortem metabolomics/lipidomics1, 12, 13, have emerged, and have been successfully applied to PMI estimation. These technologies may be a potential tool for PMI estimation in forensic practice.

Since its introduction in 1985 by Hillenkamp et al.14, matrix-assisted laser desorption ionization (MALDI) has seen rapid development in the life sciences and medicine15. An important component of the success of this technique has been MALDI imaging mass spectrometry (IMS) of tissue sections, which was introduced in 1997 by Caprioli and coworkers16. The label-free nature and lack of requirement for prior knowledge make it highly suitable for both explorative, as well as comparative, research of various tissue samples17. The use of MALDI IMS offers the ability to investigate pathophysiological changes taking place directly in a tissue while retaining the histopathological context, allowing the simultaneous mapping of hundreds of peptides and proteins present in tissue sections, with a lateral resolution of approximately 50–75 microns18. MALDI IMS is evolving into a powerful tool for biomedical research19, and this technology has been applied to a variety of analyte classes, including pharmaceuticals20, 21, metabolites22, lipids23, peptides24, 25, and proteins26, 27.

When a rat or human dies, the internal organs will decay in a time-dependent manner. Therefore, the relative intensities of signals from peptides or proteins will vary by body organ and postmortem interval. To address the effect of the time since death on the decomposition of internal organs, we describe here results of a study on postmortem rat and human liver tissues. We hypothesized that, as a rat or human body decomposes, the relative signal intensities from different peptides or proteins within the internal organs will change. To assess this hypothesis, we measured rat and human liver samples at various time intervals after death (range = 0–144 hours) using MALDI-TOF MS on peptides and proteins, and used a profiling acquisition, imaging, and bioinformatics package for inspection and comparison of data sets.

Results

Observation of changes in rat and human liver samples at different PMIs with HE staining

From a PMI of 0 h to that of 144 h, the severity of both rat and human liver cell autolysis continuously increased, as shown in the micrographs of postmortem liver cells (hematoxylin and eosin staining, 20× magnification) (Fig. 1). At 0 h, all of the liver cells and cell nuclei were clearly visible. At 48 hours after death, the nuclei were observed to shrink, and partial degradation was seen in the hepatocytes (Fig. 1). After 96 hours, the nuclei completely disappeared, and 144 hours after death, the liver cell structure itself had mostly disappeared.

Figure 1.

Figure 1

Histological changes at (a) 0, (b) 48, (c) 96, and (d) 144 h postmortem for liver tissues. (A) in SD rat liver samples; (B) in human liver samples.

MALDI imaging of liver samples from rats and humans

All of the liver tissue sections, obtained from different PMI groups, were examined using hematoxylin and eosin staining, as well as MALDI imaging. After acquiring imaging data from all the tissue sections, the FlexImaging 3.0 software program was used to select peptides with strong spectral signals to generate MALDI images (Fig. 2) for the different PMI groups. From the spectra, we found that most peaks were in the 700–4000 Da range (Fig. 3). Before the generation of ion density maps, the spectra were normalized to the total ion current to minimize spectrum-to-spectrum differences in peak intensities. For the generated images, the peaks at m/z = 1364.038, 1461.061, and 1492.089 in the rat liver tissues, and 3197.037, 3233.081, and 3359.019 in the human liver tissues, for example, showed marked decreases in intensity between 0 h and 144 h postmortem (Fig. 2).

Figure 2.

Figure 2

Ion signals showing an obvious change at different PMIs. (A) In SD rat liver samples; (B) in human liver samples.

Figure 3.

Figure 3

(a–d) Representative mass spectrum at (a) 0, (b) 48, (c) 96, and (d) 144 h postmortem for liver tissues. (e–h) Average peptide/protein profiles at (e) 0, (f) 48, (g) 96, and (h) 144 h postmortem for liver tissues. (A) In SD rat liver samples; (B) in human liver samples.

Processing MALDI IMS data using PCA

Multiple spectra (n ≈ 150) per region of interest were selected from the MALDI IMS data. Comparisons of regions of interest for the different PMI groups were conducted with a principal component analysis (PCA) based on peptide or protein patterns. Using PCA, the different PMI groups were separated from each other successfully (Fig. 4). This means that the various peptides and proteins present in the rat and human liver samples change significantly with time after death.

Figure 4.

Figure 4

Principal component analysis (PCA) of MALDI IMS data acquired in the liver samples at 0 h (red), 48 h (green), 96 h (blue), 144 h (yellow) postmortem. (A) In SD rat liver samples; (B) in human liver samples.

Gel view of PMI group data

The gel view displays all of the spectra from the loaded classes arranged into a pseudo-gel configuration. The x-axis records the m/z value, while the y-axis displays the running spectrum number originating from subsequent spectral loading. The peak intensity is expressed by a color code. The color bar and the y-axis indicate the relationship between the color of a peak and the corresponding intensity in arbitrary units. The intensities of the major peaks for each PMI group were significantly different from those of all other PMI groups (Fig. 5).

