Skip to main content
Acta Crystallographica Section F: Structural Biology Communications logoLink to Acta Crystallographica Section F: Structural Biology Communications
. 2017 Jul 26;73(Pt 8):476–480. doi: 10.1107/S2053230X17010640

The quorum-quenching lactonase from Alicyclobacter acidoterrestris: purification, kinetic characterization, crystallization and crystallographic analysis

Celine Bergonzi a,b, Michael Schwab a, Eric Chabriere b, Mikael Elias a,*
PMCID: PMC5544005  PMID: 28777091

A lactonase from Alicyclobacter acidoterrestris named AaL has been isolated, purified, characterized and crystallized. The structure of AaL is expected to provide insights regarding its catalytic mechanism of lactone hydrolysis.

Keywords: quorum sensing, quorum quenching, lactonases, thermophiles, Alicyclobacter acido­terrestris

Abstract

Lactonases comprise a class of enzymes that hydrolyze lactones, including acyl-homoserine lactones (AHLs); the latter are used as chemical signaling molecules by numerous Gram-negative bacteria. Lactonases have therefore been demonstrated to quench AHL-based bacterial communication. In particular, lactonases are capable of inhibiting bacterial behaviors that depend on these chemicals, such as the formation of biofilms or the expression of virulence factors. A novel representative from the metallo-β-lactamase superfamily, named AaL, was isolated from the thermoacidophilic bacterium Alicyclobacter acidoterrestris. Kinetic characterization proves AaL to be a proficient lactonase, with catalytic efficiencies (k cat/K m) against AHLs in the region of 105  M −1 s−1. AaL exhibits a very broad substrate specificity. Its structure is expected to reveal the molecular determinants for its substrate binding and specificity, as well as to provide grounds for future protein-engineering projects. Here, the expression, purification, characterization, crystallization and X-ray diffraction data collection of AaL at 1.65 Å resolution are reported.

1. Introduction  

Quorum sensing (QS) is a chemical communication mechanism used by microbes to coordinate behavior in a cell-density-dependent manner, such as in bioluminescence, biofilm formation, expression of virulence factors, swarming motility and many others (Bassler, 1999 ▸; Miller & Bassler, 2001 ▸). QS utilizes a variety of small diffusible molecules, including acyl-homoserine lactones (AHLs). AHLs can significantly vary with regard to their alkyl chain, which typically ranges from four to 14 C atoms and may include various chemical modifications [for example oxidation on carbon 3 (Lade et al., 2014 ▸) or a p-coumaroyl substituent (Schaefer et al., 2008 ▸)]. Quorum sensing can be quenched by enzymes called lactonases, which can catalyze the opening of the lactone ring (Bokhove et al., 2010 ▸; Hiblot, Gotthard, Elias et al., 2013 ▸).

AHL-degrading enzymes can be found in organisms beyond the bacterial world, and have been isolated from archaea, plants, fungi and mammals in addition to bacteria (LaSarre & Federle, 2013 ▸; Elias & Tawfik, 2012 ▸). Three large families of lactonases have been identified (Elias & Tawfik, 2012 ▸), and the three families have distinct structural properties. The paraoxonases, which exhibit a six-bladed β-propeller fold (Ben-David et al., 2013 ▸, 2015 ▸), have been shown to proficiently hydrolyze δ-lactones, γ-lactones and AHLs (Bar-Rogovsky et al., 2013 ▸; Khersonsky & Tawfik, 2005 ▸). Another family, the phosphotriesterase-like lactonases (PLLs), which exhibit a (β/α)8 fold, have been identified from numerous bacterial and archaeal sources, including extremophiles (Xiang et al., 2009 ▸; Hawwa et al., 2009 ▸; Afriat et al., 2006 ▸; Elias et al., 2008 ▸; Del Vecchio et al., 2009 ▸; Hiblot et al., 2012 ▸, 2015 ▸; Bzdrenga et al., 2014 ▸; Hiblot, Gotthard, Elias et al., 2013 ▸). PLLs show different substrate specificities and were divided accordingly: PLL-As can hydrolyze δ-lactones, γ-lactones and AHLs, whereas PLL-Bs prefer δ-lactones and γ-lactones (Hiblot et al., 2015 ▸).

