Abstract
Spider venoms are rich sources of peptidic ion channel modulators with important therapeutical potential. We screened a panel of 60 spider venoms to find modulators of ion channels involved in pain transmission. We isolated, synthesized and pharmacologically characterized Cd1a, a novel peptide from the venom of the spider Ceratogyrus darlingi. Cd1a reversibly paralysed sheep blowflies (PD50 of 1318 pmol/g) and inhibited human Cav2.2 (IC50 2.6 μM) but not Cav1.3 or Cav3.1 (IC50 > 30 μM) in fluorimetric assays. In patch-clamp electrophysiological assays Cd1a inhibited rat Cav2.2 with similar potency (IC50 3 μM) without influencing the voltage dependence of Cav2.2 activation gating, suggesting that Cd1a doesn’t act on Cav2.2 as a classical gating modifier toxin. The Cd1a binding site on Cav2.2 did not overlap with that of the pore blocker ω-conotoxin GVIA, but its activity at Cav2.2-mutant indicated that Cd1a shares some molecular determinants with GVIA and MVIIA, localized near the pore region. Cd1a also inhibited human Nav1.1–1.2 and Nav1.7–1.8 (IC50 0.1–6.9 μM) but not Nav1.3–1.6 (IC50 > 30 μM) in fluorimetric assays. In patch-clamp assays, Cd1a strongly inhibited human Nav1.7 (IC50 16 nM) and produced a 29 mV depolarising shift in Nav1.7 voltage dependence of activation. Cd1a (400 pmol) fully reversed Nav1.7-evoked pain behaviours in mice without producing side effects. In conclusion, Cd1a inhibited two anti-nociceptive targets, appearing to interfere with Cav2.2 inactivation gating, associated with the Cav2.2 α-subunit pore, while altering the activation gating of Nav1.7. Cd1a was inactive at some of the Nav and Cav channels expressed in skeletal and cardiac muscles and nodes of Ranvier, apparently contributing to the lack of side effects at efficacious doses, and suggesting potential as a lead for development of peripheral pain treatments.
Introduction
Voltage-gated ion channels, including calcium (Cav) and sodium (Nav) channels, are membrane proteins involved in the generation of electrical signals underlying the propagation of action potentials in excitable cells. Cav and Nav are structurally similar, consisting of a pore-forming α subunit and 1–3 auxiliary subunits, including a number of Nav β isoforms and Cav β, α2δ, and γ auxiliary subunits [1, 2]. The Cav and Nav α-subunits are large transmembrane proteins (~200–260 kDa) organized into four homologous domains (DI—IV). Each domain comprises six transmembrane α helices segments (S1–S6), with the pore-forming P loop located between the S5 and S6 segments [3]. Each voltage sensor domain spans from S1–S4, with the positively charged residues in S4 serving as gating charges [4]. Nine Nav α subunits (Nav1.1–Nav1.9) and ten Cav α subunits (Cav1.1–1.4, Cav2.1–2.3 and Cav3.1–3.3) have been functionally characterized and can be differentiated by their primary structure, current kinetics and relative sensitivity to neurotoxins and small molecules [4].
Animal venoms have been pivotal tools in determining Cav and Nav structure and physiological function [4,5], providing peptides that either occlude the pore of the channel or influence its gating. Moreover, physiological and pharmacological studies have demonstrated that Cav channels, including Cav2.2 and a number of Nav channels, including Nav1.7, are involved in nociceptive signalling, playing a critical role in the development of chronic pain associated with tissue and nerve injury [6,7, 8]. Importantly, a number of neuropeptides have shown therapeutic potential due to ion channel activity [9], including ω-conotoxin MVIIA isolated from the venom of the cone snail Conus magus, which potently and selectively blocks Cav2.2 in pain fibres [6,10]. MVIIA is currently marketed as Prialt for the treatment of severe chronic neuropathic, cancer and HIV/AIDS pain [11, 12], validating Cav2.2 as an important analgesic target. Loss-of-function mutations in the human gene SCN9A encoding the Nav1.7 α subunit result in a congenital inability to experience pain [13,14], while gain-of-function mutations in SCN9A lead to inherited erythromelalgia [15] and paroxysmal extreme pain disorder [16]. Thus, Nav1.7 has become an important analgesic target, and numerous spider-venom peptides have been reported that modulate the activity of this channel [17].
Spider venoms are rich sources of peptidic Cav and Nav channel modulators [18, 19, 20]. In the search for novel analgesic peptides, we used Ca2+-based fluorescence assays to guide the isolation of a peptide termed Cd1a, from the venom of the African rear-horned baboon tarantula Ceratogyrus darlingi. Functional characterization of Cd1a revealed moderate insecticidal effects against sheep blowflies, modest activity at Cav2.2 channels and potent activity at Nav1.7, as well as the Cd1a mode of action on both channels. Cd1a reversed spontaneous pain behaviours induced in mice by activation of Nav1.7, demonstrating its analgesic potential.
Materials and methods
Spider venom screening and assay-guided isolation of Cd1a
Spider venoms were collected from adult specimens of the family Theraphosidae, Hexathelidae, Desidae, Araneidae, Sparassidae, Pisauridae, Nephilidae and Ctenidae (see supporting information: S1 Table) using electrical stimulation (12 V) applied to the basal part of the chelicerae. The crude lyophilized venoms were dissolved in distilled water, centrifuged (20,000 × g for 5 min) to remove particulates, then the supernatant was stored at −20°C until use.
The lyophilized venoms were diluted in phosphate salt solution (PSS) containing (in mM): NaCl 140, glucose 11.5, KCl 5.9, MgCl2 1.4, NaH2PO4 1.2, NaHCO3 5, CaCl2 1.8, 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid; HEPES 10), plus 0.1% BSA and nifedipine (10 μM) to fully inhibit endogenous Cav1 channels. The crude venoms (at 40 μg/well) were tested for activity against human (h) Cav2.2 channels in SH-SY5Y cells using a FLIPRTETRA (Fluorimetric Imaging Plate Reader, Molecular Devices, California, USA) Ca2+ imaging assay, as detailed below [21]. Venoms were re-tested at 4 μg/mL to identify the most active venoms. C. darlingi venom produced complete block of Cav2.2-mediated Ca2+ responses at both 4 and 40 μg/well and it was selected for further fractionation to isolate the active peptide.
C. darlingi venom (0.5 mg) was diluted in 100 μL of solvent A (99.9% trifluoroacetic acid (TFA)/0.1% H2O) and fractionated on a reversed-phase high-performance liquid chromatography (RP-HPLC) analytical column (Vydac C18, 250 × 4.6 mm, 5 μm, Grace DDS, IL, USA). Elution was performed with solvent A mixed with a linear gradient of solvent B (90% acetonitrile (ACN)/0.1% TFA in H20) at 5% for 5 min, 5–20% over 5 min, 20–40% over 40 min, and 80% from 50–60 min. Fractions were collected and ~10% of each fraction lyophilized, re-suspended in assay buffer, plated and tested for activity using the FLIPR assay.
Automated protein sequencing was performed by the Australian Proteome Research Facility (Sydney, NSW, Australia), using an Applied Biosystems 494 Procise Protein Sequencing System. Briefly, the purified peptide (Cd1a) was dissolved in 25 mM ammonium bicarbonate, pH 8.0 and reduced with DTT at 56°C for 0.5 h, then alkylated using iodoacetamide at room temperature for 0.5 h. The reduced/alkylated Cd1a was then purified using RP-HPLC (using a Zorbax 300SB-C18 column 3 × 150 mm). A single major peak eluting at 18.3 min was collected, evaporated to 50 μL and loaded onto a Precycled Bioprene-treated disc for Edman sequencing.