Figure 5.

Figure 5

Gel view of data from different PMI groups. (A) In SD rat liver samples; (B) in human liver samples.

Differences in peaks at various PMIs and establishment of classification models

Overall, 57 peptide/protein peaks from rat liver samples, and 43 from human liver samples, showed significant differences in the spectra of the training group data sets generated by MALDI-TOF MS (Supplementary Tables S1 and S2). Peptide/protein peaks with m/z = 2825.524 and 1595.481 in rat liver tissues, and 3335.815 and 453.348 in human liver tissues, exhibited the greatest differences in peak intensity between different PMIs (p < 0.00001). Because of this, these peaks were plotted as 2D peak distributions (Fig. 6). Three algorithms, GA (optimized by adjusting the number of neighbors for k-nearest neighbor classification), SNN, and QC, were used for classification model construction using spectral data from the training group generated by MALDI-TOF MS. The recognition capability, cross-validation, and overall accuracy of the models are presented in Tables 1 and 2.

Figure 6.

Figure 6

Two-dimensional peak distributions of peptides with m/z = 2825.524, 1595.481, 3335.815, and 453.348 for different PMI groups. (A) In SD rat liver samples; (B) in human liver samples.

Table 1.

Cross-validation and recognition capability of the three algorithms used to classify different PMIs in rat liver tissues.

Algorithm Model name Cross-validation (%) Recognition capability (%) Overall accuracy (%)
GA GA 92.16 95.50 92.20
SNN SNN 74.87 96.38 83.34
QC QC 79.85 79.53 75

Table 2.

Cross-validation and recognition capability of the three algorithms used to classify different PMIs in human liver tissues.

Algorithm Model name Cross-validation (%) Recognition capability (%) Overall accuracy (%)
GA GA 80.96 91.07 90.73
SNN SNN 88.12 95.54 92.40
QC QC 82.59 85.71 82.60

Discussion

Precise estimation of the PMI has been difficult since the very beginning of forensic medicine. It is one of the fundamental tasks of the forensic pathologist summoned to the scene where a body has been found28. MALDI IMS is an effective tool that provides molecular images of tissues during the molecular discovery process29. It has high speed and throughput, simple sample handling, and excellent reproducibility30. This powerful technology is widely used for proteome and peptidome imaging. By collecting mass spectra at discrete spatial points, one can generate ion images reflecting the localization of biomolecules. With this information, one can further map and study the 2D molecular profile of a tissue section. These benefits make it an ideal method for the estimation of PMI. The liver is optimal for this process because it exhibits autolysis, rapid putrefaction, and the presence of a homogenous cell population, which alleviates the effect of between-cell variation31.

MALDI IMS is being used increasingly often for disease diagnosis and classification32, 33. In this study, we investigated the use of MALDI IMS for profiling the proteins and peptides in rat and human liver tissue samples of different PMIs. The peaks at m/z = 1364.038, 1461.061, and 1492.089, for example, in rat liver tissues, and 3197.037, 3233.081, and 3359.019 in human liver tissues, strongly decreased in intensity with increasing PMI (Fig. 2). These changes detected with MALDI IMS are consistent with the histological changes in rat and human liver tissues with intermediate PMIs Fig. 1. In our previous study31, we also found the infrared microspectral imaging changes were consistent with pathological postmortem changes in rat liver tissues.

The intensities of peptide/protein peaks, such as m/z 1595.481, 2825.524, 1426.773, 3810.226, 4621.661 in rat liver tissues and 453.348, 3335.815, 3208.154, 616.574, 3476.852 in human liver tissues, changed significantly from time zero to 144 h postmortem. In total, four protein signals in rat liver tissues, and three in human liver tissues were identified (Tables 3 and 4). At 48 h postmortem, some new peaks appeared both in rat and human liver tissues, suggesting that the liver peptide/protein degraded obviously on account of autolysis or decomposition. At 96 h postmortem, some peaks disappeared gradually, suggesting that the liver peptide/protein degraded seriously. After 144 h postmortem, few or no peaks can be detected by MALDI-TOF MS system, suggesting that the liver peptide/protein degraded completely. Our results showed that the significantly changed peptide/protein peaks in rat liver tissues were not the same as in human liver tissues. That may be result from the difference of internal environments, such as enzymes activity and microbial activities, in rat and human livers. Though the constructed PMI classification models with a high recognition capacity and good cross-validation in both the rat and human liver tissues, the model built in rats can’t be used to predict PMI in humans. Overall, the postmortem changes in rat liver tissues were similar with human liver tissues.

Table 3.

The identification of the potential markers used for the estimation of PMI in rat liver tissues.