The third family of lactonases are the metallo-β-lactamase-like lactonases (MLLs), illustrated by the first isolated and most studied representative: autoinducer inactivator A (AiiA) from Bacillus thuringiensis. The crystal structure of AiiA has been determined (Liu et al., 2005 ▸) and its catalytic mechanism has been investigated (Liu et al., 2008 ▸; Momb et al., 2008 ▸). Owing to its ability to disrupt bacterial quorum sensing, AiiA has been shown to protect plants from bacterial infection in a genetically modified plant system (Dong et al., 2000 ▸) as well as inhibiting bacterial biofilm formation (Augustine et al., 2010 ▸).

AaL (WP_021296945.1) is a recently identified enzyme that was isolated from the acidophilic, moderately thermostable bacterium Alicyclobacter acidoterrestris. A. acidoterrestris exhibits a broad growth-temperature range (25–60°C) and can grow at various pH values (pH 2.5–6.0) (Spinelli et al., 2009 ▸). AaL is a rare representative of the MLL family in thermophilic organisms: it shares 27% sequence identity with AiiA and 43% sequence identity with the closest known structure, AiiB (PDB entry 2r2d; Liu et al., 2007 ▸). AaL also shares 85% sequence identity with the recently crystallized lactonase GcL from Geobacillus caldoxylosilyticus (Bergonzi et al., 2016 ▸). Here, we report the protein production, purification, kinetic characterization, crystallization and preliminary X-ray diffraction data of the lactonase AaL.

2. Materials and methods  

2.1. Cloning, expression and purification of AaL  

The gene encoding AaL in the organism A. acidoterrestris (WP_021296945.1) was optimized for heterologous expression in Escherichia coli and was synthesized by GenScript (Piscataway, New Jersey, USA) (Table 1 ▸). The gene construct includes an N-terminal affinity Strep-tag (WSHPQFEK) followed by a TEV cleavage site (ENLYFQS) to allow nearly complete removal of the tag, leaving only an N-terminal serine residue after cleavage. The optimized AaL gene construct was cloned in pET-22b(+) (Novagen) using NdeI and XhoI as restriction sites.

Table 1. Expression and production of AaL.

Source organism A. acidoterrestris
DNA source Synthetic
Cloning vector pET-22b(+)
Expression vector pET-22b(+)
Expression host E. coli
Restriction sites NdeI, XhoI
Complete amino-acid sequence of the construct produced SMTNIAKAQPKLYVMDNGRMRMDKNWMIAMHNPATIANPNAPTEFIEFPIYTVLIDHPEGKILFDTSCNPDSMGAQGRWGEATQSMFPWTASEECYLHNRLEQLKVRPEDIKFVIASHLHLDHAGCLEMFTNATIIVHEDEFSGALQTYARNQTEGAYIWGDIDAWIKNNLNWRTIKRDEDNIVLAEGIKILNFGSGHAWGMLGLHVQLPEKGGIILASDAVYSAESYGPPIKPPGIIYDSLGFVRSVEKIKRIAKETNSEVWFGHDSEQFKRFRKSTEGYYETAGTAG

The protein was overproduced as described previously (Hiblot, Gotthard, Champion et al., 2013 ▸; Hiblot et al., 2012 ▸, 2015 ▸; Gotthard et al., 2011 ▸; Bergonzi et al., 2016 ▸). Protein expression was carried out in 1 l ZYP autoinducer medium (100 µg ml−1 ampicillin and 34 µg ml−1 chloramphenicol), inoculated with 10 ml of overnight pre-culture. Cell cultures were grown at 309 K until they reached the exponential growth phase (OD600 nm). The cell cultures then underwent a temperature transition at 290 K overnight, and 0.2 mM CoCl2 was added to the medium to assist proper folding of the metalloenzyme. The induction of AaL is caused by a shortage of glucose and the import of lactose from the autoinducer medium. The cells were pelleted by centrifugation at 272 K (4400g, 15 min). The pellets were resuspended in a lysis buffer composed of 50 mM HEPES pH 8, 150 mM NaCl, 0.2 mM CoCl2, 0.25 mg ml−1 lysozyme, 0.1 mM phenylmethylsulfonyl fluoride (PMSF). Cell lysis was performed using a sonication device (Q700 Sonicator, Qsonica, USA) through three sonication steps of 30 s at an amplitude of 45 (1 s pulse on; 1 s pulse off). Cell debris was removed by centrifugation at 272 K (5000g, 20 min) and the lysate was filtered using 0.22 µm filters (VWR, USA). The filtered lysate was subsequently applied onto a StrepTrap HP column (GE Healthcare) using a flow rate of 1 ml min−1. AaL was eluted with an elution buffer consisting of 50 mM HEPES pH 8, 150 mM NaCl, 2.5 mM desthiobiotin. Pure fractions were pooled and cleaved with TEV protease overnight at room temperature. The protein sample was filtered to remove the precipitated TEV protease (0.22 µm filters; VWR, USA) and loaded onto a size-exclusion column (HiLoad 16/600, Superdex 200, GE Healthcare) equilibrated in a buffer composed of 50 mM HEPES pH 8.00, 150 mM NaCl. Fractions containing nearly pure AaL protein were pooled and concentrated to 10 mg ml−1 using a centrifugation device (Vivaspin 15R, Sartorius, Germany). The yield was approximately 10 mg of nearly pure protein per litre of culture. The purity of the produced protein was assessed by Coomassie-stained SDS–PAGE (Fig. 1 ▸), revealing a band at ∼32.5 kDa that corresponds to monomeric AaL.

Figure 1.

Figure 1

12% SDS–PAGE of the AaL protein. Lane M contains molecular-weight markers (Precision Plus Protein Kaleidoscope Prestained Protein Standards from Bio-Rad; labelled in kDa). Lane 1 contains 10 µl AaL protein at 2.5 mg ml−1. The black arrow indicates the band for AaL.

2.2. Kinetic characterization of AaL  

Kinetic measurements were performed in triplicate at 298 K on a microplate spectrophotometer (Synergy HTX, BioTek, USA) running the Gen5.1 software (Table 2 ▸). In these experiments, a 200 µl reaction volume was used in a 96-well plate setup. Catalytic parameters were calculated by fitting the measured kinetic data to the Michaelis–Menten equation using the GraphPad Prism 5.0 software. The time course of lactone hydrolysis was monitored by a previously described pH-indicator assay using cresol purple (Bergonzi et al., 2016 ▸). Lactone hydrolysis generates a proton that subsequently acidifies the medium. The reaction rates can therefore be monitored at 577 nm in a weak buffer solution composed of 2.5 mM Bicine pH 8.3, 150 mM NaCl, 0.2 mM cresol purple and 0.5% DMSO over a range of substrate concentrations (0–2 mM). The extinction coefficient of cresol purple at pH 8.3 (∊577 nm = 2923 M −1 cm−1) was evaluated in situ by measuring the absorbance of the buffer with different concentrations of acetic acid (0–0.35 mM). A background rate was observed in the absence of substrate and enzyme, presumably corresponding to acidification by atmospheric CO2. This rate (−4 to −8 mOD min−1), which was independent of the substrate concentration, was subtracted from all measurements as described previously (Khersonsky & Tawfik, 2005 ▸). This rate was <5% of the rate observed with the enzyme.

Table 2. Kinetic parameters of AaL at 25°C.

  k cat (s−1) K m (µM) k cat/K m (s−1  M −1)
C4-AHL 13.54 ± 0.91 10.5 ± 0.3 (1.29 ± 0.37) × 106
C6-AHL 13.97 ± 0.43 82.7 ± 11.0 (1.69 ± 0.23) × 105
C10-AHL 5.13 ± 0.35 49.6 ± 1.4 (1.03 ± 0.30) × 105
3-Oxo-C12-AHL 5.03 ± 0.25 14.0 ± 3.4 (3.60 ± 0.88) × 105

2.3. Thermal stability of AaL  

The thermal stability of the enzyme against heat was determined using the ANS (8-anilinonaphthalene-1-sulfonic acid) fluorescence thermal shift assay (Fig. 2 ▸; Hawe et al., 2008 ▸). Triplicate samples (250 µl) containing 2.5 µM pure enzyme and 10 µM ANS were prepared. The samples were vortexed and incubated for 30 min at 25, 37, 45, 50, 55, 60, 70 and 80°C in different heating blocks. The samples were then assayed in a black, 96-well flat-bottom plate (Flat bottom 96 well, Fisherbrand) and measured using a fluorescence microplate reader (Synergy HTX, BioTek, USA) with the Gen5.1 software, using an excitation wavelength of 360 nm and an emission wavelength of 508 nm. The melting temperature of the enzyme (T m), defined here as the temperature at which 50% of the maximal ANS fluorescence was reached, was determined by fitting the ANS fluorescence signal to the following equation at different tested temperatures using the GraphPad Prism software,

2.3.

where X, Y and h represent the incubation temperature, the ANS fluorescence and the slope coefficient, respectively.