Chemical synthesis
Chemical synthesis of Cd1a was performed using solid phase peptide synthesis (SPPS). Briefly, Cd1a was assembled using standard in situ neutralization Boc-SPPS [22] on a 1,4-bis(ethenyl)benzene;(4-methylphenyl)-phenylmethanamine;styrene;hydrochloride (MBHA; Novabiochem, Merck Millipore, Kilsyth, Vic, Australia) resin, employing [benzotriazol-1-yloxy(dimethylamino)methylidene]-dimethylazanium;N-ethyl-N-propan-2-ylpropan-2amine; hexafluorophosphate (HBTU DIEA; Sigma-Aldrich/Auspep P/L Melbourne, Australia) activation. The following side chain protected Boc-L-amino acids were used: Arg(Tos), Asn(Xan), Asp(Chxl), Cys(4-MeBzl), Gln(Xan), Tyr(2-BrZ), Thr(Bzl), Trp(For), Ser(Bzl), Lys(2-ClZ) (Novabiochem, Merck Millipore). The resin was cleaved with hydrogen fluoride (BOC Gases, Sydney, NSW, Australia) for 1 h at 0°C employing p-cresol/p-thio-cresol scavenger (5% each, Sigma Aldrich). Crude peptide was precipitated from ether, filtered and lyophilized from ACN/H2O (Sigma Aldrich). After HPLC fractionation (Column: Vydac C18, 250 × 21 mm; gradient: 5–60% ACN over 60 min), pure reduced peptide (20 mg) at a concentration of 0.2 mg/mL was oxidized overnight at pH 7.8 in a solution of 0.3 M NH4OAc/0.3 M guanidine-HCl, in the presence of reduced (GSH) and oxidized (GSSG) glutathione (GSH/GSSG; 100:10 mol. eq.). The most prominent isomer was obtained after RP-HPLC isolation (Column: Vydac C18, 250 × 10 mm; gradient: 5–60% ACN over 60 min) in quantities of 1–2 mg. The purity and identity of this product was confirmed by co-elution with a native sample of Cd1a using liquid chromatography-mass spectrometry (LC-MS).
Cell culture and fluorimetric assays
SH-SY5Y cells were maintained in Roswell Park Memorial Institute (RPMI) medium supplemented with 10% foetal bovine serum (FBS) and 2 mM L-glutamine at 37°C in a 5% humidified CO2 incubator. HEK293 cells stably expressing hNav1.1–1.8 channels α-subunits co-expressed with the Nav β1 subunit (Scottish Biomedical, Glasgow, UK; except Nav1.6, which was generated by GlaxoSmithKline, Stevenage, UK) were maintained at 37°C in a 5% humidified CO2 incubator in Dulbecco's Modified Eagle Medium (DMEM; Invitrogen, MA, USA) supplemented with 10% FBS, 2 mM L-glutamine, and kept under selection antibiotics as per manufacturer’s protocol. Cells were plated 48 h prior to assay at a density of 30,000–50,000 cells/well on 384-well black-walled imaging plates (Corning, NY, USA). All the cells were used up to maximum 20 passages.
The FLIPR assays were performed based on previously described protocols [17, 21, 23]. For the FLIPR calcium-based assays, SH-SY5Y cells were pre-incubated for 30 min (37°C in a humidified 5% CO2 incubator) with a Calcium 4 fluorescence dye (Molecular Devices) diluted in PSS buffer + 0.1% BSA and nifedipine (10 μM) when testing for hCav2.2 activity. Conversely, to test for Cav1 activity, cells were pre-incubated with ω-conotoxin CVID (1 μM) for 30 min. After the incubation period the plates were transferred to the FLIPR and camera gain and intensity adjusted for each plate to yield 800–1000 arbitrary fluorescence units (AFU) baseline fluorescence. Ca2+ responses were measured using a cooled CCD camera with excitation at 470–495 nM and emission at 515–575 nM. Ten baseline fluorescence readings were taken prior to addition of crude venoms, venom fractions or purified peptides diluted in PSS + 0.1% BSA, then fluorescence readings were taken every second for 300 s. After 300 s, activators were added to the cells and fluorescence readings recorded each second for a further 300 s. Endogenous hCav channels were activated with 90 mM KCl/5 mM CaCl2.
The FLIPR membrane potential assays for sodium channels were performed using HEK293 cells expressing hNav1.1–1.8. The cells were loaded with Membrane Potential Assay Kit Red (Molecular Devices) reconstituted in PSS + 0.1% BSA and incubated at 37°C for 30 min before transfer to the FLIPR. After ten baseline fluorescence readings, changes in fluorescence (excitation 510–545 nm; emission 565–625 nm) in response to addition of antagonists (crude venoms or peptides) were measured every second for 300 s. After 300 s, activators (Nav1.8: deltamethrin at 100 μM, Sigma-Aldrich; Nav1.6: veratridine at 20 μM, Abcam, Melbourne, VIC, Australia; and all other Nav isoforms: veratridine 70 μM) were then added and the responses monitored for a further 300 s, except for Nav1.8 cells, where responses were measured for 1800 s.
A four-parameter Hill equation was used to fit concentration-response curves by nonlinear regression analysis (GraphPad Prism v5.0, San Diego, CA, USA). Results are presented as the mean ± standard error of the mean (SEM) of 3–6 replicates on 384-well plates for each independent experiment, performed 3–6 times. Statistical significance was determined using analysis of variance (ANOVA) or a Student’s t-test.
[125I]-GVIA binding assay
SH-SY5Y cell membranes were prepared using an adaptation of the method of Wagner et al [24]. The cells were harvested using trypsin/ethylenediaminetetraacetic acid (EDTA; Lonza, Basel, Switzerland), washed once with Dulbecco's phosphate-buffered saline (DPBS; Sigma-Aldrich) and centrifuged for 4 min at 500 × g. After centrifugation, the supernatant was discarded, then the pellet was re-suspended in 10 mL binding assay buffer (20 mM HEPES, 75 mM NaCl, 0.2 mM EDTA and 0.2 mM 2-[2-[2-[2-[bis(carboxymethyl)amino]ethoxy]ethoxy]ethyl-(carboxymethyl)amino]acetic acid; EGTA, adjusted to pH 7.2) containing complete protease inhibitor (Roche Diagnostics, NSW, Australia) and sonicated. The homogenate was then centrifuged at 4°C for 30 min at 40,000 × g, the supernatant discarded, and the pellet dissolved in binding assay buffer containing 10% glycerol, before storage at –80°C prior to use. A bicinchoninic acid (BCA) assay kit (Thermo Scientific, Waltham, MA, USA) was used for protein quantification as per manufacturer’s instructions.
Radiolabelled conotoxin GVIA ([125I]-GVIA; iodinated at Tyr22) was prepared using IODOGEN as previously described [25], or purchased (Perkin Elmer, USA), and stored at 4°C for use within 20 days. On the day of the assay, the membranes were thawed on ice and reconstituted to 10 μg/50 μL (mouse) or 10–20 μg/50 μL (SH-SY5Y) in binding assay buffer containing 2% complete protease inhibitor and 0.1% BSA. Stock [125I]-GVIA was diluted to 20,000 cpm/50 μL ([30 pM]). For displacement studies, [125I]-GVIA was incubated with mouse brain membranes or SH-SY5Y membranes and varying concentrations of the competing ligand on 96-well plates. The plates were incubated with shaking for 1 h at room temperature and vacuum filtered through a glass-fibre filter pre-soaked in 0.6% polyethyleneimine (PEI) to reduce non-specific binding and washed with buffer containing 20 mM HEPES and 125 mM NaCl at pH 7.2 using a Tomtec harvester vacuum system (CT, USA). The filters were then dried at 37°C before being placed in sample bags and soaked in liquid scintillant. Retained radioactivity was then counted using a MicroBeta JET microplate liquid scintillation counter (Wallac, Finland). Non-specific binding was determined in the presence of 50 μL of unlabelled peptides. Specific binding was calculated as the difference between total and non-specific binding. A one-site model was fitted to the data using GraphPad Prism v5.0. Results are presented as the mean ± SEM of 3–6 replicates, performed at minimum 3 independent experiments. Statistical significance was determined using analysis of variance (ANOVA) or a Student’s t-test, with statistical significance defined as p < 0.05.