Protein Meas. M/z Calc. MH+ Number of matched peptides Mascot Score Sequence
uncharacterized protein LOC102151723 9934.369 9939.046 6 56.10 TWAVVSDAVGCVEGALRPVAQVGQHQAPVTQVGQHQAPLTQITMSVYTVAALPGPWGCSRDSTTACSALAPWPSPSLPTATLPAHGAQTVPLLGVHI
basic proline-rich protein-like 6274.792 6275.068 4 54.80 LLQADQHRAPSTPAPTADGAGGSAASPAHPEPQPIAGGGGGGGGGAGTSSPAAGARPGPPRPAPPPACR
olfactory receptor 2G3-like 6252.396 6258.314 7 63.20 ALGTCGSHLLVVSLFYGTITAVYIQPNSSYAHTHGKFISLFYTVVTPTLNPLIYTLR
interferon omega 5 precursor 3918.777 3916.990 6 59.30 TQAISVLHEMLQQTFLLFHTERSSAAWDSTLLDK

Table 4.

The identification of the potential markers used for the estimation of PMI in human liver tissues.

Protein Meas. M/z Calc. MH+ Number of matched peptides Mascot Score Sequence
Rho GTPase-activating protein 24 3233.339 3233.619 4 44.20 MGILNSDTLGNPTNVRNMSWLPNGYVTLR
Amine oxidase 3327.452 3328.533 5 32.70 QPVDRIYFAGTETATHWSGYMEGAVEAGER
Small vasohibin-binding protein 686.286 686.329 1 14.50 MDPPAR

PCA is a common mathematical technique that is used for the analysis, visualization, and compression of biological data. The primary goal of PCA is to reduce the dimensionality of a data set, while simultaneously retaining the information present. This technique transforms the original variables, defined by peaks intensities, to new variables, which are called the principal components (PCs), which best explain the variance in the data set18. This variable transformation is defined in such a way that the first PC has the largest possible variance, with the ultimate goal of discarding the components that are not significant, while reconstructing images that contain most of the original information18.

In this study, MALDI imaging data for samples taken at PMIs of 0 h, 48 h, 96 h, and 144 h in both rat and human liver tissues were analyzed using PCA. The PCA score plots showed that the different groups were well separated from each other for both rat and human liver tissues Fig. 4. Respectively, PC1, PC2, and PC3 describe 36%, 15%, and 12% of the original observation variability in rat liver tissues, and 30%, 19% and 11% in human liver tissues. These were chosen to generate score plots (Fig. 4). The potential chemical markers that contributed most to the differences of the different time groups were observed from the loading plot. In this plot, ion signals at m/z = 2825.524, 1595.481, 1426.773, 3810.226, and 3905.093 in rat liver tissue, and 790.992, 453.348, 3476.852, 3335.815, and 616.574 in human liver tissue were selected as potential markers for the estimation of PMI. Generally, the intensity of these ion signals exhibited large differences among the different PMIs.

In our study, the GA, SNN, and QC algorithms were used to build classification models based on the MALDI IMS data set derived from the different PMI groups. The classification of different time group data yielded high recognition capacity and good cross-validation in both the rat and human liver tissues (Tables 1 and 2). The application of our model to different test sets also achieved high accuracy in discriminating PMI groups. In short, we generated classification models both in rat and human liver tissues based on MALDI IMS-derived spectral data, and these models were well suited for the accurate estimation of PMI.

Previous studies have shown notable trends in the relative abundances of different bacterial taxa in the buccal cavities and rectums of rat corpses, as well as the internal organs, buccal cavities, and blood of human corpses throughout the decomposition process9, 34. Metcalf et al. also found that postmortem microbial communities changed in a clock-like manner that provided an estimate of absolute PMI, which is similar to the use of the development of fly larvae to estimate the PMI10. In this study, we found that the peptides or proteins of the rat and human livers also showed obvious changes at different PMIs. Takako Sato et al. detected 70 metabolites in cardiac blood and found that among these, 25 metabolites had a strong statistical correlation with the PMI, which was similar to the report of Donaldson et al.1, 12. Kaszynski et al. identified 175 and 163 metabolites in muscle and serum samples of mice, respectively, and found that 17 (9.7%) and 14 (8.5%) of the total number of metabolites demonstrated significant correlation with the PMI35. In our study, we detected 57 and 43 peaks in rat and human liver tissues, respectively, and found that these peaks had a strong statistical correlation with the PMI. In general, the results of this study in rat livers were in good agreement with our previous studies31, 36. To date, this study is the first to combine MALDI imaging mass spectrometry with multivariate analysis for the estimation of postmortem interval in both rat and human models.

Although MALDI IMS is a promising method for PMI estimation, it also has limitations. The sample preparation process must be carried out as quickly as possible without exposing the samples to air, moisture, or high temperatures. Also, all types of sample treatments, including cutting, washing, or matrix application, can lead to sample contamination and molecular diffusion, which could negatively affect the reproducibility of the data, complicate the analysis, or affect the quality of the image37. Additionally, in this work, we only studied rat and human samples at constant temperature. The effects of various factors, such as temperature, humidity, and cause of death, should be considered in future studies.