Figure 2.

Figure 2

Thermal stability determination of AaL using ANS as a fluorescent probe.

2.4. Crystallization of AaL  

Purified and concentrated AaL samples (10 mg ml−1) were subjected to crystallization trials (Table 3 ▸) using the sitting-drop vapor-diffusion method in a 96-well plate with the commercial kit JCSG+. Different protein:precipitant ratios were tested (1:1, 1:2 and 1:3) and the plate was incubated at 292 K. Small crystals appeared after 1 d at 292 K in a condition consisting of 0.45 M ammonium chloride, 16% polyethylene glycol 3350. In order to improve the crystal shape and size, micro-seeding was performed. A drop containing small protein crystals was pipetted, diluted, placed in 10 µl mother solution and vortexed for 30 s. This seed solution was diluted 75-fold and 0.1 µl of this diluted seeding solution was added to drops formed of 1 µl protein solution and 1 µl precipitant solution. Diffraction-quality crystals appeared after 1 d at 292 K (Fig. 3 ▸).

Table 3. Crystallization of AaL.

Method Sitting-drop vapor diffusion
Plate type 24-well plate
Temperature (K) 292
Protein concentration (mg ml−1) 10
Buffer composition of protein solution 50 mM HEPES pH 8.00, 150 mM NaCl
Composition of reservoir solution 0.45 M ammonium chloride, 16% polyethylene glycol 3350
Volume and ratio of drop 1:1
Volume of reservoir (µl) 500

Figure 3.

Figure 3

Typical crystals of the AaL protein. 1 scale unit = 110 µm.

2.5. Data collection  

Crystals were transferred into a cryoprotectant solution consisting of the mother liquor supplemented with 20%(v/v) (final concentration) glycerol. The crystals were incubated for 1 min in the cryoprotectant solution and were subsequently mounted on a CryoLoop (Hampton Research) and flash-cooled at 100 K in liquid nitrogen. X-ray diffraction intensities were collected on the 23-ID-B beamline at the Advanced Photon Source (APS), Argonne National Laboratory, Lemont, Illinois, USA (Table 4 ▸). Diffraction experiments were performed using a wavelength of 1.0332 Å with 0.2 s exposures, and data were collected on an EIGER detector. Diffraction data were collected using the fine-slicing method; individual frames consisted of 0.2° steps over a range of 1000 frames (Fig. 4 ▸).

Table 4. Data collection and processing.

Values in parentheses are for the outer shell.

Diffraction source 23-ID-B, APS
Wavelength (Å) 1.033200
Temperature (K) 100
Detector EIGER
Crystal-to-detector distance (mm) 200.0
Rotation range per image (°) 0.2
Total rotation range (°) 200
Exposure time per image (s) 0.2
Space group C2
a, b, c (Å) 111.72, 114.74, 79.97
α, β, γ (°) 90.0, 109.8, 90.0
Resolution range (Å) 1.65 (1.75–1.65)
Total No. of reflections 431338 (70385)
No. of unique reflections 111796 (17858)
Completeness (%) 98.2 (97.2)
Multiplicity 3.86 (3.94)
〈I/σ(I)〉 22.08 (3.16)
R r.i.m. (%) 3.6 (59.1)

Figure 4.

Figure 4

A diffraction frame from a crystal of AaL. The edge of the frame is at 1.23 Å resolution.

3. Results and discussion  

In this study, we provide the first characterization of a new lactonase, AaL, from the acidophilic, moderately thermophilic bacteria A. acidoterrestris. As expected, AaL is only a moderately thermostable enzyme (T m of 58.2 ± 1.1°C) and is less stable than the recently isolated lactonase GcL from G. caldoxylosilyticus (half-life of 109.1 ± 7 min at 75°C; Bergonzi et al., 2016 ▸). Our kinetic data on various AHL substrates demonstrate that AaL is a proficient enzyme. It is among the most active lactonases characterized thus far, and is approximately tenfold more active than the well characterized AiiA against C6-HSL at 25°C (Momb et al., 2008 ▸). In fact, AaL compares with GcL and is two orders of magnitude more active against C4-AHL (Bergonzi et al., 2016 ▸). Kinetic measurements reveal that AaL exhibits similar hydrolysis rates independent of the AHL acyl-chain length, contrary to GcL (Bergonzi et al., 2016 ▸) and PLLs, which show a marked preference for long-chain AHLs (Hiblot, Gotthard, Elias et al., 2013 ▸). Solution of the structure of AaL is expected to shed light on the key structural determinants that account for its very unique broad substrate preference.

The lactonase AaL was therefore crystallized and diffraction data were collected to 1.65 Å resolution. The data were indexed, integrated and scaled using the XDS software package (Kabsch, 1993 ▸). The crystals belonged to space group C2, with unit-cell parameters a = 111.72, b = 114.74, c = 79.97 Å, α = γ = 90.0, β = 109.8°. With the molecular weight of AaL being 32.5 kDa, calculation of the Matthews coefficient suggested the presence of three monomers in the asymmetric unit (V M of 2.47 Å3 Da−1 and 50.31% solvent content) as the most likely solution. Molecular replacement was performed using MOLREP (Vagin & Teplyakov, 2010 ▸) with the structure of AiiB as a starting model (PDB entry 2r2d; Liu et al., 2007 ▸). After the initial molecular replacement, three molecules were placed in the asymmetric unit (R = 34.30%, R free = 37.24%). Cycles of manual building and structure refinement using REFMAC (Murshudov et al., 2011 ▸) allowed the model to be improved (R = 17.5%, R free = 20.67%). The structure is still being improved by manual building using Coot (Emsley & Cowtan, 2004 ▸). Inspection of the electron-density maps suggests that apart from minor rotamers and solvent molecules the model is almost final, containing three molecules of AaL. Interpretation of the structure is currently in progress and will be published elsewhere.

Acknowledgments

We are grateful to the Nano Crystallization Facility and the Kahlert Structural Biology Laboratory, and in particular to Carrie Wilmot and Ke Shi for assistance in setting up crystallization screens and to Ed Hoeffner for assistance in using the in-house X-ray diffraction setup.

References

  1. Afriat, L., Roodveldt, C., Manco, G. & Tawfik, D. S. (2006). Biochemistry, 45, 13677–13686. [DOI] [PubMed]
  2. Augustine, N., Kumar, P. & Thomas, S. (2010). Arch. Microbiol. 192, 1019–1022. [DOI] [PubMed]
  3. Bar-Rogovsky, H., Hugenmatter, A. & Tawfik, D. S. (2013). J. Biol. Chem. 288, 23914–23927. [DOI] [PMC free article] [PubMed]
  4. Bassler, B. L. (1999). Curr. Opin. Microbiol. 2, 582–587. [DOI] [PubMed]
  5. Ben-David, M., Sussman, J. L., Maxwell, C. I., Szeler, K., Kamerlin, S. C. & Tawfik, D. S. (2015). J. Mol. Biol. 427, 1359–1374. [DOI] [PubMed]
  6. Ben-David, M., Wieczorek, G., Elias, M., Silman, I., Sussman, J. L. & Tawfik, D. S. (2013). J. Mol. Biol. 425, 1028–1038. [DOI] [PubMed]
  7. Bergonzi, C., Schwab, M. & Elias, M. (2016). Acta Cryst. F72, 681–686. [DOI] [PMC free article] [PubMed]
  8. Bokhove, M., Nadal Jimenez, P., Quax, W. J. & Dijkstra, B. W. (2010). Proc. Natl Acad. Sci. USA, 107, 686–691. [DOI] [PMC free article] [PubMed]
  9. Bzdrenga, J., Hiblot, J., Gotthard, G., Champion, C., Elias, M. & Chabriere, E. (2014). BMC Res. Notes, 7, 333. [DOI] [PMC free article] [PubMed]
  10. Del Vecchio, P., Elias, M., Merone, L., Graziano, G., Dupuy, J., Mandrich, L., Carullo, P., Fournier, B., Rochu, D., Rossi, M., Masson, P., Chabriere, E. & Manco, G. (2009). Extremophiles, 13, 461–470. [DOI] [PubMed]
  11. Dong, Y.-H., Xu, J.-L., Li, X.-Z. & Zhang, L.-H. (2000). Proc. Natl Acad. Sci. USA, 97, 3526–3531.
  12. Elias, M., Dupuy, J., Merone, L., Mandrich, L., Porzio, E., Moniot, S., Rochu, D., Lecomte, C., Rossi, M., Masson, P., Manco, G. & Chabriere, E. (2008). J. Mol. Biol. 379, 1017–1028. [DOI] [PubMed]
  13. Elias, M. & Tawfik, D. S. (2012). J. Biol. Chem. 287, 11–20. [DOI] [PMC free article] [PubMed]
  14. Emsley, P. & Cowtan, K. (2004). Acta Cryst. D60, 2126–2132. [DOI] [PubMed]
  15. Gotthard, G., Hiblot, J., Elias, M. & Chabrière, E. (2011). Acta Cryst. F67, 354–357. [DOI] [PMC free article] [PubMed]
  16. Hawe, A., Sutter, M. & Jiskoot, W. (2008). Pharm. Res. 25, 1487–1499. [DOI] [PMC free article] [PubMed]
  17. Hawwa, R., Larsen, S. D., Ratia, K. & Mesecar, A. D. (2009). J. Mol. Biol. 393, 36–57. [DOI] [PubMed]
  18. Hiblot, J., Bzdrenga, J., Champion, C., Chabriere, E. & Elias, M. (2015). Sci. Rep. 5, 8372. [DOI] [PMC free article] [PubMed]
  19. Hiblot, J., Gotthard, G., Chabriere, E. & Elias, M. (2012). PLoS One, 7, e47028. [DOI] [PMC free article] [PubMed]
  20. Hiblot, J., Gotthard, G., Champion, C., Chabriere, E. & Elias, M. (2013). Acta Cryst. F69, 1235–1238. [DOI] [PMC free article] [PubMed]
  21. Hiblot, J., Gotthard, G., Elias, M. & Chabriere, E. (2013). PLoS One, 8, e75272. [DOI] [PMC free article] [PubMed]
  22. Kabsch, W. (1993). J. Appl. Cryst. 26, 795–800.
  23. Khersonsky, O. & Tawfik, D. S. (2005). Biochemistry, 44, 6371–6382. [DOI] [PubMed]
  24. Lade, H., Paul, D. & Kweon, J. H. (2014). Biomed. Res. Int. 2014, 162584. [DOI] [PMC free article] [PubMed]
  25. LaSarre, B. & Federle, M. J. (2013). Microbiol. Mol. Biol. Rev. 77, 73–111. [DOI] [PMC free article] [PubMed]
  26. Liu, D., Lepore, B. W., Petsko, G. A., Thomas, P. W., Stone, E. M., Fast, W. & Ringe, D. (2005). Proc. Natl Acad. Sci. USA, 102, 11882–11887. [DOI] [PMC free article] [PubMed]
  27. Liu, D., Momb, J., Thomas, P. W., Moulin, A., Petsko, G. A., Fast, W. & Ringe, D. (2008). Biochemistry, 47, 7706–7714. [DOI] [PMC free article] [PubMed]
  28. Liu, D., Thomas, P. W., Momb, J., Hoang, Q. Q., Petsko, G. A., Ringe, D. & Fast, W. (2007). Biochemistry, 46, 11789–11799. [DOI] [PubMed]
  29. Miller, M. B. & Bassler, B. L. (2001). Annu. Rev. Microbiol. 55, 165–199. [DOI] [PubMed]
  30. Momb, J., Wang, C., Liu, D., Thomas, P. W., Petsko, G. A., Guo, H., Ringe, D. & Fast, W. (2008). Biochemistry, 47, 7715–7725. [DOI] [PMC free article] [PubMed]
  31. Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367. [DOI] [PMC free article] [PubMed]
  32. Schaefer, A. L., Greenberg, E., Oliver, C. M., Oda, Y., Huang, J. J., Bittan-Banin, G., Peres, C. M., Schmidt, S., Juhaszova, K., Sufrin, J. R. & Harwood, C. S. (2008). Nature (London), 454, 595–599. [DOI] [PubMed]
  33. Spinelli, A. C. N., Sant’Ana, A. S., Rodrigues-Junior, S. & Massaguer, P. R. (2009). Appl. Environ. Microbiol. 75, 7409–7416. [DOI] [PMC free article] [PubMed]
  34. Vagin, A. & Teplyakov, A. (2010). Acta Cryst. D66, 22–25. [DOI] [PubMed]
  35. Xiang, D. F., Kolb, P., Fedorov, A. A., Meier, M. M., Fedorov, L. V., Nguyen, T. T., Sterner, R., Almo, S. C., Shoichet, B. K. & Raushel, F. M. (2009). Biochemistry, 48, 2237–2247. [DOI] [PMC free article] [PubMed]

Articles from Acta Crystallographica. Section F, Structural Biology Communications are provided here courtesy of International Union of Crystallography

RESOURCES