Electrophysiological properties of rCav2.2 channels
HEK tsA-201 cells used for the Cav2.2 patch-clamp experiments were cultured and transiently transfected with native rat (r) Cav2.2 (Cav α1b co-expressed with Cav β1b and Cav α2δ subunits) or mutant rCav2.2-G1326P, as previously described [26]. Transfected cells were incubated for 48 h at 37°C and 5% CO2, re-suspended with 0.25% (w/v) trypsin-EDTA (Invitrogen) and plated onto glass coverslips at least 3–4 h before the patch clamp experiments. Cav currents were measured by conventional whole-cell patch clamp using an Axopatch 200B amplifier in combination with Clampex 9.2 software (Molecular Devices), as previously described [27]. Cd1a was prepared daily in external solution containing 0.1% BSA and applied to the cells with a gravity-driven micro-perfusion system. The external recording solution for calcium channel recordings contained (in mM): 114 CsCl, 20 BaCl2, 1 MgCl2, 10 HEPES 10 glucose, adjusted to pH 7.4 with CsOH. For voltage-clamp recordings, 5 μM CdCl2 was also added to the external solution to inhibit Cav channels. For all recordings, the internal patch pipette solution contained (in mM): 108 CsMeSO4, 2 MgCl2, 11 EGTA, 10 HEPES, adjusted to pH 7.4 with CsOH supplemented with 0.6 mM GTP and 2 mM ATP immediately before use. After establishment of the whole-cell configuration, cellular capacitance was minimized using the analog compensation available on the amplifier. Series resistance was < 10 MΩ and compensated to > 85% in all the experiments. Data were filtered at 1 kHz (8-pole Bessel) and digitized at 10 kHz with a Digidata 1320 interface (Molecular Devices). For current-voltage (I-V) relationship studies, the membrane potential was held at –110 mV and cells were depolarized from –80 to 20 mV in 10-mV increments. For steady-state inactivation studies, the membrane potential was depolarized by test pulses to 0 mV for Cav2.2, after 3.6 s conditioning pre-pulses ranging from –110 to 0 mV. Individual sweeps were separated by 12 s.
Electrophysiological properties of hNav1.7 channels
For patch-clamp analysis, HEK293 cells stably expressing hNav1.7 (Navα co-expressed with the Nav β1 subunit; Scottish Biomedical) were cultured following the manufacturer's guidelines. The cells were removed from the culture at 70% confluence using Stempro Accutase (Life Technologies, Australia) and resuspended to 1×106 cells/mL in Ex-Cell ACF CHO Medium (Life Technologies, Australia) supplemented with 25 mM HEPES (Sigma-Aldrich, Australia) and 1 × Glutamax (Life Technologies, Australia) before being transferred to the QPatch QStirrer (Sophion Bioscience, Ballerup, Denmark) and allowed to recover for 30 min before use. The external solution for all Nav recordings contained (in mM): NaCl (140), KCl (4), CaCl2 (2), MgCl2 (1), HEPES (10), TEA-Cl (20) and glucose (10) containing 0.1% BSA. The pH was adjusted to 7.4 with NaOH and osmolarity adjusted to 315 mOsm with sucrose. The intracellular solution consisted of (in mM): CsF (140), EGTA/CsOH (1/5), HEPES (10) and NaCl (10) adjusted to pH 7.4 with CsOH and 320 mOsm with sucrose. The whole-cell patch-clamp experiments were performed at room temperature on a QPatch 16 automated electrophysiology platform (Sophion Bioscience) using 16-channel planar patch-chip plates (QPlates) with a patch hole diameter of 1 μm and resistance of 2 ± 0.02 MΩ. The cell positioning and sealing parameters were: positioning pressure –60 mbar, minimum seal resistance 0.1 GΩ, holding potential –100 mV and holding pressure –20 mbar. Whole-cell currents were filtered at 5 kHz (8-pole Bessel) and digitized at 25 kHz. A P4 online leak-subtraction protocol was used with non-leak-subtracted currents acquired in parallel.
The cells expressing hNav1.7 were maintained with a holding potential of –100 mV and I-V relationships determined using a family of 500 ms conditioning pulses from –120 mV to +70 mV in 5-mV steps, followed by depolarization to 0 mV to assess the voltage dependence of fast inactivation. Each sweep was separated by 20 s to allow complete recovery from inactivation. State-dependence was assessed after a 10 min compound incubation to ensure steady-state inhibition for each concentration. In order to assess compound activity at the partially inactivated/open state, a series of 10 × 50 ms depolarizations to 0 mV were measured after corresponding conditioning pulses to –55 mV for 8 s with a 50 ms recovery before the test pulse, and cycled over a 12 s period for recovery of inactivation. To assess possible interaction with the voltage sensor domain, a triple-pulse protocol was used, comprising two steps to 0 mV for 50 ms separated by a strong depolarization depolarisation step to 200 mV for 50 ms, with 20 ms recovery to the –100 mV holding potential between each step.
Electrophysiology data analysis
The Cav channel electrophysiology data were analyzed using Clampfit 9.2 (Molecular Devices). Curves were fitted using Origin 7.5 software (Northampton, MA, USA). Electrophysiology data for Nav channels were assessed using the Sophion QPatch Assay Software v5.0, with curves fitted using GraphPad Prism v5.0. I-V relationships were fitted with using a modified Boltzmann equation: I = [Gmax*(Vm–Erev)]/[1+exp(Va–Vm)/ka)], where Vm is the test potential, Va is the half-activation potential, Erev is the reversal potential, Gmax is the maximum slope conductance, and ka reflects the slope of the activation curve. The voltage dependence of steady-state inactivation was calculated by dividing the amplitude of the test current (I) by the maximal current elicited (Io). Steady-state inactivation curves were fitted using the Boltzmann equation: I/Io = 1/(1+exp((Vm–Vh)/k)), where Vh is the half-inactivation potential, k is the slope factor and Vm is the holding voltage. Statistical significance was determined by paired or unpaired Student’s t-tests and one-way or repeated measures ANOVA for n ≥ 6 independent experiments, followed by Dunnett’s post-hoc test. Differences were considered significant if p < 0.05. Data are expressed as mean ± SEM.
Animal behaviour assessment
All the experiments involving animals were conducted according to the International Association for the Study of Pain Guidelines for the Use of Animals in Research (http://www.iasp-pain.org), in agreement with the Animal Care and Protection Regulation Qld (2012), and the Australian Code of Practice for the Care and Use of Animals for Scientific Purposes, 8th edition (2013) (http://www.nhmrc.gov.au). Ethics approval was obtained from the University of Queensland Institutional Animal Ethics Committee. C57BL/6J, an inbred mouse strain widely used in biomedical research [28], was used in all animal tests. Prior to experimentation, adult C57BL/6J male mice (5–8 weeks of age, average weight 20–25 g) were housed in groups of 2–4 under 12 h light-dark cycle, with free access to standard rodent chow and water. After experiments animals were euthanized by CO2 asphyxiation. All efforts were made to reduce the number and minimize the suffering of animals.
To test the analgesic potential of Cd1a, while avoiding potential off-target related side effects produced by systemic administration, we used a mouse model of Nav1.7-mediated pain, as previously described [29], based on intraplantar injection of the α/β scorpion toxin OD1 [30]. Briefly, a concentration of OD1 found to induce pain-like behaviour in mice (300 nM/40 μL diluted in sterile saline/0.1% BSA) [29] was injected subcutaneously into the subplantar surface of the left hind paw of mice (intraplantar, i.pl.) under light isoflurane anaesthesia (3%). Control animals received OD1 (300 nM) and treated animals received Cd1a (0.1 nM–10 μM/40 μL), Cm1a, Cm1b or tetrodotoxin (TTX) (1 μM/40 μL co-injected with OD1). Immediately after injection, the mice were placed into polyvinyl boxes (10 × 10 × 10 cm) and, after recovery from isoflurane, animals were monitored with a video camera placed under the boxes. Spontaneous pain behaviour (paw flinches, shakes and licks) and side-effects were visually assessed over 10–30 min by an observer blinded to all groups. Motor performance was assessed using the Parallel Rod Floor Test, with each peptide administered i.pl. 5 min before the testing. Distance travelled (m) and number of foot slips were recorded using ANY-Maze software (Stoelting Co., version 4.70, Wood Dale, IL, USA). The ataxia index was calculated by dividing the number of foot slips by the distance travelled.