In conclusion, we demonstrated that MALDI IMS, combined with multivariate analysis, can be utilized to estimate intermediate PMIs based on protein or peptide signatures in rat and human liver tissue samples. Large correlations between MALDI IMS and histological changes were also found in both rat and human liver tissues. The classification models constructed can be used for the estimation of PMI under specific conditions.

Materials and Methods

Materials and instruments

Trifluoroacetic acid, acetonitrile, and ethanol were purchased from Sigma-Aldrich (St. Louis, MO). An Autoflex III SmartBeam MALDI-TOF MS system, MTP Slide Adapter II, ImagePrep, conductive slides, sinapinic acid, and α-cyano-4-hydroxy cinnamic acid were purchased from Bruker Daltonics (Bremen, Germany). Optimum cutting temperature (OCT) compound was obtained from Leia (Leica Microsystems Nussloch GmbH, Germany). A peptide calibration standard was also obtained from Bruker Daltonics, which included angiotensin II, angiotensin I, substance P, bombesin, adrenocorticotrophic hormone clip 1–17, adrenocorticotrophic hormone clip 18–39, somatostatin 28, and rennin substrate. A Labconco Centrivap cold trap and concentrator was obtained from LabconcoCorp. (Kansas City, MO, USA). A Leica CM 1950 cryostat was purchased from Leica (Leica Biosystems Nussloch GmbH, Germany).

Sampling procedures

Thirty-six adult Sprague-Dawley rats weighing between 250 and 300 g, and 24 in vitro right posterior lobe of livers (human) weighing 200 g, were kept in an incubator under constant conditions (23 ± 1 °C, 30–45% relative humidity). Before euthanasia by mechanical asphyxia, the rats were sedated with subcutaneous injection of phenobarbital sodium (50–60 mg/kg). Rat liver samples were collected by dissection at four PMIs (0, 48, 96, and 144 h). In vitro right posterior lobe of livers (human) were obtained from individuals who suffered sudden cardiac death or car accident, and the corpses were kept in a freezer starting immediately after death (Supplementary Table S3). The time when a corpse was dissected was marked “0 h”. In vitro right posterior lobes of livers (human) were collected after dissection at four “PMIs” (0, 48, 96, and 144 h). For sampling, the right posterior lobe of livers (human) were cut into broad strips using two parallel razor blades mounted 8 mm apart, and the strips were subsequently trimmed to an average size of 10 mm × 10 mm × 8 mm. Then, the liver strips were washed with phosphate-buffered saline (PBS), loosely wrapped in aluminum foil, and frozen in liquid nitrogen at temperatures below −70 °C by gently lowering the tissue into liquid nitrogen and maintaining it for 30–60 s. Finally, all samples were stored in a freezer at −80 °C until they were required for analysis.

This study was approved by the Science and Ethics Committee of Xi’an Jiaotong University Health Science Center, and the methods were carried out in accordance with the approved guidelines and regulations. Informed consent was obtained from next-of-kin relatives of the cases.

Sample preparation

For MALDI-TOF MS analysis, serial sections (10 µm) were cut from the frozen tissue samples with a Leica CM 1950 cryostat at −20 °C. The sections were placed with forceps onto either a regular glass slide for hematoxylin and eosin (HE) staining or an indium tin oxide-coated glass slide (Bruker Daltonics) for MALDI analysis. Prior to rinsing with 70% ethanol and 100% ethanol for 12 s, the sections for MALDI analysis were transferred to a cold room (−4 °C) and dried for 10 min in a Labconco Centrivap cold trap and concentrator. After washing with ethanol, the sample was dried again. Tissue fixation and removal of salts and other contaminants was carried out through a series of ethanol/water washing steps, as described in previous studies37–40. Later, the MALDI matrix was applied using the ImagePrep system, and the standard protocol provided with the instrument was followed. A solution of sinapinic acid (10 mg/mL) in water/acetonitrile 40:60 (v/v) with 0.2% trifluoroacetic acid was used as the matrix for the MALDI measurements of rat and human liver tissues. The Bruker default method consisted of 5 phases in total, each including individual cycles of incubation, nebulization and dehydration. Phases 2–5 were controlled by an optical sensor, which measured the moisture, matrix layer thickness, and dehydration parameters, by monitoring the scattered light intensity by refraction index matching41. The amount of matrix was then applied in a defined range (minimum/maximum number) of cycles based on a given sensor signal or the defined range of spray cycles that are specified within each phase41. Spray time was approximately 2 s, and incubation time was 30 s. The detailed pretreatments for peptide/protein analysis, such as fresh frozen tissue sample preparation and matrix application, were prepared as reported in earlier studies37–42.

MALDI-TOF MS analysis

Analysis of tissue sections was performed using an Autoflex III SmartBeam MALDI-TOF mass spectrometer equipped with a 337-nm Nd:YAG laser. The spectra were recorded in the positive linear mode (delay: 200 ns; ion source 1 (IS1) voltage: 20.00 kV; ion source 2 (IS2) voltage: 18.90 kV; lens voltage: 6.5 kV; sampling rate, 0.1 GS/s; mass range: 400 Da to 10,000 Da; peak assignment tolerance: 20 ppm). For MALDI IMS data acquisitions, 500 shots were summed per array position with a spatial resolution of 1000 µm. Data acquisition was carried out at 44% of the maximum laser energy. Software used for data acquisition was Flex Control 3.0 (Bruker Daltonics) with the LP_ProtMix method,which is mainly used for peptides or proteins analysis. Prior to the analysis of a tissue sample on the plate, external calibration was accomplished to minimize the mass shift by using a calibration mixture of peptides and proteins, which was deposited on the surface of the sample support materials and covering the mass range of 700–4000 Da.

Statistical analysis and spectral classification

The ClinProTools software 2.2 (Bruker Daltonics) was used for the analysis of all imaging data derived from the sections of the rat and human liver samples taken at different PMIs. All data comparisons were performed equally, summarizing signals above a signal-to-noise ratio greater than 3.0. All spectra were routinely baseline-corrected using the Top Hat algorithm with a 10.0% minimal baseline width, and smoothed using the Savitzky–Golay algorithm with a 5.0 width (m/z) and 2 cycles. The intensities of the peaks of interest were normalized with the peak intensity of an ACTH internal standard. The pretreated data were then used for visualization and statistical analysis using ClinProTools.

Differences in peptide peaks among the different time groups were selected using the peak intensity as the basis of statistical differences. Built-in mathematical models in ClinProTools2.2 (the GA, SNN algorithm, and QC algorithm) were then used to select peptide peaks and set up classification models to determine the optimal separation planes between samples from different PMIs.

After each model was generated, a random cross-validation process was carried out with the software, and the percent to leave out and number of iterations were set at 20 and 10, respectively. The models were then validated using the test set in a blinded manner. To determine the accuracy of the class prediction model, the software quantifies recognition capability and cross-validation. Recognition capability describes the performance of an algorithm, i.e., the proper classification of a given data set43. Cross-validation is a measure of the reliability of a model and can be used to predict how a model will behave in the future. This method is used for evaluating the performance of an algorithm for a given data set and under a given parameterization43. To minimize sampling errors, the selection for the training and test sets was repeated 30 times. The classification results given in the tables are the average of the 30 single classification results. For multivariate analyses, PCA was performed to observe the differential distribution of masses at the surfaces of the tissues.

Peptide/protein Identity Assignment

MALDI MS spectra of each selected peptide were obtained using an Autoflex III SmartBeam MALDI-TOF MS instrument operated in linear positive ion mode with spectra acquired in the range of m/z 400–10,000. The obtained spectra were processed using flexAnalysis 3.3 (Bruker Daltonik). Data were submitted to Mascot Server 2.5.14 (Matrix Science, Boston, USA) and run against the SwissProt database (SwissProt 2016_10) in human sample and NCBIprot database (NCBIprot_20161127) in rat sample to match the peptide sequences to their corresponding intact proteins. Trypsin was chosen as the protease in the search parameter. SwissProt database search included 552884 sequences, and 197760918 residues; specifically from the taxonomy “Homo sapiens” 20121 entries were searched. NCBIprot database search included 106762850 sequences, and 39119668168 residues; specifically from the taxonomy “Other mammalia” 1787181 entries were searched. The protein N-term, was selected for modification in human samples, and carbamidomethyl (C) for rat samples, respectively (Tables 3 and 4).

Application of the complete classification models

Cadaver cases and sample collection

Liver samples derived from four human corpses (2 males and 2 females) from routine forensic casework with postmortem intervals between 6–168 h were collected. This study was approved by the Science and Ethics Committee of Xi’an Jiaotong University Health Science Center, and the methods were carried out in accordance with the approved guidelines and regulations. Informed consent was obtained from next-of-kin relatives of the cases. PMIs were certified by local police departments. The age, sex, cause of death, ambient temperature, and PMI at the time of sampling were documented for each corpse (Table 5).

Table 5.

Basic information of each corpse used for PMI classification.

Case Name Age (years) Sex Cause of Death Place of Death Ambient Temperature (C°) PMI (hours)
Case A 54 Male Coronary Heart Disease Hospital 24 62
Case B 62 Male Coronary Heart Disease Hospital 24 112
Case C 25 Female Chest Trauma Factory 20 168
Case D 34 Female Car Accident Road 20 6

MALDI-TOF MS analysis and PMI classification

The details of the MALDI-TOF MS analysis were described in the section of MALDI-TOF MS analysis. After measurements of each collected sample, the representative data were then classified by the complete classification model of human liver tissues. The results were showed in Tables 6, 7 and 8.