Data were fitted using GraphPad Prism v5.0 and are presented as mean ± SEM (n = 6–12 mice). Statistical significance was determined using analysis of variance (ANOVA) with a Dunnett’s post-test, with significance defined as p < 0.05.
Blowfly toxicity assay
To determine Cd1a activity in insects we used a previously reported method [31] with some modifications. Synthetic Cd1a was dissolved in insect saline and injected into the ventro-lateral thoracic region of adult sheep blowflies (Lucilia cuprina) with an average mass between 26.9 and 29.3 mg. A 1.0 mL Terumo Insulin syringe (BD Ultra-Fine, Terumo Medical Corporation, MD, USA) with a fixed 29 G needle fitted to an Arnold hand micro-applicator (Burkard Manufacturing Co. Ltd., England) was used to inject a maximum volume of 2 μL per fly. All flies were individually housed in 2-mL tubes and paralytic activity and lethality were determined at 1 h and 24 h post-injection. A total of three tests were carried out and for each test seven doses of Cd1a (n = 10 flies per dose) and the appropriate control (insect saline; n = 20 flies each) were used. PD50 values were calculated as described previously [31] using Prism 6.
Materials
TTX, Cm1a and Cm1b were purchased from Alomone Labs, Jerusalem, Israel. OD1 and CVID were synthesized as previously described [30, 32, 33]. All the other chemicals were purchased from Sigma-Aldrich Australia, unless otherwise indicated.
Results
Discovery, synthesis and biochemical analysis of Cd1a
To find novel Cav2.2 inhibitors, we screened 60 spider venoms using fluorimetric assays and SH-SY5Y cells expressing hCav2.2. Approximately 30% of the venoms tested inhibited ≥ 50% of the hCav2.2 responses (S1 Table), confirming spider venoms are rich sources of Cav2.2 inhibitors. Venom from the African spider C. darlingi (spider shown in Fig 1A) fully inhibited hCav2.2 (estimated 37 ng/μL). A search on ArachnoServer, a database listing spider venom toxins [20], indicated that there was no other Cav2.2 inhibitor discovered from C. darlingi venom and thus, we selected this venom for fractionation. A single fraction eluting as a sharp peak at ~30% solvent B and ~99% purity (based on the HPLC profile) inhibited hCav2.2 (Fig 1A). MALDI-TOF MS analysis indicated that the active fraction was dominated by a single mass (charged monoisotopic [M+H]+) of 4028.2 Da (Fig 1B). Edman sequencing revealed a 33-residue peptide sequence (DCLGWFKSCDPKNDKCCKNYSCSRRDRWCKYDL-NH2), with MALDI-TOF analysis indicating that the peptide was C-terminally amidated (~ –1 Da difference from the mass calculated for the free acid form of the Edman-derived sequence).
Cd1a was chemically synthesised using stepwise SPPS. A prominent disulfide bond isomer purified by HPLC to > 97% homogeneity had identical molecular mass to, and co-eluted with, native Cd1a (Fig 1B). Synthetic Cd1a inhibited Cav2.2, further confirming that the synthetic peptide was correctly folded.
Sequence homology studies
Surprisingly, BLAST searches on ArachnoServer database [20, 34] revealed that Cd1a was poorly similar to other Cav2.2 inhibitors. The most similar Cav inhibitor isolated from a spider venom was ω-TRTX-Hs1a (Huwentoxin-X) [35], which shares only 40% identity with Cd1a. Cd1a lacks most of the functional residues shown to be important for Cav2.2 block by ω-conotoxin CVID (Fig 1C), the most selective Cav2.2 inhibitor described to date [33].
Interestingly, Cd1a is orthologous to β-TRTX-Cm1a (97% identity) and β-TRTX-Cm1b (94% identity), two peptides known to be Nav channel inhibitors, isolated from the venom of the closely related tarantula spider C. marshalli (see Fig 1C) [36]. Cm1a and Cm1b belong to the NaSpTx Family 1 of spider toxins [19, 20]. Peptides from NaSpTx family 1 exhibit a conserved cysteine connectivity (C1–C4, C2–C5, C3–C6) and adopt an inhibitor cystine knot (ICK) fold [37, 38]. ICK frameworks have an antiparallel β-sheet stabilised by a cystine knot, formed by three disulfide bridges [36, 37].
Cd1a inhibited human Cav channels
We assessed Cd1a activity on native hCav1.3, hCav2.2 and hCav3.1 channels expressed in SH-SY5Y cells [21], and compared with Cm1a and Cm1b activity. Cd1a, Cm1a and Cm1b fully inhibited ω-conotoxin-sensitive hCav2.2 responses, in SH-SY5Y cells (IC50 values (μM): Cd1a 2.6 ± 0.93 μM; Cm1a 0.4 ± 0.2; and Cm1b 1.1 ± 0.6; Fig 2A). These results contrast with a previous report on patch clamp electrophysiology data, which indicated that Cm1a and Cm1b were inactive at HVA calcium currents of sensory neurons [36]. Cd1a, Cm1a and Cm1b were inactive on nifedipine-sensitive Cav1.3 and mibefradil/pimozide-sensitive Cav3.1 (Cd1a tested up to 30 μM and Cm1a and Cm1b 10 μM). Despite a tendency to some variability in potencies, the Cav2.2 activity of the three peptides were not statistically different (two-way Anova).
Cd1a binding on Cav2.2 did not completely overlap the GVIA binding site
We used radiolabeled GVIA (125I-GVIA) in competitive binding studies to investigate the Cd1a mode of action. ω-Conotoxin GVIA is known to bind to Cav2.2 channel α-subunit pore, in a region localized within the external EF hand motif of domain III S5–S6 (see S1 Fig) [26, 39]. Surprisingly, whereas unlabeled GVIA (used as a control) fully displaced radiolabeled 125I-GVIA from both human SH-SY5Y (IC50 of 0.18 ± 0.01 nM) and mouse brain cell membranes (IC50 of 0.27 ± 0.01 nM) (Fig 2B) with potencies similar to previous described [21, 24], Cd1a (10 μM) did not displace 125I-GVIA from these membranes, indicating that the Cd1a binding site does not overlap the GVIA binding site on Cav2.2 channels.
Cd1a did not act as a classical gating modifier toxin on Cav2.2 channels
The Cd1a effect was investigated on Ba2+ currents measured using whole-cell voltage-clamp electrophysiology on rCav2.2 (Cavα1B, Cavβ1b + Cavα2δ) expressed in tsA cells. Cd1a (3 μM) inhibited the currents by ~50% (n = 9) and there was no recovery from block during a 5 min wash-off period (Fig 3A). The reversal potential and half-activation voltage for Cd1a-treated cells (Erev = +51.2 mV, Va = –5.3 mV) were not significantly different from untreated cells (Erev = +52.4 mV, Va = –1.7 mV) (Fig 3B). In contrast, Cd1a produced a statistically significant hyperpolarizing shift in the half-inactivation potential of ~8 mV (Vh control = –46 mV; Vh Cd1a = –54.6 mV (Fig 3C). The absence of a measurable effect on the voltage dependence of activation under our conditions indicates. Cd1a has a unique mode of action at Cav2.2 channels, differing from that of classical gating modifier toxins, such as ω-grammotoxin SIA and ω-IVA [39].