Table 6.

Real routine applications of the complete GA classification model.

Case Name GA Classification Model
0 h postmortem 48 h postmortem 96 h postmortem 144 h postmortem
Case A 10.00% 83.33% 6.67% 0%
Case B 0% 11.43% 80.00% 8.57%
Case C 2.63% 5.26% 15.79% 76.32%
Case D 86.11% 11.11% 2.78% 0%
Table 7.

Real routine applications of the complete SNN classification model.

Case Name SNN Classification Model
0 h postmortem 48 h postmortem 96 h postmortem 144 h postmortem
Case A 16.67% 76.67% 3.33% 3.33%
Case B 2.86% 8.57% 82.86% 5.71%
Case C 0% 7.89% 13.16% 78.95%
Case D 80.56% 16.67% 2.78% 0%
Table 8.

Real routine applications of the complete QC classification model.

Case Name QC Classification Model
0 h postmortem 48 h postmortem 96 h postmortem 144 h postmortem
Case A 13.33% 80.00% 6.67% 0%
Case B 0% 14.29% 77.14% 8.57%
Case C 0% 7.89% 18.42% 73.68%
Case D 75.00% 19.44% 5.56% 0%

Effectiveness of the complete classification models

For the complete classification models, we tested whether it is possible to discriminate corpse liver tissues of different PMIs in routine forensic casework. The results showed that Case A (62 h postmortem), B (112 h postmortem), C (168 h postmortem), D (6 h postmortem) was classified for “48 h postmortem”, “96 h postmortem”, “144 h postmortem”, “0 h postmortem” with a high possibility, respectively, by all classification models. These results indicate that the classification models we have set up are useful, additional tool for the PMI estimation in routine forensic casework.

Electronic supplementary material

Acknowledgements

We acknowledge all of our study participants, whose cooperation was essential to the completion of this work. This study was supported by the National Natural Science Foundation of China (81601645, 81671869, 81273339 and 81273335) and the Science and Technology Committee of Shanghai Municipality (17DZ2273200/16DZ2290900). English language editing was provided by Edanz Group Ltd (Beijing, China).

Author Contributions

C.Z.L. collected the MS data and performed the statistical analysis, contributed substantially to data interpretation, and drafted and critically revised the first draft of the manuscript. Z.D.L. contributed to study design and data interpretation and helped to draft the manuscript. K.F.D., Y.T., and D.M. performed sample preparation and tissue staining. Y.S. performed MALDI-Imaging analysis. Q.H.Z. in collaboration with X.Y.Z. participated in the statistic analysis. Y.J.C. contributed to study design and data interpretation. Finally, P.H. and Z.Y.W. designed and supervised the complete study. All authors reviewed and approved the final manuscript.

Competing Interests

The authors declare that they have no competing interests.

Footnotes

Chengzhi Li and Zhengdong Li contributed equally to this work.

Electronic supplementary material

Supplementary information accompanies this paper at doi:10.1038/s41598-017-05216-0

Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Contributor Information

Zhenyuan Wang, Email: wzy218@mail.xjtu.edu.cn.

Ping Huang, Email: huangp@ssfjd.cn.

References

  • 1.Sato T, et al. A preliminary study on postmortem interval estimation of suffocated rats by GC-MS/MS-based plasma metabolic profiling. Anal Bioanal Chem. 2015;407:3659–3665. doi: 10.1007/s00216-015-8584-7. [DOI] [PubMed] [Google Scholar]
  • 2.Palmiere C, Mangin P. Urea nitrogen, creatinine, and uric acid levels in postmortem serum, vitreous humor, and pericardial fluid. Int J Legal Med. 2015;129:301–305. doi: 10.1007/s00414-014-1076-z. [DOI] [PubMed] [Google Scholar]
  • 3.Tumram NK, Ambade VN, Dongre AP. Thanatochemistry: Study of synovial fluid potassium. Alexandria Journal of Medicine. 2014;50:369–372. doi: 10.1016/j.ajme.2014.02.005. [DOI] [Google Scholar]
  • 4.Poor VS, Lukacs D, Nagy T, Racz E, Sipos K. The rate of RNA degradation in human dental pulp reveals post-mortem interval. Int J Legal Med. 2016;130:615–619. doi: 10.1007/s00414-015-1295-y. [DOI] [PubMed] [Google Scholar]
  • 5.Hansen J, Lesnikova I, Funder AM, Banner J. DNA and RNA analysis of blood and muscle from bodies with variable postmortem intervals. Forensic Sci Med Pathol. 2014;10:322–328. doi: 10.1007/s12024-014-9567-2. [DOI] [PubMed] [Google Scholar]
  • 6.Wells JD, Lecheta MC, Moura MO, LaMotte LR. An evaluation of sampling methods used to produce insect growth models for postmortem interval estimation. Int J Legal Med. 2015;129:405–410. doi: 10.1007/s00414-014-1029-6. [DOI] [PubMed] [Google Scholar]
  • 7.Brown K, Thorne A, Harvey M. Calliphora vicina (Diptera: Calliphoridae) pupae: a timeline of external morphological development and a new age and PMI estimation tool. Int J Legal Med. 2015;129:835–850. doi: 10.1007/s00414-014-1068-z. [DOI] [PubMed] [Google Scholar]
  • 8.Metcalf JL, Carter DO, Knight R. Microbiology of death. Curr Biol. 2016;26:R561–563. doi: 10.1016/j.cub.2016.03.042. [DOI] [PubMed] [Google Scholar]
  • 9.Guo J, et al. Potential use of bacterial community succession for estimating post-mortem interval as revealed by high-throughput sequencing. Sci Rep. 2016;6:24197. doi: 10.1038/srep24197. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Metcalf, J. L. et al. Microbial community assembly and metabolic function during mammalian corpse decomposition. Science351 (2015). [DOI] [PubMed]
  • 11.Human Microbiome Project, C. Structure, function and diversity of the healthy human microbiome. Nature486, 207–214, doi:10.1038/nature11234 (2012). [DOI] [PMC free article] [PubMed]
  • 12.Donaldson AE, Lamont IL. Metabolomics of post-mortem blood: identifying potential markers of post-mortem interval. Metabolomics. 2014;11:237–245. doi: 10.1007/s11306-014-0691-5. [DOI] [Google Scholar]
  • 13.Wood, P. L. Lipidomics Analysis of Postmortem Interval: Preliminary Evaluation of Human Skeletal Muscle. Journal of Postgenomics Drug & Biomarker Development03, doi:10.4172/2153-0769.1000127 (2012).
  • 14.Karas M, Bachmann D, Hillenkamp F. Influence of the wavelength in high-irradiance ultraviolet laser desorption mass spectrometry of organic molecules. Anal Chem. 2002;57:347–348. [Google Scholar]
  • 15.Dreisewerd K. Recent methodological advances in MALDI mass spectrometry. Anal Bioanal Chem. 2014;406:2261–2278. doi: 10.1007/s00216-014-7646-6. [DOI] [PubMed] [Google Scholar]
  • 16.Caprioli RM, Farmer TB, Gile J. Molecular imaging of biological samples: localization of peptides and proteins using MALDI-TOF MS. Anal Chem. 1997;69:4751–4760. doi: 10.1021/ac970888i. [DOI] [PubMed] [Google Scholar]
  • 17.Cazares LH, Troyer DA, Wang B, Drake RR, Semmes OJ. MALDI tissue imaging: from biomarker discovery to clinical applications. Anal Bioanal Chem. 2011;401:17–27. doi: 10.1007/s00216-011-5003-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Mourino-Alvarez L, et al. MALDI-Imaging Mass Spectrometry: a step forward in the anatomopathological characterization of stenotic aortic valve tissue. Sci Rep. 2016;6:27106. doi: 10.1038/srep27106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Pietrowska M, Gawin M, Polanska J, Widlak P. Tissue fixed with formalin and processed without paraffin embedding is suitable for imaging of both peptides and lipids by MALDI-IMS. Proteomics. 2016;16:1670–1677. doi: 10.1002/pmic.201500424. [DOI] [PubMed] [Google Scholar]
  • 20.Nilsson A, et al. Mass spectrometry imaging in drug development. Anal Chem. 2015;87:1437–1455. doi: 10.1021/ac504734s. [DOI] [PubMed] [Google Scholar]
  • 21.Huang JT, et al. Molecular imaging of drug-eluting coronary stents: method development, optimization and selected applications. J Mass Spectrom. 2012;47:155–162. doi: 10.1002/jms.2046. [DOI] [PubMed] [Google Scholar]