Cd1a affected mutant rCav2.2-G1326P function
We tested the ability of Cd1a to inhibit rCav2.2 carrying a G1326P mutation (Cav2.2-G1326P), which lies on the large extracellular loop region of the Cav2.2 α subunit. This mutation results in localized structural disruption within the domain III S5–H5 region associated with the external EF hand motif within domain III S5–S6 [26, 40, 41] that alters ω-conotoxin GVIA and MVIIA affinity and reversibility [41], associating this location with the binding site for these toxins. Whereas wild-type rCav2.2 channels showed no recovery from Cd1a-evoked block, Cd1a inhibition of the mutant Cav2.2-G1326P channel was reversed following a 5 min washout (Fig 3A). In addition, Cd1a induced a significant shift in Erev of the mutant channel (control = 61.0 mV, Cd1a = 52.5 mV) in contrast to its lack of effect at the wild-type channel. The voltage dependence of activation of the mutant, like the native rCav2.2, was unaffected (Va control = 7.0 mV, Va Cd1a = 7.2 mV), whereas the voltage dependence of inactivation underwent a small but significant shift (Vh control = –28.9 mV; Vh Cd1a –38 mV (Fig 3D and 3E). The combined data suggest that, despite no overlap in binding sites demonstrated by the inability of Cd1a to displace GVIA in biochemical studies, there is some overlap in the molecular determinants of channel interactions between these two toxins. However, more extensive channel mutagenesis is required to fully define the Cd1a binding site.
Cd1a activity on 8 heterologously expressed hNav channels
Due to the high similarity between Cd1a and the Nav channel inhibitors Cm1a and Cm1b, we assessed the effect of Cd1a on hNav1.1–1.8 channels heterologously expressed in HEK293 cells using fluorimetric assays, and compared with the effects of Cm1a and Cm1b using the same assays. Overall, Cd1a activity was not statistically different to Cm1a and Cm1b (two-way Anova), with each peptide inhibiting Nav1.1, Nav1.2 and Nav1.7 (IC50 values in Fig 4A, Table 1). Cd1a (30 μM) and Cm1a (10 μM) (Fig 4B) were inactive at Nav1.3–Nav1.6 (Fig 4A–4C, Table 1), whereas Cm1b (Fig 4C) was also inactive at Nav1.4–Nav1.5 (up to 10 μM), but inhibited hNav1.3 and Nav1.6. Cd1a was the only peptide with activity at Nav1.8 (Fig 4A, Table 1) in our assays, in contrast with previous report on rat clones using patch clamp electrophysiology [36], where 2 μM Cm1a and Cm1b inhibited 55 and 40% of Nav1.8 current, respectively.
Table 1. Cd1a, Cm1a and Cm1b activity on Nav1.1–1.8 channels.
Nav subtype | Cd1a (IC50, μM)* |
Cm1a (IC50, μM) |
Cm1b (IC50, μM) |
---|---|---|---|
Nav1.1 | 2.18 ± 0.69 | 1.06 ± 0.32 | 0.17 ± 0.11 |
Nav1.2 | 0.13 ± 0.04 | 0.07 ± 0.22 | 0.08 ± 0.02 |
Nav1.3 | > 30 | > 10 | 5.57 ± 0.04 |
Nav1.4 | > 30 | > 10 | > 10 |
Nav1.5 | > 30 | > 10 | > 10 |
Nav1.6 | > 30 | > 10 | 3.99 ± 1.60 |
Nav1.7 | 3.34 ± 1.56 | 5.12 ± 2.85 | 0.23 ± 0.13 |
Nav1.8 | 6.92 ± 3.44 | > 10 | > 10 |
*Data are expressed as mean ± SEM.
The Cd1a mode of action on hNav1.7
We assessed the Cd1a effect on hNav1.7 channels stably expressed in HEK293 cells using planar patch-clamp electrophysiology. Cd1a inhibited the hNav1.7 peak current in a concentration-dependent manner, with an IC50 in the low nanomolar range (16.0 ± 3.0 nM, n = 10; Fig 5A). An I-V family of conditioning pulses and their corresponding G-V curves were used to determine the effect of Cd1a on the voltage dependence of activation (Va), while depolarization to 0 mV following a conditioning pulse was used to assess its effects on the steady-state inactivation (Vh) (Fig 5B). Interestingly, Cd1a (100 nM) induced a significant 29 mV depolarizing shift in Va (control –20.4 ± 0.3 mV; Cd1a 8.6 ± 1.0 mV, n = 11) (Fig 5C). Furthermore, at 100 nM Cd1a induced a small 3.8 mV hyperpolarizing shift of the voltage dependence of inactivation (Vh) of hNav1.7 (control –58.9 ± 0.4 mV; Cd1a –62.7 ± 0.5 mV, n = 9) (Fig 5D).
We used a triple pulse protocol previously described [36, 42] to identify if Cd1a interacted with the Nav1.7 voltage sensor domains. Under control conditions there was no significant change between a first (P1) and third (P3) pulses separated by a strong positive pulse (P2) (Insert Fig 5E). Cd1a at 1 μM fully inhibited P1 as expected, however, the P3 current was not fully inhibited, indicating partial relief of block by P2. This suggests that Cd1a interacts with one or more voltage sensor domain of hNav1.7 channels.
Cd1a is analgesic in a Nav1.7 mouse model of peripheral pain
Intraplantar injection of the scorpion toxin OD1 evokes spontaneous pain behaviours (paw licks, shakes and flinches) in mice (Fig 6A), an effect mostly mediated by Nav1.7 channels [29]. Intraplantar injections of Cd1a (400 pmol) completely reversed OD1-evoked spontaneous pain behaviours for at least 30 min (Fig 6A). The Cd1a effect was concentration dependent (IC50 = 0.36 ± 0.12 pmol) (Fig 6B). For comparison, we tested Cm1a, Cm1b and TTX in the same mouse model. At a dose that all peptides with activity at NaV1.7 reversed spontaneous pain behaviours (40 pmol), TTX caused sedation, and reduced motor coordination (Fig 6C and 6D) in all mice, whereas Cd1a, Cm1a and Cm1b did not produce any apparent side effects.
Cd1a reversibly paralysed sheep blowfly
Cd1a produced paralytic effects in adult sheep blowfly, with a PD50 measured 1 hour after injection of 1318 ± 58 pmol/g (Fig 7). Remarkably, however, all flies fully recovered from the initial paralytic effects induced by Cd1a at doses up to 8.17 nmol/g.
Discussion
We describe the discovery and characterization of Cd1a, the first Nav/Cav inhibitor peptide reported from the African theraphosid spider C. darlingi. Cd1a belongs to NaSpTx family 1 [19], a class of promiscuous toxins that can modulate a range of ion channels, including Nav, Cav, Kv, mechanosensitive and proton-gated ion channels. Peptides from NaSpTx family 1 share an ICK structural motif that typically provides resistance to heat denaturation and proteolysis [37, 44], features that are potentially advantageous for drug development. Interestingly, Cd1a inhibits important peripheral nociceptive targets, including Nav1.7, Nav1.8 and Cav2.2, but not cardiac Cav and Nav channels (Cav1.3, Cav3.1 and Nav1.5), or Nav channels found in skeletal muscle (Nav1.4) or nodes of Ranvier in motor nerves (Nav1.6). The Cd1a selectivity profile is consistent with its analgesic efficacy and lack of side effects at maximal efficacious doses in a mouse model of peripheral pain shown in this work.
Cd1a has little sequence similarity to other venom peptides that inhibit Cav channels, likely reflecting its relatively low potency against Cav2.2 (IC50 of ~3 μM at rat and human Cav2.2). Like Cd1a, the related peptides Cm1a and Cm1b from C. marshalli [36] are known Nav inhibitors and have little sequence similarity to Cav inhibitors. However we found for the first time that these peptides inhibit hCav2.2 with moderate potency, but were inactive at hCav1.3 and hCav3.1. Our results contrasted with a previous report on patch clamp electrophysiology, which indicated that Cm1a and Cm1b were inactive at HVA calcium currents of sensory neurons [36]. However Cm1a and Cm1b were tested at a maximum concentration of 100 nM [36], thus at a higher concentration it’s conceivable that these peptides would also be active in their system. Unlike classical Cav channel gating modifier toxins, Cd1a didn’t affect activation gating of rCav2.2 but instead induced a small shift in the voltage-dependence of inactivation, suggesting that at this channel Cd1a doesn’t act as a typical gating modifier toxin. Cd1a activity was enhanced at the rCav2.2α1B-G1326P mutant channel while channel inhibition became partially reversible, indicating possible partial overlap with the binding site for ω-conotoxins. In addition, Cd1a caused a small change in reversal potential of the mutant channel but not the wild-type, while channel inhibition became partially reversible, indicating binding near the ion permeation/selectivity pathway. However, competitive binding studies revealed that the Cd1a binding does not completely overlap with the GVIA binding site on mutant Cav2.2. Thus, we suggest a possible allosteric coupling between the Cd1a and GVIA binding site that is introduced by the rCav2.2α1B-G1326P mutation. Residues in the outer vestibule of the channel pore may allosterically affect Cd1a binding and its ability to interact with the inactivated state of the channel. Precisely how Cd1a influences the voltage dependence of inactivation remains to be determined, but it is possible that the toxin interacts with one or more of the S6 regions, which have been linked to fast inactivation [45].
The high level of homology between Cd1a and the Nav inhibitor peptides Cm1a and Cm1b suggested that Nav channels may be the primary high-affinity target for Cd1a. Indeed, in electrophysiological studies Cd1a was ~200-fold more potent at recombinant hNav1.7 than rCav2.2, inhibiting hNav1.7 with an IC50 of ~15 nM. Whereas we have previously shown that species differences can lead to discrepancies in potencies [21], the IC50 for Cd1a at human and rat Cav2.2 were similar in both in patch clamp and fluorescence assays (~3 μM), confirming the primary target for Cd1a is Nav1.7.
Using a FLIPR membrane potential dye assay, we identified that Cd1a, Cm1a and Cm1b were similarly active across a range of hNav channels, including Nav1.1–1.2 and Nav1.7. However, Cd1a potency at Nav1.7 was lower using the FLIPR assays than when using patch clamp electrophysiology (~200-fold), consistent with previous reports [46]. In addition we could not detect Nav1.8 activity for Cm1a and Cm1b, in contrast with previous report [36]. Although an explanation for these differences remains to be elucidated, a number of factors may affect between-assay peptide potency. These include different expression systems and β subunit combinations, species differences, influence of membrane potential dye, and the requirement for channel activation by veratridine in fluorescence assays. Nonetheless, fluorescence-based assays allow high-throughput screening and rapid assessment of pharmacology. While the rank order of potency across Nav isoforms is typically conserved, differences in potencies between patch clamp electrophysiology (‘the gold standard method for assessing ion-channel function’) and fluorescence based assays have been described [46, 47, 48].
Although Cd1a didn’t affect the steady-state voltage parameters of activation of rat Cav2.2, the human Nav1.7 inhibition was driven by a depolarising shift in Va. This effect on Nav1.7 is consistent with gating modifying activity through one or more of the voltage sensor domains (VSD) [36, 39, 42]. A forced outward movement of one or more Nav voltage sensor domains has been achieved with strong positive depolarizing pulses, releasing gating modifier toxins from the voltage sensor domains [36, 42] and leading to recovery from toxin inhibition. In support, the strong positive-depolarising pulse we used in our patch clamp experiments enhanced recovery from Cd1a inhibition by ~70% and inhibition of inward but not outward current were observed, similar to other gating modifier toxins [36, 42].
Due to its pharmacology profiling and mode of action, with the highest activity at Nav channels, Cd1a was named β-theraphotoxin-Cd1a (or β-TRTX-Cd1a as abbreviation), based on the rational nomenclature devised for spider toxins [49]. While the exact site of Cd1a interaction with Nav channels remains to be elucidated, spider-venom peptides with similar modes of action have been found to bind to VSDs DI—DIII but not to DIV, which appears to influence inactivation rather than activation [50–52].
We assessed the analgesic potential of Cd1a by examining its ability to reverse spontaneous pain induced by intraplantar injection of the Nav1.7 channel activator OD1 [29, 30, 43]. Remarkably, Cd1a was able to completely reverse the OD1-induced nociceptive behaviour in mice, with no apparent off-target related side effects at the highest dose tested and no motor side effects. These results contrasted with TTX, which also fully reversed the OD1-induced pain behaviour at the same dose, but caused sedation and motor incoordination, suggesting off-target neuronal and/or skeletal muscle effects associated with its inhibition of Nav1.1–1.4 and/or Nav1.6 [53]. Consistent with the lack of side effects seen for Cd1a in mice, Cd1a was inactive on cardiac and peripherally expressed Cav1.3, Cav2.1 Nav1.4, Nav1.5 and Nav1.6 (30 μM). Cd1a was potent at centrally expressed Nav1.1–1.2, however, it is unlikely to cross the blood-brain barrier and interact with these channels centrally [9].
In future, Cd1a needs to be tested in other more conventional animal models of pain, such as the inflammation and neuropathic pain models, to confirm its usefulness as a peripheral analgesic lead, and to provide information tools to compare Cd1a with peptides from other animal venoms.
Whereas the analgesic effect of Cd1a might be useful as a therapeutic lead, we wondered about the ecological significance of Cd1a. Pain-inducing venom components for defensive purposes have been previously reported from tarantula venoms [31], but the analgesic activity of Cd1a does neither endow the spiders with an evolutionary advantage nor support a potential defensive purpose. Hence, we assumed that it might be used for predation and with insects and other invertebrates being the main prey of tarantulas [54] we tested Cd1a in a blowfly toxicity assay. The fact that Cd1a induced paralysis in blowflies supports a potential role for Cd1a in predation.
In summary, we have isolated and pharmacologically characterized Cd1a, a novel peptide inhibitor that showed insecticidal effects and acts on the anti-nociceptive targets Cav2.2, Nav1.7 and Nav1.8. Cd1a additionally inhibits the central Nav1.1–1.2, but not peripheral off-target channels such as Cav1.3 and Cav2.1 or Nav1.4–1.6. Interestingly, Cd1a acts at Cav2.2 and Nav1.7 with distinct modes of action, inhibiting Cav2.2 activity affecting near the pore region, but not overlapping the ω-conotoxin binding site, interfering with inactivation with no apparent effects on the activation gating of the channel. Conversely, at Nav1.7 Cd1a acts as a typical gating modifier toxin, interacting with one or more of the voltage sensor domains and changing the gating properties of this channel. The primary structure of Cd1a strongly suggests that it will fold into an ICK motif that is expected to provide a high level of chemical, thermal and biological stability. Thus, Cd1a may be a useful lead for development of a peripherally acting analgesic. In future studies it will be important to examine Cd1a analgesic potential in a wider range of pain models to confirm its usefulness as an analgesic lead.
Supporting information
Acknowledgments
This research was facilitated by access to the Australian Proteome Analysis Facility (APAF), supported under the Australian Government’s National Collaborative Research Infrastructure Strategy (NCRIS). We acknowledge help from Craig Alexander Rathwell with assessment of animal behaviour. We thank members of the Deutsche Arachnologische Gesellschaft (DeArGe), particularly Ingo Wendt and Henrik Krehenwinkel, for providing spiders for milking and Geoff Brown (Department of Agriculture, Fisheries and Forestry, Brisbane) for the supply of blowflies.
Data Availability
All relevant data are within the paper and its Supporting Information files.
Funding Statement
We acknowledge financial support from the Australian National Health and Medical Council (NHMRC Program Grant APP1072113 to RJL, PFA and GFK). SRS was supported by a University of Queensland International Research Tuition Award (UQIRS) PhD Scholarship. RJL, PFA and GFK were supported by NHMRC Principal Research Fellowships; IV was supported by an Australian Research Council Future Fellowship; GWZ was supported by grants from the Canadian Institutes of Health Research and holds a Canada Research Chair. CB was supported by a Studentship from Alberta Innovates Health Solutions. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. The authors received no financial support for the research, authorship, and/or publication of this article.
References
- 1.Wu J, Yan Z, Li Z, Yan C, Lu S, Dong M, et al. Structure of the voltage-gated calcium channel Cav1.1 complex. Science. 2015; 350: aad2395 doi: 10.1126/science.aad2395 [DOI] [PubMed] [Google Scholar]
- 2.Catterall WA. Structure and regulation of voltage-gated Ca2+ channels. Annu Rev Cell Dev Biol. 2000; 16: 521–55. doi: 10.1146/annurev.cellbio.16.1.521 [DOI] [PubMed] [Google Scholar]
- 3.Catterall WA. From ionic currents to molecular mechanisms: The structure and function of voltage-gated sodium channels. Neuron. 2000; 26: 13–25. [DOI] [PubMed] [Google Scholar]
- 4.Catterall WA, Cestele S, Yarov-Yarovoy V, Yu FH, Konoki K and Scheuer T. Voltage-gated ion channels and gating modifier toxins. Toxicon. 2007; 49: 124–41. doi: 10.1016/j.toxicon.2006.09.022 [DOI] [PubMed] [Google Scholar]
- 5.Kalia J, Milescu M, Salvatierra J, Wagner J, Klint JK, King GF, et al. From foe to friend: using animal toxins to investigate ion channel function. J Mol Biol. 2015; 427: 158–75. doi: 10.1016/j.jmb.2014.07.027 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Zamponi GW, Lewis RJ, Todorovic SM, Arneric SP and Snutch TP. Role of voltage-gated calcium channels in ascending pain pathways. Brain Res Rev. 2009; 60: 84–9. doi: 10.1016/j.brainresrev.2008.12.021 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Waxman SG and Zamponi GW. Regulating excitability of peripheral afferents: emerging ion channel targets. Nat Neurosc. 2014; 17: 153–63. [DOI] [PubMed] [Google Scholar]
- 8.Liu M and Wood JN. The roles of sodium channels in nociception: implications for mechanisms of neuropathic pain. Pain Med (Malden, Mass). 2011; 12 Suppl 3: S93–9. [DOI] [PubMed] [Google Scholar]
- 9.Lewis RJ and Garcia ML. Therapeutic potential of venom peptides. Nat Rev Drug Discov. 2003; 2: 790–802. doi: 10.1038/nrd1197 [DOI] [PubMed] [Google Scholar]
- 10.Olivera BM, Cruz LJ, de Santos V, LeCheminant GW, Griffin D, Zeikus R, et al. Neuronal calcium channel antagonists. Discrimination between calcium channel subtypes using ω-conotoxin from Conus magus venom. Biochemistry. 1987; 26: 2086–90. [DOI] [PubMed] [Google Scholar]
- 11.Staats PS, Yearwood T, Charapata SG, Presley RW, Wallace MS, Byas-Smith M, et al. Intrathecal ziconotide in the treatment of refractory pain in patients with cancer or AIDS: a randomized controlled trial. J Am Med Assoc. 2004; 291: 63–70. [DOI] [PubMed] [Google Scholar]
- 12.Miljanich GP. Ziconotide: neuronal calcium channel blocker for treating severe chronic pain. Curr Med Chem. 2004; 11: 3029–40. [DOI] [PubMed] [Google Scholar]
- 13.Cox JJ, Reimann F, Nicholas AK, Thornton G, Roberts E, Springell K, et al. An SCN9A channelopathy causes congenital inability to experience pain. Nature. 2006; 444: 894–8. doi: 10.1038/nature05413 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Goldberg YP, MacFarlane J, MacDonald ML, Thompson J, Dube MP, Mattice M, et al. Loss-of-function mutations in the Nav1.7 gene underlie congenital indifference to pain in multiple human populations. Clin Genet. 2007; 71: 311–9. doi: 10.1111/j.1399-0004.2007.00790.x [DOI] [PubMed] [Google Scholar]
- 15.Wu MT, Huang PY, Yen CT, Chen CC and Lee MJ. A novel SCN9A mutation responsible for primary erythromelalgia and is resistant to the treatment of sodium channel blockers. PLoS One. 2013; 8: e55212 doi: 10.1371/journal.pone.0055212 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Dib-Hajj SD, Estacion M, Jarecki BW, Tyrrell L, Fischer TZ, Lawden M, et al. Paroxysmal extreme pain disorder M1627K mutation in human Nav1.7 renders DRG neurons hyperexcitable. Mol Pain. 2008; 4: 37 doi: 10.1186/1744-8069-4-37 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Klint JK, Smith JJ, Vetter I, Rupasinghe DB, Er SY, Senff S, et al. Seven novel modulators of the analgesic target Nav1.7 uncovered using a high-throughput venom-based discovery approach. Br J Pharmacol. 2015; 172: 2445–58. doi: 10.1111/bph.13081 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Sousa SR, Vetter I and Lewis RJ. Venom peptides as a rich source of Cav2.2 channel blockers. Toxins. 2013; 5: 286–314. doi: 10.3390/toxins5020286 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Klint JK, Senff S, Rupasinghe DB, Er SY, Herzig V, Nicholson GM, et al. Spider-venom peptides that target voltage-gated sodium channels: pharmacological tools and potential therapeutic leads. Toxicon. 2012; 60: 478–91. doi: 10.1016/j.toxicon.2012.04.337 [DOI] [PubMed] [Google Scholar]
- 20.Herzig V, Wood DL, Newell F, Chaumeil PA, Kaas Q, Binford GJ, et al. ArachnoServer 2.0, an updated online resource for spider toxin sequences and structures. Nucleic Acids Res. 2011; 39: D653–7. doi: 10.1093/nar/gkq1058 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Sousa SR, Vetter I, Ragnarsson L and Lewis RJ. Expression and pharmacology of endogenous Cav channels in SH-SY5Y human neuroblastoma cells. PloS One. 2013; 8: e59293 doi: 10.1371/journal.pone.0059293 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Schnolzer M, Alewood P, Jones A, Alewood D and Kent SB. In situ neutralization in Boc-chemistry solid phase peptide synthesis. Rapid, high yield assembly of difficult sequences. Int J Pept Protein Res. 1992; 40: 180–93. [DOI] [PubMed] [Google Scholar]
- 23.Vetter I, Mozar CA, Durek T, Wingerd JS, Alewood PF, Christie MJ, et al. Characterisation of Nav types endogenously expressed in human SH-SY5Y neuroblastoma cells. Biochem Pharmacol. 2012; 83: 1562–71. doi: 10.1016/j.bcp.2012.02.022 [DOI] [PubMed] [Google Scholar]
- 24.Wagner J, Snowman A, Biswas A, Olivera B and Snyder S. ω-conotoxin GVIA binding to a high affinity receptor in brain: Characterization, calcium sensitivity and solubilization. J Neuroscience. 1988; 9: 3354–9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Ahmad SN and Miljanich GP. The calcium channel antagonist, ω-conotoxin, and electric organ nerve terminals: binding and inhibition of transmitter release and calcium influx. Brain Res. 1988; 453: 247–56. [DOI] [PubMed] [Google Scholar]
- 26.Feng ZP, Hamid J, Doering C, Jarvis SE, Bosey GM, Bourinet E, et al. Amino acid residues outside of the pore region contribute to N-type calcium channel permeation. J Biol Chem. 2001; 276: 5726–30. doi: 10.1074/jbc.C000791200 [DOI] [PubMed] [Google Scholar]
- 27.Bladen C, McDaniel SW, Gadotti VM, Petrov RR, Berger ND, Diaz P, et al. Characterization of novel cannabinoid based T-type calcium channel blockers with analgesic effects. ACS Chem Neurosci. 2015; 6: 277–87. doi: 10.1021/cn500206a [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Bryant CD, Zhang NN, Sokoloff G, Fanselow MS, Ennes HS, Palmer AA, et al. Behavioral differences among C57BL/6 substrains: implications for transgenic and knockout studies. J Neurogenet. 2008; 22: 315–31. doi: 10.1080/01677060802357388 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Deuis JR, Wingerd JS, Winter Z, Durek T, Dekan Z, Sousa SR et al. Analgesic Effects of GpTx-1, PF-04856264 and CNV1014802 in a Mouse Model of Nav1.7-Mediated Pain. Toxins. 2016; 8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Jalali A, Bosmans F, Amininasab M, Clynen E, Cuypers E, Zaremirakabadi A, et al. OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels. FEBS Lett. 2005; 579: 4181–86. doi: 10.1016/j.febslet.2005.06.052 [DOI] [PubMed] [Google Scholar]
- 31.Herzig V and Hodgson WC. Neurotoxic and insecticidal properties of venom from the Australian theraphosid spider Selenotholus foelschei. Neurotoxicology. 2008; 29:471–5 doi: 10.1016/j.neuro.2008.03.002 [DOI] [PubMed] [Google Scholar]
- 32.Durek T, Vetter I, Wang CI, Motin L, Knapp O, Adams DJ, et al. Chemical engineering and structural and pharmacological characterization of the alpha-scorpion toxin OD1. ACS Chem Biol. 2013; 8: 1215–22. doi: 10.1021/cb400012k [DOI] [PubMed] [Google Scholar]
- 33.Lewis RJ, Nielsen KJ, Craik DJ, Loughnan ML, Adams DA, Sharpe IA, et al. Novel ω-conotoxins from Conus catus discriminate among neuronal calcium channel subtypes. J Biol Chem. 2000; 275: 35335–44. doi: 10.1074/jbc.M002252200 [DOI] [PubMed] [Google Scholar]
- 34.Altschul SF, Gish W, Miller W, Myers EW and Lipman DJ. “Basic local alignment search tool.” J Mol Biol. 1990; 215: 403–10. doi: 10.1016/S0022-2836(05)80360-2 [DOI] [PubMed] [Google Scholar]
- 35.Liu Z, Dai J, Dai L, Deng M, Hu Z, Hu W, et al. Function and solution structure of Huwentoxin-X, a specific blocker of N-type calcium channels, from the Chinese bird spider Ornithoctonus huwena. J Biol Chem. 2006; 281: 8628–35. doi: 10.1074/jbc.M513542200 [DOI] [PubMed] [Google Scholar]
- 36.Bosmans F, Rash L, Zhu S, Lazdunski M, Escoubas P, et al. Four novel tarantula toxins as selective modulators of voltage-gated sodium channel subtypes. Mol Pharmacol. 2006; 69: 419–29. doi: 10.1124/mol.105.015941 [DOI] [PubMed] [Google Scholar]
- 37.Pallaghy PK, Nielsen KJ, Craik DJ and Norton RS. A common structural motif incorporating a cystine knot and a triple-stranded beta-sheet in toxic and inhibitory polypeptides. Protein Sci. 1994; 3: 1833–9. doi: 10.1002/pro.5560031022 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Colgrave ML and Craik DJ. Thermal, chemical, and enzymatic stability of the cyclotide kalata B1: the importance of the cyclic cystine knot. Biochemistry. 2004; 43: 5965–75. doi: 10.1021/bi049711q [DOI] [PubMed] [Google Scholar]
- 39.McDonough SI, Lampe RA, Keith RA and Bean BP. Voltage-dependent inhibition of N- and P-type calcium channels by the peptide toxin ω-grammotoxin-SIA. Mol Pharmacol. 1997; 52: 1095–104. [DOI] [PubMed] [Google Scholar]
- 40.Ellinor PT, Zhang JF, Horne WA and Tsien RW. Structural determinants of the blockade of N-type calcium channels by a peptide neurotoxin. Nature. 1994; 372: 272–5. doi: 10.1038/372272a0 [DOI] [PubMed] [Google Scholar]
- 41.Feng ZP, Hamid J, Doering C, Bosey GM, Snutch TP and Zamponi GW. Residue Gly1326 of the N-type calcium channel α1B subunit controls reversibility of ω-conotoxin GVIA and MVIIA block. Journal Biol Chem. 2001; 276: 15728–35. [DOI] [PubMed] [Google Scholar]
- 42.Sokolov S, Kraus RL, Scheuer T and Catterall WA. Inhibition of sodium channel gating by trapping the domain II voltage sensor with protoxin II. Mol Pharmacol. 2008; 73: 1020–8. doi: 10.1124/mol.107.041046 [DOI] [PubMed] [Google Scholar]
- 43.Maertens C, Cuypers E, Amininasab M, Jalali A, Vatanpour H and Tytgat J. Potent modulation of the voltage-gated sodium channel Nav1.7 by OD1, a toxin from the scorpion Odonthobuthus doriae. Mol Pharmacol. 2006; 70: 405–14. doi: 10.1124/mol.106.022970 [DOI] [PubMed] [Google Scholar]
- 44.Herzig V and King GF. The cystine knot is responsible for the exceptional stability of the insecticidal spider toxin ω-hexatoxin-Hv1a. Toxins. 2015; 7: 4366–80. doi: 10.3390/toxins7104366 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Stotz SC, Jarvis SE and Zamponi GW. Functional roles of cytoplasmic loops and pore lining transmembrane helices in the voltage-dependent inactivation of HVA calcium channels. J Physiol. 2004; 554: 263–73. doi: 10.1113/jphysiol.2003.047068 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Mathes C, Friis S, Finley M and Liu Y. QPatch: the missing link between HTS and ion channel drug discovery. Comb Chem High Throughput Screen. 2009; 12: 78–95. [DOI] [PubMed] [Google Scholar]
- 47.Terstappen GC, Roncarati R, Dunlop J and Peri R. Screening technologies for ion channel drug discovery. Future Med Chem. 2010; 2: 715–30. doi: 10.4155/fmc.10.180 [DOI] [PubMed] [Google Scholar]
- 48.Felix JP, Williams BS, Priest BT, Brochu RM, Dick IE, Warren VA, et al. Functional assay of voltage-gated sodium channels using membrane potential-sensitive dyes. Assay Drug Dev. Technol. 2004; 2: 260–68. doi: 10.1089/1540658041410696 [DOI] [PubMed] [Google Scholar]
- 49.King GF, Gentz MC, Escoubas P and Nicholson GM. A rational nomenclature for naming peptide toxins from spiders and other venomous animals. Toxicon. 2008; 52: 264–76. doi: 10.1016/j.toxicon.2008.05.020 [DOI] [PubMed] [Google Scholar]
- 50.Ma Z, Kong J, Gordon D, Gurevitz M and Kallen RG. Direct evidence that scorpion α-toxins (Site-3) modulate sodium channel inactivation by hindrance of voltage-sensor movements. PLoS One. 2013; 8: e77758 doi: 10.1371/journal.pone.0077758 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.McPhee JC, Ragsdale DS, Scheuer T and Catterall WA. A critical role for the S4-S5 intracellular loop in domain IV of the sodium channel alpha-subunit in fast inactivation. J Biol Chem. 1998; 273: 1121–9. [DOI] [PubMed] [Google Scholar]
- 52.Xiao Y, Blumenthal K and Cummins TR. Gating-pore currents demonstrate selective and specific modulation of individual sodium channel voltage-sensors by biological toxins. Mol Pharmacol. 2014; 86: 159–67. doi: 10.1124/mol.114.092338 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Fozzard HA and Lipkind GM. The tetrodotoxin binding site is within the outer vestibule of the sodium channel. Mar Drugs. 2010; 8: 219–34. doi: 10.3390/md8020219 [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Smith JJ, Herzig V, King GF and Alewood PF. The insecticidal potential of venom peptides. Cell Mol Life Sci. 2013;70: 3665–93. doi: 10.1007/s00018-013-1315-3 [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
All relevant data are within the paper and its Supporting Information files.