  • 22.Bhandari DR, Schott M, Rompp A, Vilcinskas A, Spengler B. Metabolite localization by atmospheric pressure high-resolution scanning microprobe matrix-assisted laser desorption/ionization mass spectrometry imaging in whole-body sections and individual organs of the rove beetle Paederus riparius. Anal Bioanal Chem. 2015;407:2189–2201. doi: 10.1007/s00216-014-8327-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Berry KA, et al. MALDI imaging of lipid biochemistry in tissues by mass spectrometry. Chem Rev. 2011;111:6491–6512. doi: 10.1021/cr200280p. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Schober Y, Guenther S, Spengler B, Rompp A. High-resolution matrix-assisted laser desorption/ionization imaging of tryptic peptides from tissue. Rapid Commun Mass Spectrom. 2012;26:1141–1146. doi: 10.1002/rcm.6192. [DOI] [PubMed] [Google Scholar]
  • 25.Groseclose MR, Andersson M, Hardesty WM, Caprioli RM. Identification of proteins directly from tissue: in situ tryptic digestions coupled with imaging mass spectrometry. J Mass Spectrom. 2007;42:254–262. doi: 10.1002/jms.1177. [DOI] [PubMed] [Google Scholar]
  • 26.Seeley EH, Schwamborn K, Caprioli RM. Imaging of intact tissue sections: moving beyond the microscope. J Biol Chem. 2011;286:25459–25466. doi: 10.1074/jbc.R111.225854. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Deutskens F, Yang J, Caprioli RM. High spatial resolution imaging mass spectrometry and classical histology on a single tissue section. J Mass Spectrom. 2011;46:568–571. doi: 10.1002/jms.1926. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Kumar, S. et al. Temperature-Dependent Postmortem Changes in Human Cardiac Troponin-T (cTnT): An Approach in Estimation of Time Since Death †. J Forensic Sci (2015). [DOI] [PubMed]
  • 29.Seeley EH, Caprioli RM. MALDI imaging mass spectrometry of human tissue: method challenges and clinical perspectives. Trends Biotechnol. 2011;29:136–143. doi: 10.1016/j.tibtech.2010.12.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Casadonte R, Caprioli RM. Proteomic analysis of formalin-fixed paraffin-embedded tissue by MALDI imaging mass spectrometry. Nature Protocol. 2011;6:1695–1709. doi: 10.1038/nprot.2011.388. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Huang P, et al. Characterization of the Postmortem Interval by Infrared Microscopy. Anal Lett. 2015;49:290–298. doi: 10.1080/00032719.2015.1070162. [DOI] [Google Scholar]
  • 32.Mao X, et al. Application of imaging mass spectrometry for the molecular diagnosis of human breast tumors. Sci Rep. 2016;6:21043. doi: 10.1038/srep21043. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Meding S, et al. Tumor classification of six common cancer types based on proteomic profiling by MALDI imaging. J Proteome Res. 2012;11:1996–2003. doi: 10.1021/pr200784p. [DOI] [PubMed] [Google Scholar]
  • 34.Javan GT, et al. Human Thanatomicrobiome Succession and Time Since Death. Sci Rep. 2016;6:29598. doi: 10.1038/srep29598. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Kaszynski, R. H. et al. Postmortem interval estimation: a novel approach utilizing gas chromatography/mass spectrometry-based biochemical profiling. Anal Bioanal Chem, doi:10.1007/s00216-016-9355-9 (2016). [DOI] [PubMed]
  • 36.Huang P, Tian W, Tuo Y, Wang Z, Yang G. Estimation of Postmortem Interval in Rat Liver and Spleen Using Fourier Transform Infrared Spectroscopy. Spectrosc Lett. 2009;42:108–116. doi: 10.1080/00387010802375362. [DOI] [Google Scholar]
  • 37.Chughtai K, Heeren RM. Mass Spectrometric Imaging for Biomedical Tissue Analysis. Chem Rev. 2010;110:3237–3277. doi: 10.1021/cr100012c. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Han EC, et al. Direct tissue analysis by MALDI-TOF mass spectrometry in human hepatocellular carcinoma. Clin Chim Acta. 2011;412:230–239. doi: 10.1016/j.cca.2010.09.021. [DOI] [PubMed] [Google Scholar]
  • 39.Aerni HR, Cornett DS, Caprioli RM. Automated acoustic matrix deposition for MALDI sample preparation. Anal Chem. 2006;78:827–834. doi: 10.1021/ac051534r. [DOI] [PubMed] [Google Scholar]
  • 40.Beine B, Diehl HC, Meyer HE, Henkel C. Tissue MALDI Mass Spectrometry Imaging (MALDI MSI) of Peptides. Methods Mol Biol. 2016;1394:129–150. doi: 10.1007/978-1-4939-3341-9_10. [DOI] [PubMed] [Google Scholar]
  • 41.Kriegsmann, M. et al. Reliable entity subtyping in Non-small cell Lung Cancer by MALDI Imaging Mass Spectrometry on Formalin-fixed Paraffin-embedded Tissue Specimens. Molecular & Cellular Proteomics Mcp15 (2016). [DOI] [PMC free article] [PubMed]
  • 42.Wang S, et al. MALDI imaging for the localization of saponins in root tissues and rapid differentiation of three Panax herbs. Electrophoresis. 2016;37:1956–1966. doi: 10.1002/elps.201600027. [DOI] [PubMed] [Google Scholar]
  • 43.Yang L, et al. Classification of Epidermal Growth Factor Receptor Gene Mutation Status Using Serum Proteomic Profiling Predicts Tumor Response in Patients with Stage IIIB or IV Non-Small-Cell Lung Cancer. PLoS One. 2015;10:e0128970. doi: 10.1371/journal.pone.0128970. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES