Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2018 May 8;8:7143. doi: 10.1038/s41598-018-25315-w

Systematic analysis of DEMETER-like DNA glycosylase genes shows lineage-specific Smi-miR7972 involved in SmDML1 regulation in Salvia miltiorrhiza

Jiang Li 1, Caili Li 1, Shanfa Lu 1,
PMCID: PMC5940787  PMID: 29739980

Abstract

DEMETER-like DNA glycosylases (DMLs) initiate the base excision repair-dependent DNA demethylation to regulate a wide range of biological processes in plants. Six putative SmDML genes, termed SmDML1SmDML6, were identified from the genome of S. miltiorrhiza, an emerging model plant for Traditional Chinese Medicine (TCM) studies. Integrated analysis of gene structures, sequence features, conserved domains and motifs, phylogenetic analysis and differential expression showed the conservation and divergence of SmDMLs. SmDML1, SmDML2 and SmDML4 were significantly down-regulated by the treatment of 5Aza-dC, a general DNA methylation inhibitor, suggesting involvement of SmDMLs in genome DNA methylation change. SmDML1 was predicted and experimentally validated to be target of Smi-miR7972. Computational analysis of forty whole genome sequences and almost all of RNA-seq data from Lamiids revealed that MIR7972s were only distributed in some plants of the three orders, including Lamiales, Solanales and Boraginales, and the number of MIR7972 genes varied among species. It suggests that MIR7972 genes underwent expansion and loss during the evolution of some Lamiids species. Phylogenetic analysis of MIR7972s showed closer evolutionary relationships between MIR7972s in Boraginales and Solanales in comparison with Lamiales. These results provide a valuable resource for elucidating DNA demethylation mechanism in S. miltiorrhiza.

Introduction

Salvia, widely distributed in the world, is the largest genus in the Labiatae family. It includes about 900 species, of which many have significant economical and medicinal value. S. miltiorrhiza Bunge is a well-known Salvia species widely used in traditional Chinese medicine (TCM) for the treatment of dysmenorrhoea, amenorrhoea and cardiovascular diseases14. It is also one of the best selling TCM materials with long usage history and the first Chinese herb entering international market. Recently, S. miltiorrhiza is emerging as a model system for medicinal plant biology5. The whole genomes of two S. miltiorrhiza lines have been decoded6,7. A huge amount of RNA-seq-based transcriptome data have been obtained and are available for comparative analysis (https://www.ncbi.nlm.nih.gov/sra). It provides useful information for further elucidating the genetic and epigenetic regulatory mechanisms of S. miltiorrhiza development and bioactive compound production.

Epigenetic regulation is an important regulatory mechanism affecting many plant cellular processes. It is known that epigenetic phenotypes are caused by changes in a chromosome without alterations in the DNA sequence, including individual or combined changes in DNA methylation and histone modification, as well as the action of chromatin-remodeling factors and noncoding RNAs8. DNA methylation is an important epigenetic modification. It is involved in multiple biological processes, such as transposon silencing, genomic imprinting, and X-chromosome inactivation913. In mammals, DNA methylation predominantly occurs in CG sequence contexts14; however, in plants, three sequence contexts, including CG, CHG and CHH (H represents either A, T or G), are major DNA methylation targets15,16. DNA methylation levels and patterns in plants are dynamically regulated by DNA methyltransferases and demethylases. DNA METHYLTRANSFERASE 1 (MET1) and CHROMOMETHYLASE 3 (CMT3) maintain symmetric CG17 and CHG methylation18, respectively. Methylation of asymmetric CHH contexts must be de novo created by DOMAINS REARRANGED METHYLTRANSFERASE (DRM) during cell replication19. DNA demethylation can be regulated through passive or active processes. Passive demethylation occurs in newly synthesized DNA strand and is caused by dysfunction of DNA methyltransferase, whereas active demethylation is an outcome of replacement of methylated cytosine with non-methylated cytosine under the catalysis of DEMETER-like DNA glyscosylases (DMLs)20,21.

The DMLs act as bifunctional glycosylase/AP-lyase, which removes 5-methylcytosine (5 mC) followed by cleaving the abasic site8. They contain three essential domains, including a DNA glycosylase domain and two additional conserved domains, termed domain A and domain B22. The DNA glycosylase domain has a helix-hairpin-helix (HhH) motif, a glycine/proline-rich region followed by a conserved aspartic acid (GPD), and a [4Fe-4S] cluster motif22. The [4Fe-4S] cluster motif consists of four cysteine residues functioning to hold a [4Fe-4S] cluster and is required for 5 mC excision22. Amino acids in domain A are required for nonspecific DNA binding and all three domains are necessary and sufficient for 5 mC excision22.

DMLs play significant roles in many developmental and biological processes, such as reproduction, seed development, and plant response to biotic and abiotic stresses20,2327. Arabidopsis contains four DML gene family members, known as AtDME, AtROS1, AtDML2 and AtDML3, respectively. AtDME is necessary for seed viability and is a core regulator of imprinted genes28. It is preferentially expressed in the central cell before fertilization, ensuring maternal expression of the imprinted genes MEA and FWA29,30. AtROS1, AtDML2 and AtDML3 are broadly expressed in vegetative tissues to maintain a proper genome methylation pattern and to regulate relevant genes and transposons31. AtROS1 counteracts RNA-directed DNA Methylation (RdDM) pathway for dynamic transcriptional regulation32, whereas AtDML2 and AtDML3 are involved in removing improper methylated cytosines and maintaining methylation levels of certain targeted sites to make sure an appropriate distribution of genome methylation31. A total of six DML genes exist in the rice genome. It includes OsROS1a, OsROS1b, OsROS1c, OsROS1d, OsDML3a and OsDML3b, of which four are AtROS1 orthologs, whereas the other two are AtDML3 orthologs24. The function of OsROS1a is analogous, to certain extent, to that of AtDME in both male and female gametophytes33. OsROS1c is responsible for the demethylation of retrotransposon Tos17 and plays a critical role in promoting the transposition of Tos1721. Little is known about the function of other rice DMLs and DMLs in other plants.

Based on current knowledge of epigenetics, we presume that epigenetic regulation is involved in secondary metabolism and Dao-di herb formation, two important issues in medicinal plant biology. With the long-term goal to test this hypothesis and to elucidate the underlying mechanisms, we analyze and report here the DML gene family in S. miltiorrhiza. Comparative analysis showed that SmDMLs were conserved with Arabidopsis and rice DMLs. They differentially expressed in various S. miltiorrhiza tissues and were responsive to DNA methylation inhibitor (5-aza-2′-deoxycytidine, 5Aza-dC) treatments. The expression of SmDML1 is posttranscriptionally regulated by Smi-miR7972. The existence of MIR7972s in plants was systematically investigated. MIR7972 genes were identified in some species belonging to three orders, including Lamiales, Solanales, and Boraginales. The distribution patterns were scattered and the number of gene members was varied among species. The results provide the first hand of information for elucidating the role of epigenetic regulation in medicinal plants.

Results

Identification and comparative analysis of SmDMLs

Since S. miltiorrhiza has significant medicinal value and is being developed rapidly as a model system for medicinal plant biology, two research groups sequenced the whole genomes of two different S. miltiorrhiza lines, one of which is known as 99-37, whereas the name of the other one is unknown6. The draft genome assemblies of line 99-3 and the name-unknown line are about 559 and 641 Mb, respectively, although the estimated genome sizes are 615 and 645.78 Mb, respectively6,7. It suggests that both of the current S. miltiorrhiza genome assemblies are incomplete. In order to identify S. miltiorrhiza DEMETER-like DNA glycosylase gene family (SmDMLs), we searched the two genome assemblies using four Arabidopsis AtDML proteins as queries. The retrieved genomic DNA sequences were first computationally predicted for gene models on the GENSCAN web server34 and then manually examined and corrected by comparison with DML genes identified from other plants (www.ncbi.nlm.nih.gov/blast/) and by alignment with RNA-seq data of S. miltiorrhiza transcriptome (http://www.ncbi.nlm.nih.gov/sra). After correcting various genomic DNA sequence errors, we obtained six full-length SmDML genes from the genome assembly of the name-unknown S. miltiorrhiza line and four full-length SmDML genes and several SmDML gene fragments from the genome assembly of line 99-3. Amino acid sequence alignment showed that each of the four SmDML proteins from line 99-3 was identical to a SmDML protein from the name-unknown S. miltiorrhiza line. Sequence comparison of line 99-3 SmDML gene fragments, transcriptome of line 99-3 and the other two SmDML genes from the name-unknown S. miltiorrhiza line showed that line 99-3 SmDML gene fragments encoded partial SmDML proteins identical to the other two SmDML proteins from the name-unknown S. miltiorrhiza line. Taken together, we conclude that the SmDML gene family includes six members, which are designated as SmDML1SmDML6, respectively (Table 1). The number of SmDMLs is more than AtDMLs, whereas it is same as OsDMLs24.

Table 1.

Sequence features and intron numbers of SmDMLs, AtDMLs and OsDMLs.

Gene name Gene model Gene length No. of intron ORF (bp) Protein (aa) MW (kDa) pI
SmDML1 MG602215 9194 18 5865 1954 217.9 6.90
SmDML2 MG602216 8800 19 5598 1865 207.2 6.97
SmDML3 MG602217 11369 19 6093 2030 226.5 8.20
SmDML4 MG602218 4976 19 2163 720 80.5 9.27
SmDML5 MG602219 6859 20 3165 1054 118.4 6.76
SmDML6 MG602220 9820 20 3237 1078 121.8 7.37
AtDME AT5G04560.2 8306 18 5964 1987 221.1 7.61
AtROS1 AT2G36490.1 6014 18 4182 1393 156.5 7.38
AtDML2 AT3G10010.1 6197 19 3999 1332 151.5 8.62
AtDML3 AT4G34060.1 5251 19 3135 1044 120.3 9.63
OsROS1a LOC_Os01g11900.1 11143 16 5859 1952 215.9 6.77
OsROS1b LOC_Os02g29230.1 8100 14 4911 1636 182.6 6.53
OsROS1c LOC_Os05g37350.1 12675 19 5544 1847 205.9 6.61
OsROS1d LOC_Os05g37410.1 10616 20 5490 1829 204.3 6.53
OsDML3a LOC_Os02g29380.1 8438 16 3624 1207 134.4 6.14
OsDML3b LOC_Os04g28860.1 5860 12 2883 960 108.4 8.94

SmDML genes contain 18–20 introns (Table 1, Fig. 1). Although similarities of gene structures exist among the six SmDMLs, it is particularly high among SmDML1, SmDML2 and SmDML3 and between SmDML5 and SmDML6. In addition, the structures of SmDML1, SmDML2 and SmDML3 are highly similar to four AtDMLs, OsROS1aOsROS1d and OsDML3a (Fig. 1). The deduced SmDML proteins have amino acid number varying from 720 (SmDML4) to 2030 (SmDML3), isoelectric point (pI) from 6.76 (SmDML5) to 9.27 (SmDML4), and molecular weight (Mw) from 80.5 kDa (SmDML4) to 226.5 (SmDML3) (Table 1). Wide ranges of gene length, pI and Mw also exist among AtDMLs and OsDMLs (Table 1). It suggests the conservation and divergence of sequence features of plant DMLs.

Figure 1.

Figure 1

Gene structures of DMLs in S. miltiorrhiza, Arabidopsis and rice. Exons are presented by filled green boxes. Introns are presented by lines.

Conserved domains and motifs of DMLs

It has been shown that DML proteins contain a DNA glycosylase domain and two additional conserved domains A and B22. Multiple sequence alignment of deduced amino acid sequences showed that all of the six SmDMLs also contain the three domains (Fig. 2, see Supplementary Figs S13). The DNA glycosylase domain is highly conserved among 15 analyzed DMLs, including six SmDMLs, four AtDMLs and five OsDMLs, and contains HhH, GPD and [4Fe-4S] cluster motifs (Fig. 2). Compared with other DMLs analyzed, OsDML3b has less conserved DNA glycosylase domain. Differing from the DNA glycosylase domain, the sequences of domains A and B are highly conserved among all 16S. miltiorrhiza, Arabidopsis and rice DMLs (see Supplementary Figs S2,3). In addition to the amino acid sequence, the location of domains is conserved among all DMLs from S. miltiorrhiza, Arabidopsis and rice (see Supplementary Fig. S1). These results suggest that the majority of domains in DMLs from different plant species are deeply conserved. It is consistent with the critical function of these domains in 5 mC excision.

Figure 2.

Figure 2

Amino acid sequence alignment of the conserved DNA glycosylase domain of DML proteins in S. miltiorrhiza, Arabidopsis and rice. Numbers show the position of amino acids. Identical amino acids are highlighted in red. Similar amino acid residues are showed in red.

In order to further determine the conservation and divergence of plant DMLs, we searched conserved motifs in SmDMLs, AtDMLs and OsDMLs using the MEME suite (http://meme.sdsc.edu/meme/meme.html). A total of 15 conserved motifs were identified (Fig. 3). The length of motifs ranges from 18 to 150 amino acids (Table 2). The number of motifs in each DML varies between 7 and 15. Motif 1 is actually the DNA glycosylase domain. It exists in 15 of the 16 DMLs analyzed (Fig. 3). No motif 1 was detected in OsDML3b. It is consistent with the fact that the DNA glycosylase domain is less conserved in OsDML3b compared with that in other DMLs analyzed. Motifs 2 and 9 are located in domain A. Motif 2 exists in all 16 DMLs analyzed, whereas motif 9 was found in 13 of the 16 DMLs. No motif 9 was detected in SmDML4, OsDML3a and OsDML3b. It suggests that motif 2 is more conserved than motif 9, although both of them are located in the conserved domain A. Motifs 3, 4, 5, 7, 8 and 11 are located in domain B. Among them, motifs 3, 4, 5, 7 and 8 existing in 14 or 15 DMLs show relatively high conservation, whereas motif 11, which was detected in 11 of 16 DMLs, is the least conserved. In addition to the nine motifs found in conserved domains, other six, including motifs 6, 10, 12, 13, 14 and 15, are located in less conserved regions. Among them, motifs 6, 10 and 13 are highly conserved, whereas motifs 12, 14 and 15 are specific to OsROS1c and OsROS1d. Motifs commonly existing in DMLs are probably associated with the conserved functions of DMLs, but those specific to a few DMLs seem to be related to gene-specific functions.

Figure 3.

Figure 3

Distribution of conserved motifs of DML proteins from S. miltiorrhiza, Arabidopsis and rice.

Table 2.

Consensus sequences of 15 motifs identified in SmDMLs, AtDMLs and OsDMLs.

Motif Length (aa) Consensus sequence
1 150 FLNRLVKDHGSIDLEWLRDVPPDKAKDYLLSIRGLGLKSVECVRLLTLHHLAFPVDTNVGRIAVRLGWVPLQPLPESLQLHLLELYPVLESIQKYLWPRL
2 63 ERRVFRGRADSFIARMHLVQGDRRFSPWKGSVVDSVVGVFLTQNVSDHLSSSAFMSLAAKFPV
3 43 RGTILIPCRTAMRGSFPLNGTYFQVNEVFADHESSLNPIDVPR
4 29 QYCFWRGFVCVRGFDRKTRAPRPLVARLH
5 33 ASIPTPKLKNVSRLRTEHQVYELPDSHPLLEGF
6 41 ERTEDTMDSVDWEAVRCADVKEIADTIKERGMNNMLAERIK
7 21 DKREPDDPCPYLLAIWTPGET
8 21 WNLPRRTVYFGTSVPSIFKGL
9 28 VKKKKPRPKVDLDPETTRVWNLLMGKDA
10 29 EAFYEDPDEIPTIKLNMEEFTQNLKSYIQ
11 21 LCSNETCFSCNSIREAQSQTV
12 150 YIKFMTKKRSQKARLNSPNSIQPNIDQKNRFSSETIFSGGFNGLKRSEETFQKTLPQIPDDKRINLDIHCEVPVENSPNTSTPPYMDYLQGVTSKFRYFD
13 18 NCEPIIEEPASPEPEIEE
14 150 MACEKIHMEPKGNATVNELTKGENYSLHCKEPAGSLCDHETEIDHKAKSISDFSAVELTACMKNLHATQFQKEISLSQSVVTSESILQPGLPLSSGMDHA
15 150 HRPKVIREDRPAKKQMATTSEEKPLNQKPKRKYVWKNRNPSSLEKCAEPFSDHSISRESRTTVRSSIASVRRRLQFEFGEHGVQRDQSSRTNSWYRNQEK

Phylogenetic analysis of DML proteins

In order to determine the evolutionary relationship among DMLs, an unrooted neighbor-joining tree was constructed using 66 full length protein sequences from 16 plant species. DML proteins were clustered into three orthology groups, including the DME group, the ROS1 group, and the DML3 group (Fig. 4). The ROS1 group is the largest group. It contains 33 DML proteins. Based on the phylogenetic tree constructed, the ROS1 group may be further divided into the monocot subgroup and the dicot subgroup. Similar to the ROS1 group, the DML3 group may also be divided into the monocot subgroup and the dicot subgroup. DME group is only restricted to dicots. It indicates that DME may be phylogenetically monophyletic in dicots. These results are consistent with previous phylogenetic tree constructed using conserved DNA glycosylase domains of DMLs from flowering plants24. It suggests the conservation and divergence of DML proteins in monocots and dicots.

Figure 4.

Figure 4

Phylogenetic analysis of DML proteins from 16 plant species. Monocot and dicot are colored green and red, respectively. The bootstrap values are shown.

All of SmDMLs showed close phylogenetic relationships with DMLs from monkey flower (Erythranthe guttatus) (Fig. 4). It is consistent with the fact that both S. miltiorrhiza and E. guttatus are members of Lamiales. Based on gene structures, conserved motifs and phylogenetic relationships, SmDML2 and SmDML5 are closely related with SmDML3 and SmDML6, respectively. SmDML2 and SmDML3 share 62.88% protein sequence identity and 66.16% cDNA similarity. Protein sequence identity and cDNA similarity between SmDML5 and SmDML6 are 89.58% and 93.17%, respectively. It implies duplication events occurred during SmDMLs evolution. To test the phylogenetic selection pressure on these genes after duplication, we analyzed the substitution rate ratios of nonsynonymous (Ka) versus synonymous (Ks) mutations (Ka/Ks)35. Generally, Ka/Ks = 1 suggests that the genes are pseudogenes with neutral selection, whereas less than 1 implies purifying or stabilizing selection35. The calculated Ka/Ks values between SmDML2 and SmDML3 and between SmDML5 and SmDML6 are 0.3833 and 0.9799, respectively. It indicated that SmDML2 and SmDML3 paralogous pairs experienced strong purifying selection, whereas SmDML5 and SmDML6 paralogous pairs could be pseudogenes with neutral selection. These results suggested that specific SmDMLs experienced distinct phylogenetic selection pressure.

Differential expression of SmDMLs in S. miltiorrhiza

As the main participants of DNA demethylation, DMLs play important roles in plant growth and development36,37. To preliminarily explore the biological function of SmDMLs, the expression of six SmDMLs in flowers, leaves, roots and stems of 2-year-old, field nursery-grown S. miltiorrhiza plants was analyzed using quantitative RT-PCR technology. Although the transcripts of all six SmDMLs were detected in the tissues analyzed, significant differential expression patterns were observed (Fig. 5). SmDML1 showed the highest expression in leaves and flowers. Its expression in roots was the lowest among the four tissues analyzed. The expression patterns of SmDML1 are different from its Arabidopsis counterpart, AtROS1, which showed high expression in stems and roots and low in flowers31. SmDML2 and SmDML3 are paralogs closely related (Fig. 4). Consistently, they showed similar expression patterns with the highest in flowers, followed by stems, leaves and roots. SmDML4 was predominantly expressed in flowers. Although SmDML5 and SmDML6 are probably pseudogenes based on Ka/Ks, they were expressed. SmDML5 showed the highest expression in flowers and stems, followed by leaves, and the lowest in roots, whereas SmDML6 was expressed mainly in flowers and leaves (Fig. 5). Expressed pseudogenes have been reported in other plants, such as rice35 and barley38.

Figure 5.

Figure 5

Expression patterns of SmDMLs in roots (Rt), stems (St), leaves (Le) and flowers (Fl) of S. miltiorrhiza. The expression levels were analyzed using the quantitative RT-PCR method. Fold changes of SmDML expression are shown. Expression level in leaves was arbitrarily set to 1 and the levels in other organs were given relative to this. One-way ANOVA was calculated using IBM SPSS 20 software. P < 0.05 was considered statistically significant and was represented by different letters. Error bars was indicated by the standard deviations of three biological replicates.

To further analyze the expression patterns of SmDMLs, we analyzed RNA-seq data generated for periderm, phloem and xylem of S. miltiorrhiza roots. SmDML1 exhibited the highest expression in xylem, followed by phloem and periderm. The expression of SmDML2 and SmDML3 paralogs showed similar patterns with the highest in phloem, followed by xylem and periderm. However, the differential expression for each of them in the three tissues of S. miltiorrhiza roots was not significant as analyzed using TopHat2.0.12 and Cufflinks2.2.139 (Table S3). The FPKM (Fragments Per Kilobase of transcript per Million mapped reads) values of SmDML4–SmDML6 were very low, which are consistent with the low expression levels in roots analyzed using the quantitative RT-PCR technology (Fig. 5).

Expression patterns of SmDML genes in response to 5Aza-dC

It has been shown that DNA methylation-related genes are responsive to DNA methylation inhibitor treatment and methylation-sensitive expression of ROS1 in plants is conserved and adaptive40. To elucidate the expression patterns of SmDML genes in response to DNA methylation inhibitor treatment, we treated S. miltiorrhiza plantlets with different concentrations of the DNA methyltransferase inhibitor, 5Aza-dC. Gene expression analysis showed that SmDML1, SmDML2 and SmDML4 were significantly methylation-responsive (Fig. 6). SmDML1 transcripts were significantly reduced regardless of the concentration of 5Aza-dC treated (Fig. 6). The expression of SmDML2 was significantly decreased at 5 µM and 10 µM 5Aza-dC treatments; however, reduced expression of SmDML2 was not significant at higher 5Aza-dC concentrations (Fig. 6). The expression of SmDML4 was significantly decreased at 10 µM, 30 µM and 50 µM 5Aza-dC treatments. SmDML5 and SmDML6 transcript levels were not influenced by 5Aza-dC treatments, indicating they could be not involved in DNA demethylation. Interestingly, the expression of SmDML3 was not detected in S. miltiorrhiza plantlets (Fig. 6); however, it was expressed in all mature tissues analyzed (Fig. 6), implying its important roles in S. miltiorrhiza plant maturation. Taken together, these data suggest that DNA methylation changes can influence SmDML expression in S. miltiorrhiza.

Figure 6.

Figure 6

Responses of SmDML genes to 5Aza-C treatment. Fold changes of SmDMLs in leaves of S. miltiorrhiza plantlets treated with 1, 5, 10, 30 or 50 µM of 5Aza-C for 15 days are shown. The expression levels were analyzed using the quantitative RT-PCR method. Expression level in leaves without treatment (0 µM) was arbitrarily set to 1 and the levels in leaves of 5Aza-C-treated plantlets were given relative to this. One-way ANOVA was calculated using IBM SPSS 20 software. P < 0.05 was considered statistically significant and was represented by asterisks.

miRNA-mediated posttranscriptional regulation of SmDML1

In Arabidopsis, AtDML3 transcripts are cleaved by miR40241,42. In Nicotiana benthamiana, NbROS1 is targeted by Nb_miRC1_3p43. In order to know whether SmDMLs are regulated by miRNAs, we searched high-throughput S. miltiorrhiza small RNA database for miRNAs potentially targeting SmDMLs using psRNATarget44,45. A total of 44 small RNAs with sequence reads greater than four were identified under the maximum expectation of 3.0. The retrieved small RNA sequences were aligned with S. miltiorrhiza 99-3 genome and then secondary structures of genomic DNA sequences surrounding the small RNAs were predicted and manually checked. It resulted in the identification of Smi-MIR7972. This miRNA gene generates two 21nt-miRNAs, termed Smi-miR7972a and Smi-miR7972b, respectively. Smi-miR7972a and Smi-miR7972b are overlapped, and Smi-miR7972a starts 1nt upstream relative to Smi-miR7972b (Fig. 7a). Quantitative qRT-PCR analysis using Smi-miR7972a- and Smi-miR7972b-specific primers showed that Smi-miR7972a was highly expressed in leaves of 2-year-old, field nursery-grown S. miltiorrhiza plants (Fig. 7b). Its expression in roots, stems and flowers is similar and relatively low compared with its expression in leaves. Smi-miR7972b showed the highest expression in stems. Its expression in roots, leaves and flowers is similar. The expression of Smi-miR7972a was higher than Smi-miR7972b in all tissues analyzed (Fig. 7b). Blast analysis of Smi-miR7972a and Smi-miR7972b against miRBase (http://www.mirbase.org/) showed that Smi-miR7972a was identical to the functionally unknown Rgl-miR7972 from Rehmannia glutinosa46. Examination of Smi-miR7972a and Nb_miRC1_3p sequences revealed that they were highly similar with only a mismatched nucleotide. It suggests that Nb_miRC1_3p is actually a member of the MIR7972 family. Thus, Nb_miRC1_3p was renamed to Nbe-miR7972 in this report (Fig. 7c).

Figure 7.

Figure 7

Smi-miR7972 in S. miltiorrhiza. (a) The hairpin structure of Smi-miR7972. Smi-miR7972a and Smi-miR7972b are indicated by red and green lines. (b) Expression patterns of Smi-miR7972a and Smi-miR7972b in roots (Rt), stems (St), leaves (Le) and flowers (Fl) of S. miltiorrhiza. Fold changes of Smi-miR7972a and Smi-miR7972b are shown. Expression level of Smi-miR7972a in roots was arbitrarily set to 1 and the levels of Smi-miR7972a and Smi-miR7972b were given relative to this. Error bars was indicated by the standard deviations of three biological replicates. (c) Sequence alignment of miR7972s from S. miltiorrhiza, R. glutinosa and N. benthamiana. (d) Validation of Smi-miR7972a- and Smi-miR7972b-mediated cleavage using the modified 5′ RLM RACE method. Heavy black line represents open reading frame of SmDML1. The complementary sites of Smi-miR7972 in SmDML1 are represented by A and B and shown in red. The nucleotide sequences of Smi-miR7972a and Smi-miR7972b from 3′ to 5′ and the complementary sites of SmDML1 from 5′ to 3′ are shown in the expanded regions. Vertical dashes indicate Watson-Crick pairing. Circles indicate G:U wobble pairing. Vertical arrows indicate the 5′ termini of Smi-miR7972-mediated cleavage products, as obtained by 5′ RLM-RACE, with the frequency of clones shown.

Computational target prediction showed that SmDML1 contained two regions near-perfectly complementary to Smi-miR7972a and Smi-miR7972b (Fig. 7d). The regions were named region A and region B, respectively. The expectations are 1.0 and 3.0 for region A and region B, respectively, as calculated using psRNATarget44. To analyze the cleavage site of Smi-miR7972a and Smi-miR7972b in SmDML1, the modified 5′RLM-RACE experiments were carried out as previously described47. The results confirmed that SmDML1 was indeed cleaved at region A in vivo (Fig. 7d). However, the cleavage at region B was not validated. It indicates that region B is not cleaved due to the greater expectation. It is also possible that region B is cleaved only in certain tissues or plant developmental stages. Plant miRNAs usually cleave target mRNAs at the tenth complementary nucleotide from the 5′ end of the miRNA48,49. Investigation of cleavage site at region A showed that there were two cleavage sites. One corresponds to the tenth complementary nucleotide from the 5′ end of Smi-miR7972b, confirming the cleavage by Smi-miR7972b. The other one corresponds to the twelfth and thirteenth complementary nucleotides from the 5′ end of Smi-miR7972b and Smi-miR7972a, respectively. It implied that this site was cleaved neither Smi-miR7972b nor Smi-miR7972a, indicating the complexity of mRNA cleavage mechanism.

Phylogeny of MIR7972 genes

So far, miR7972 has been identified only in three plant species, including S. miltiorrhiza, N. benthamiana and R. glutinosa, all of which are placed in Lamiids. In order to know the phylogeny of MIR7972 genes in plants, systematic and comprehensive investigation was carried out on the whole genome sequences of 40 Lamiids species (Table S4) and almost all RNA-seq data available for Lamiids species in SRA database. MIR7972 genes exist only in Solanales, Boraginales and Lamiales. It was not found in other orders of the Lamiids clade. In total, 62 MIR7972 genes were identified (Table S5), of which 34 were from 29 Lamiales species, 26 from 8 Solanales species, whereas the other two were from two Boraginales species. Interestingly, in Solanales, MIR7972s were identified only in Nicotianeae of Solanaceae and Ipomoea of Convolvulaceae. In Boraginales, MIR7972s were identified only in two plant species of Lithospermum. However, Lamiales MIR7972s widely exist in various families, including Oleaceae, Gesneriaceae, Plantaginaceae, Pedaliaceae, Verbenaceae, Lamiaceae, Phrymaceae, Paulowniaceae, and Orobanchaceae (Fig. 8). The majority of these families are not evolutionarily close to each other (http://www.mobot.org/MOBOT/Research/APweb/welcome.html). It indicates the complexity of MIR7972 origin and evolution. The underlying mechanism remains to be elucidated. Most of the Lamiales species contain one MIR7972 gene, whereas multiple copies were found in all Nicotianeae species, suggesting the occurrence of MIR7972 duplication in Nicotianeae.

Figure 8.

Figure 8

Phylogenetic relationships of MIR7972 precursors in various Lamiids species. It includes Ruellia speciosa (rsp), Mentha longifolia (mlo), Ocimum tenuiflorum (ote), Fraxinus excelsior (fex), Dorcoceras hygrometricum (dhy), Sesamum indicum (sin), Erythranthe guttata (egu), Nicotiana obtusifolia (nob), Ipomoea nil (ini), Ipomoea trifida (itr), Nicotiana attenuata (nat), Nicotiana sylvestris (nsy), Nicotiana tomentosiformis (nto), Nicotiana tabacum (nta), Nicotiana benthamiana (nbe), Andrographis paniculata (apa), Jasminum sambac (jsa), Syringa oblata (sob), Fraxinus pennsylvanica (fpe), Olea europaea (oeu), Osmanthus fragrans (ofr), Alectra vogelii (avo), Rehmannia glutinosa (rgl), Phtheirospermum japonicum (pja), Pedicularis keiskei (pke), Conopholis americana (cam), Paulownia fortunei (pfo), Paulownia tomentosa (pto), Plantago ovata (pov), Plantago lagopus (pla), Lippia dulcis (ldu), Tectona grandis (tgr), Ocimum basilicum (oba), Perilla frutescens (pfr), Rosmarinus officinalis (rof), Mentha spicata (msp), Lithospermum erythrorhizon (ler), Arnebia euchroma (aeu). Species from Lamiales, Solanales and Boraginales are shown red, green and purple, respectively. MIR7972s could be divided into two groups, including group I and group II. The branch length is shown.

In order to reveal the phylogenetic relationship of MIR7972s, a neighbor-joining (NJ) phylogenetic tree was constructed for precursor sequences of the identified MIR7972s using MEGA7.0 (Fig. 8). MIR7972s could be divided into two groups. Group I contains Lamiales MIR7972s, whereas group II consists of MIR7972s from Solanales and Boraginales. It suggests closer evolutionary relationships between MIR7972s in Boraginales and Solanales in comparison with Lamiales. The results are consistent with previous studies showing that Lithospermeae species exhibit closer evolutionary relationships with Solanales species50.

Disscussion

S. miltiorrhiza is a widely cultivated medicinal crop in East Asia and a model medicinal plant for TCM studies. It has been used as medicinal materials to treat cerebrovascular diseases and cardiovascular diseases for hundreds of years51,52. Many genes associated with the production of bioactive compounds, including lipid-soluble tanshinones and water-soluble phenolic acids, have been characterized2,53,54. However, little is known about epigenetic factors regulating gene expression in S. miltiorrhiza. Elucidation of regulatory process of DNA methylation is important for understanding gene expression regulatory mechanism associated with secondary metabolism and Dao-di herb formation in S. miltiorrhiza. In this study, six S. miltiorrhiza SmDML genes involved in DNA demethylation were identified and characterized. The number of SmDML genes is similar to those from castor bean, tomato, Arabidopsis and rice, ranging from three to six24,55,56.

Phylogenetic analysis of 66 DMLs from 16 plant species showed that SmDML1 was a member of the ROS1 group, SmDML2–SmDML4 belonged to the DME group, and SmDML5 and SmDML6 were included in the DML3 group (Fig. 4). The results from Arabidopsis and rice showed that DMLs in a group may have different functions. For instance, both rice OsROS1a and OsROS1c are members of the ROS1 group. OsROS1a is indispensable in both male and female gametophytes and critical to gametophytes33, whereas OsROS1c promotes expression and transposition of Tos1721. Among the three SmDMLs of the DME group, SmDML4 is the smallest with only 720 amino acids. It lacks conserved motifs 9, 10, 11, and 13 compared with SmDML2 and SmDML3 (Fig. 3). SmDML2SmDML4 showed differential expression in mature plants (Fig. 5) and SmDML3 was not expressed in plantlets. Similarly, differential expression was observed for SmDML5 and SmDML6 (Fig. 5), two SmDMLs of the DML3 group. It indicates that SmDMLs from a group may also be involved in distinct biological processes.

Generally, DNA methylation suppresses gene expression, whereas DNA demethylation promotes gene expression. In this study, we found that the expression of SmDMLs was down-regulated after 5Aza-dC treatment. It is consistent with significant down-regulation of DMLs in DNA methylation mutants in Arabidopsis57,58. Low expression of SmDMLs may contribute to maintain the certain DNA methylation level under the presence of 5Aza-dC. Balance between DNA methylation and demethylation is important for plant growth and development59,60. In Arabidopsis, the balance is monitored by a DNA methylation monitoring sequence (MEMS) in the ROS1 promoter region40,60. It is unknown whether this mechanism also exists in S. miltiorrhiza. Alternatively, SmDMLs were not directly regulated by DNA methylation. Down-regulation of SmDMLs under 5Aza-dC treatment was mediated by a complex network with various mediators.

Plant miRNAs are a class of small non-coding RNAs with about 21–22 nt in length. They play vital roles in many biological processes through RNA cleavage61. Arabidopsis AtDML3 is regulated by miR402. The regulation is important for seed germination under stress conditions42. In N. benthamiana, miRNA-mediated repression of ROS1 may strength transcriptional gene silencing43. Although S. miltiorrhiza miRNAs have been reported3,45,6265, their functions are largely unknown. Analysis of high-throughput sRNA data allowed us to identify Smi-miR7972a and Smi-miR7972b targeting SmDML1 for cleavage. It indicates that miRNAs play significant roles in the regulation network of DNA methylation in S. miltiorrhiza. Smi-miR7972b accumulated at lower levels than Smi-miR7972a in the tissues analyzed (Fig. 7b). The variance between the levels of Smi-miR7972a and Smi-miR7972b could be caused by differential sequence preference of DICER-LIKE 1 (DCL1) responsible for miRNA biogenesis66,67. Experimental evidence showed that the cleavage of SmDML1 was mediated by Smi-miR7972b rather than Smi-miR7972a in the tissues analyzed (Fig. 7d). The possibility that Smi-miR7972a cuts SmDML1 in other tissues cannot be ruled out. Alternatively, Smi-miR7972b is easier to be recruited by AGO proteins for the formation of RNA induced silencing complex (RISC)68.

MIR7972 genes were only identified in some species of the three Lamiids orders, including Solanales, Lamiales and Boraginales, and the number of MIR7972 genes varied among species. The actual origin and evolution mechanism of MIR7972 is unknown. One of the possibilities is that the MIR7972 genes in different plant species were originated from a common ancestor of Solanales, Lamiales and Boraginales. Loss and duplication of MIR7972 occurred in some plant species during evolution. This possibility is consistent with frequent birth and death of some MIRNA genes69. Independent origin and evolution of MIR7972s in different lineage is the other possibility. Evidence to support this possibility is that some miRNAs evolved are rarely lost and highly conserved across taxa70. The gain and loss of MIR7972 could be important for plants of some lineages to survive in the stressful environments. Further investigating the biological function of MIR7972 will help to elucidate the evolution mechanism of MIR7972.

Materials and Methods

Plant materials

Salvia miltiorrhiza Bunge (line 99-3) plants were cultivated in a field nursery at the Institute of Medicinal Plant Development, Beijing, China. Roots, stem, leaves and flowers of two-year-old plants were collected and stored immediately in liquid nitrogen until use. For 5-aza-2′-deoxycytidine (5Aza-dC) treatment, plantlets were grown on Murashige and Skoog (MS) agar medium71 supplemented with 0, 5, 10, 30 or 50 µM 5Aza-dC (Sigma) for 15 days at 25 °C under a photoperiod of 16 h light and 8 h dark. Newly generated leaves were collected and immediately stored in liquid nitrogen until use. Three independent biological replicates were carried out for each treatment.

SmDML gene identification

The deduced amino acid sequences of four Arabidopsis DML proteins were downloaded from the TAIR database (http://www.arabidopsis.org). To predict SmDML genes, AtDMLs were used as queries to search the two databases of S. miltiorrhiza whole genome sequence6,7. The searches were carried out using the tBLASTN program72. An e-value cut off of 1e−10 was applied. Gene models were predicted on the GENSCAN web server (http://genes.mit.edu/GENSCAN.html) for retrieved genomic DNA sequences34. The predicted gene models were then manually examined and corrected by comparison with DML genes identified from other plants using the BLASTx algorithm (www.ncbi.nlm.nih.gov/blast/) and by alignment with RNA-seq data of S. miltiorrhiza transcriptome (http://www.ncbi.nlm.nih.gov/sra). The INTERPRO database (http://www.ebi.ac.uk/interpro/) was finally used to confirm each predicted protein sequence to be a DML.

Gene structure and protein sequence analysis

Gene structures of SmDMLs, AtDMLs and OsDMLs were determined on the Gene Structure Display Server (GSDS 2.0; http://gsds.cbi.pku.edu.cn/index.php). Coding sequences and corresponding genomic sequences were used as inputs. The deduced protein sequences of SmDMLs, AtDMLs and OsDMLs were analyzed for amino acid number, molecular weight (Mw), theoretical isoelectric point (pI) using the EXPASY PROTOPARAM tool (http://www.expasy.org/tools/protparam.html). Multiple sequence alignment was performed for SmDML, AtDML and OsDML amino acid sequences using ClustalW. Conserved motifs in SmDML, AtDML and OsDML proteins were detected using the MEME suite (http://meme.sdsc.edu/meme/meme.html).

Phylogenetic analysis

Unrooted neighbor-joining (NJ) trees were constructed using MEGA (version 7.0) with 1000 bootstrap replicates73. Protein sequences of DMLs from 16 plant species were downloaded from Phytozome (http://phytozome.jgi.doe.gov/pz/portal.html) (Table S1). Ka and Ks values were calculated for two gene pairs, SmDML2/SmDML3 and SmDML5/SmDML6, using DNASP5 software74.

RNA extraction and qRT-PCR analysis

Total RNA was isolated from S. miltiorrhiza tissues using the plant total RNA extraction kit (Aidlab, China). The isolation was carried out following the manufacturer’s instructions. RNA integrity was analyzed on an agarose gel. RNA quantity was determined using a NanoDrop 2000C spectrophotometer (Thermo Scientific, USA). Reverse transcription was conducted using PrimeScript™ RT reagent kit (TaKaRa, Japan). Gene specific primers were designed using Primer Premier 6 (PREMIER Biosoft Int, USA) based on SmDML coding sequences. SmUBQ10 was used as an internal control as described previously2. The expression of Smi-miR7972a and Smi-miR7972b was analyzed using Mir-X miRNA qRT-PCR SYBR Kit (TaKaRa, Japan). The primers were listed in Table S2. qRT-PCR was performed in triplicate for each tissue sample using the SYBR premix Ex Taq™ kit (TaKaRa, China) on a CFX96 Touch™ real-time PCR system (Bio-Rad, USA). Three independent biological replicates were performed. Gene relative expression levels were calculated for Ct values using the 2−ΔΔCq method75. Differential expression among tissues and treatments was determined by one-way ANOVA using IBM SPSS 20 software (IBM Corporation, USA).

RAN-Seq data and bioinformatic analysis

Transcriptome sequencing data generated for periderm, phloem and xylem of S. miltiorrhiza roots was downloaded from SRA database of NCBI (SRX751296)54. Differential expression of SmDML genes was analyzed using TopHat2.0.12 and Cufflinks2.2.139.

Identification of S. miltiorrhiza miRNAs potentially targeting SmDMLs

S. miltiorrhiza small RNAs potentially targeting SmDMLs for cleavage were predicted using psRNATarget44. Small RNAs from roots, stems, leaves and flowers of S. miltiorrhiza were downloaded from SRA database (SRX686651, SRX686652, SRX686653 and SRX686654)45. The maximum expectations of 3.0 and the target accessibility-allowed maximum energy to unpair the target site of 25 were applied. The predicted small RNAs were mapped to S. miltiorrhiza 99-3 genome using Bowtie76. No mismatch was allowed. Secondary structures of genomic sequences surrounding small RNA-aligned regions were predicted on the mfold web server77. The structures were manually checked and miRNAs were annotated under the criteria described70.

5′ RLM-RACE validation of miR7972-directed cleavage

Roots, stems, leaves and flowers of two-year-old S. miltiorrhiza were used for validation of miR7972-directed cleavage. The modified RNA ligase-mediated rapid amplification of 5′ cDNAs (5′ RLM-RACE) was carried out using the FirstChoice® RLM-RACE Kit (Invitrogen, Carlsbad, CA). The nesting and nested primers were 5′-GGGGCAACCTGGTGAGATTCCATCT-3′ and 5′-ACCGGTTAACACCATTTTTCCGA-3′, respectively. Nesting PCR was carried out under the touchdown conditions: 94 °C for 3 min, 5 cycles of 94 °C for 30 s and 72 °C for 90 s, 5 cycles of 94 °C for 30 s, 70 °C for 30 s and 72 °C for 50 s, 25 cycles of 94 °C for 30 s, 60 °C for 30 s and 72 °C for 1 min, followed by a final extension at 72 °C for 10 min. Nested PCR amplification was performed under following conditions: 94 °C for 3 min, 35 cycles of 94 °C for 30 s, 60 °C for 30 s and 72 °C for 30 s, followed by a final extension at 72 °C for 10 min.

Identification of MIR7972 genes in Lamiids

MIR7972 precursors from S. miltiorrhiza, Rehmannia glutinosa and Nicotiana benthamian were used to blast genomes of 40 Lamiids plant species listed in Table S3 using BLASTn72. Transcriptome-wide identification of MIR7972 was performed through BLAST analysis of Smi-MIR7972 or Nbe-MIR7972 against RNA-seq reads (https://www.ncbi.nlm.nih.gov/sra) from Lamiids plants using BLASTn72.

Electronic supplementary material

Acknowledgements

This work was supported by the CAMS Innovation Fund for Medical Sciences (CIFMS) (2016-I2M-3-016), the Natural Science Foundation of China (31370327, 31570667 and 81773836), and the Beijing Natural Science Foundation (5152021).

Author Contributions

J.L. analyzed the data, performed qRT-PCR and RACE experiments and participated in writing the manuscript. C.L. contributed to data analysis and RNA extraction. S.L. designed the experiment, participant in bioinformatics analysis, and wrote the manuscript. All authors have read and approved the version of manuscript

Competing Interests

The authors declare no competing interests.

Footnotes

Electronic supplementary material

Supplementary information accompanies this paper at 10.1038/s41598-018-25315-w.

Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

References

  • 1.Cheng TO. Danshen a popular chinese cardiac herbal drug. J. Am. Coll. Cardiol. 2006;47:1487–1501. doi: 10.1016/j.jacc.2006.01.001. [DOI] [PubMed] [Google Scholar]
  • 2.Ma Y, et al. Genome-wide identification and characterization of novel genes involved in terpenoid biosynthesis in Salvia miltiorrhiza. J. Exp. Bot. 2012;63:2809–2823. doi: 10.1093/jxb/err466. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Shao F, Qiu D, Lu S. Comparative analysis of the Dicer-like gene family reveals loss of miR162 target site in SmDCL1 from Salvia miltiorrhiza. Scientific Reports. 2015;5:9891. doi: 10.1038/srep09891. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Ji AJ, et al. Genome-wide identification of the AP2/ERF gene family involved in active constituent biosynthesis in Salvia miltiorrhiza. Plant. Genome. 2016;9:1–11. doi: 10.3835/plantgenome2015.08.0077. [DOI] [PubMed] [Google Scholar]
  • 5.Song JY, et al. Salvia miltiorrhiza as medicinal model plant. Yao Xue Xue Bao. 2013;48:1099–1106. [PubMed] [Google Scholar]
  • 6.Zhang G, et al. Hybrid de novo genome assembly of the Chinese herbal plant danshen (Salvia miltiorrhiza Bunge) GigaScience. 2015;4:62. doi: 10.1186/s13742-015-0104-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Xu H, et al. Analysis of the genome sequence of the medicinal plant Salvia miltiorrhiza. Molecular Plant. 2016;6:949–952. doi: 10.1016/j.molp.2016.03.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Zhang H, Zhu JK. Active DNA demethylation in plants and animals. Cold Spring Harb Symp. Quant. Biol. 2012;77:161–173. doi: 10.1101/sqb.2012.77.014936. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Bala Tannan N, et al. DNA methylation profiling in X;autosome translocations supports a role for L1 repeats in the spread of X chromosome inactivation. Hum. Mol. Genet. 2014;23:1224–1236. doi: 10.1093/hmg/ddt553. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Fu Y, et al. Mobilization of a plant transposon by expression of the transposon-encoded anti-silencing factor. EMBO J. 2013;32:2407–2417. doi: 10.1038/emboj.2013.169. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Chan SW, Henderson IR, Jacobsen SE. Gardening the genome: DNA methylation in Arabidopsis thaliana. Nat. Rev. Genet. 2005;6:351–360. doi: 10.1038/nrg1601. [DOI] [PubMed] [Google Scholar]
  • 12.Bird AP, Wolffe AP. Methylation-induced repression— belts, braces, and chromatin. Cell. 1999;99:451–454. doi: 10.1016/S0092-8674(00)81532-9. [DOI] [PubMed] [Google Scholar]
  • 13.Macdonald WA. Epigenetic mechanisms of genomic imprinting: common themes in the regulation of imprinted regions in mammals, plants, and insects. Genet Res Int. 2012;2012:585024. doi: 10.1155/2012/585024. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Cedar H, Bergman Y. Linking DNA methylation and histone modification: patterns and paradigms. Nat Rev Genet. 2009;10:295–304. doi: 10.1038/nrg2540. [DOI] [PubMed] [Google Scholar]
  • 15.Dunoyer P, et al. An endogenous, systemic RNAi pathway in plants. EMBO J. 2010;29:1699–1712. doi: 10.1038/emboj.2010.65. [DOI] [PMC free article] [PubMed] [Google Scholar] [Retracted]
  • 16.Law JA, Jacobsen SE. Establishing, maintaining and modifying DNA methylation patterns in plants and animals. Nat Rev Genet. 2010;11:204–220. doi: 10.1038/nrg2719. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Finnegan EJ, Kovac KA. Plant DNA methyltransferases. Plant Mol. Biol. 2000;43:189–201. doi: 10.1023/A:1006427226972. [DOI] [PubMed] [Google Scholar]
  • 18.Lindroth AM, et al. Requirement of CHROMOMETHYLASE3 for maintenance of CpXpG methylation. Science. 2001;292:2077–2080. doi: 10.1126/science.1059745. [DOI] [PubMed] [Google Scholar]
  • 19.Wassenegger M, Matzke MA, Matzke AJM. RNA-directed DNA methylation. Plant Mol. Biol. 2000;43:203–220. doi: 10.1023/A:1006479327881. [DOI] [PubMed] [Google Scholar]
  • 20.Hsieh TF, et al. Genome-wide demethylation of Arabidopsis endosperm. Science. 2009;324:1451–1454. doi: 10.1126/science.1172417. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.La H, et al. A 5-methylcytosine DNA glycosylase/lyase demethylates the retrotransposon Tos17 and promotes its transposition in rice. Proc. Natl. Acad. Sci. USA. 2011;108:15498–15503. doi: 10.1073/pnas.1112704108. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Mok YG, et al. Domain structure of the DEMETER 5-methylcytosine DNA glycosylase. Proc. Natl. Acad. Sci. USA. 2010;107:19225–19230. doi: 10.1073/pnas.1014348107. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Penterman J, et al. DNA demethylation in the Arabidopsis genome. Proc. Natl. Acad. Sci. USA. 2007;104:6752–6757. doi: 10.1073/pnas.0701861104. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Zemach A, et al. Local DNA hypomethylation activates genes in rice endosperm. Proc. Natl. Acad. Sci. USA. 2010;107:18729–18734. doi: 10.1073/pnas.1009695107. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Ibarra CA, et al. Active DNA demethylation in plant companion cells reinforces transposon methylation in gametes. Science. 2012;337:1360–1364. doi: 10.1126/science.1224839. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Yu A, et al. Dynamics and biological relevance of DNA demethylation in Arabidopsis antibacterial defense. Proc. Natl. Acad. Sci. USA. 2013;110:2389–2394. doi: 10.1073/pnas.1211757110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Bharti P, Mahajan M, Vishwakarma AK, Bhardwaj J, Yadav SK. AtROS1 overexpression provides evidence for epigenetic regulation of genes encoding enzymes of flavonoid biosynthesis and antioxidant pathways during salt stress in transgenic tobacco. J. Exp. Bot. 2015;66:5959–5969. doi: 10.1093/jxb/erv304. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Choi Y, et al. DEMETER, a DNA Glycosylase domain protein, is required for endosperm gene imprinting and seed viability in Arabidopsis. Cell. 2002;110:33–42. doi: 10.1016/S0092-8674(02)00807-3. [DOI] [PubMed] [Google Scholar]
  • 29.Kinoshita T, et al. One-way control of FWA imprinting in Arabidopsis endosperm by DNA methylation. Science. 2004;303:521–523. doi: 10.1126/science.1089835. [DOI] [PubMed] [Google Scholar]
  • 30.Gehring M, et al. DEMETER DNA glycosylase establishes MEDEA polycomb gene self-imprinting by allele-specific demethylation. Cell. 2006;124:495–506. doi: 10.1016/j.cell.2005.12.034. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Ortega-Galisteo AP, Morales-Ruiz T, Ariza RR, Roldán-Arjona T. Arabidopsis DEMETER-LIKE proteins DML2 and DML3 are required for appropriate distribution of DNA methylation marks. Plant Mol. Biol. 2008;67:671–681. doi: 10.1007/s11103-008-9346-0. [DOI] [PubMed] [Google Scholar]
  • 32.Gong Z, et al. ROS1, a repressor of transcriptional gene silencing in Arabidopsis, encodes a DNA glycosylase/lyase. Cell. 2002;111:803–814. doi: 10.1016/S0092-8674(02)01133-9. [DOI] [PubMed] [Google Scholar]
  • 33.Ono A, et al. A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny. Plant J. 2012;71:564–574. doi: 10.1111/j.1365-313X.2012.05009.x. [DOI] [PubMed] [Google Scholar]
  • 34.Burge CB, Karlin S. Finding the genes in genomic DNA. Curr. Opin. Struct. Biol. 1998;8:346–354. doi: 10.1016/S0959-440X(98)80069-9. [DOI] [PubMed] [Google Scholar]
  • 35.Thibaudnissen F, Ouyang S, Buell CR. Identification and characterization of pseudogenes in the rice gene complement. BMC Genomics. 2009;10:317. doi: 10.1186/1471-2164-10-317. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Agius F, Kapoor A, Zhu JK. Role of the Arabidopsis DNA glycosylase/lyase ROS1 in active DNA demethylation. Proc. Natl. Acad. Sci. USA. 2006;103:11796–11801. doi: 10.1073/pnas.0603563103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Liu R, et al. A DEMETER-like DNA demethylase governs tomato fruit ripening. Proc. Natl. Acad. Sci. USA. 2015;112:10804–10809. doi: 10.1073/pnas.1503362112. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Prade VM, et al. The Pseudogenes of Barley. Plant J. 2018;93:502–514. doi: 10.1111/tpj.13794. [DOI] [PubMed] [Google Scholar]
  • 39.Trapnell C, et al. Differential gene and transcript expression analysis of RNA-seq experiments with TopHat and Cufflinks. Nat. Protoc. 2012;7:562–578. doi: 10.1038/nprot.2012.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Mittelsten Scheid O, Williams BP, Pignatta D, Henikoff S, Gehring M. Methylation-sensitive expression of a DNA demethylase gene serves as an epigenetic rheostat. PLoS genetics. 2015;11:e1005142. doi: 10.1371/journal.pgen.1005142. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Sunkar R, Zhu JK. Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis. Plant Cell. 2004;16:2001–2019. doi: 10.1105/tpc.104.022830. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Kim JY, Kwak KJ, Jung HJ, Lee HJ, Kang H. MicroRNA402 affects seed germination of Arabidopsis thaliana under stress conditions via targeting DEMETER-LIKE protein3 mRNA. Plant Cell Physiol. 2010;51:1079–1083. doi: 10.1093/pcp/pcq072. [DOI] [PubMed] [Google Scholar]
  • 43.Baksa I, et al. Identification of Nicotiana benthamiana microRNAs and their targets using high throughput sequencing and degradome analysis. BMC Genomics. 2015;16:1–21. doi: 10.1186/s12864-015-2209-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Dai X, Zhao P. X. psRNATarget: a plant small RNA target analysis server. Nucleic Acids Res. 2011;39:W155–W159. doi: 10.1093/nar/gkr319. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Xu X, et al. Deep sequencing identifies tissue-specific microRNAs and their target genes involving in the biosynthesis of tanshinones in Salvia miltiorrhiza. PloS one. 2014;9:e111679. doi: 10.1371/journal.pone.0111679. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Li MJ, et al. Transcriptome/degradome-wide identification of R. glutinosa miRNAs and their targets: the role of miRNA activity in the replanting disease. PloS one. 2013;8:e68531. doi: 10.1371/journal.pone.0068531. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Lu S, et al. Novel and mechanical stress responsive microRNAs in Populus trichocarpa that are absent from Arabidopsis. Plant Cell. 2005;17:2186–2203. doi: 10.1105/tpc.105.033456. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Rhoades MW, et al. Prediction of plant microRNA targets. Cell. 2002;110:513–520. doi: 10.1016/S0092-8674(02)00863-2. [DOI] [PubMed] [Google Scholar]
  • 49.Schwab R, et al. Specific effects of microRNAs on the plant transcriptome. Dev. Cell. 2005;8:517–527. doi: 10.1016/j.devcel.2005.01.018. [DOI] [PubMed] [Google Scholar]
  • 50.Wu FY, et al. Transcriptome analysis explores genes related to shikonin biosynthesis in Lithospermeae plants and provides insights into Boraginales’ evolutionary history. Scientific Reports. 2017;7:4477. doi: 10.1038/s41598-017-04750-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Zhou L, Zuo Z, Chow MS. Danshen: an overview of its chemistry, pharmacology, pharmacokinetics, and clinical use. J. Clin. Pharmacol. 2005;45:1345–1359. doi: 10.1177/0091270005282630. [DOI] [PubMed] [Google Scholar]
  • 52.Yang H, Han L, Sheng T, He Q, Liang J. Effects of Replenishing Qi, promoting blood circulation and resolving phlegm on vascular endothelial function and blood coagulation system in senile patients with hyperlipemia. J. Tradit. Chin. Med. 2006;26:120–124. [PubMed] [Google Scholar]
  • 53.Cui G, et al. Functional divergence of diterpene syntheses in the medicinal plant Salvia miltiorrhiza. Plant Physiol. 2015;169:1607–1618. doi: 10.1104/pp.15.00695. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Xu Z, et al. Full-length transcriptome sequences and splice variants obtained by a combination of sequencing platforms applied to different root tissues of Salvia miltiorrhiza and tanshinone biosynthesis. Plant J. 2015;82:951–961. doi: 10.1111/tpj.12865. [DOI] [PubMed] [Google Scholar]
  • 55.Cao D, et al. Genome-wide identification of cytosine-5 DNA methyltransferases and demethylases in Solanum lycopersicum. Gene. 2014;550:230–237. doi: 10.1016/j.gene.2014.08.034. [DOI] [PubMed] [Google Scholar]
  • 56.Xu W, Yang T, Dong X, Li DZ, Liu A. Genomic DNA methylation analyses reveal the distinct profiles in castor bean seeds with persistent endosperms. Plant Physiol. 2016;171:1242–1258. doi: 10.1104/pp.16.00056. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Jia Y, et al. Loss of RNA–Dependent RNA Polymerase 2 (RDR2) function causes widespread and unexpected changes in the expression of transposons, genes, and 24-nt small RNAs. PLoS genetics. 2009;5:e1000737. doi: 10.1371/journal.pgen.1000737. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Madzima TF, Huang J, Mcginnis KM. Chromatin structure and gene expression changes associated with loss of MOP1 activity in Zea mays. Epigenetics. 2014;9:1047–1059. doi: 10.4161/epi.29022. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Cao X, Jacobsen SE. Role of the Arabidopsis DRM methyltransferases in de novo DNA methylation and gene silencing. Curr. Biol. 2002;12:1138–1144. doi: 10.1016/S0960-9822(02)00925-9. [DOI] [PubMed] [Google Scholar]
  • 60.Lei M, et al. Regulatory link between DNA methylation and active demethylation in. Arabidopsis. Proc. Natl. Acad. Sci. USA. 2015;112:3553–3557. doi: 10.1073/pnas.1502279112. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Kidner CA, Martienssen RA. The developmental role of microRNA in plants. Curr. Opin. Plant Biol. 2005;8:38–44. doi: 10.1016/j.pbi.2004.11.008. [DOI] [PubMed] [Google Scholar]
  • 62.Zhang L, et al. Genome-wide analysis and molecular dissection of the SPL gene family in Salvia miltiorrhiza. J. Integr. Plant Biol. 2014;56:38–50. doi: 10.1111/jipb.12111. [DOI] [PubMed] [Google Scholar]
  • 63.Shao F, Lu S. Genome-wide identification, molecular cloning, expression profiling and posttranscriptional regulation analysis of the Argonaute gene family in Salvia miltiorrhiza, an emerging model medicinal plant. BMC Genomics. 2013;14:512. doi: 10.1186/1471-2164-14-512. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Li C, Lu S. Genome-wide characterization and comparative analysis of R2R3-MYB transcription factors shows the complexity of MYB-associated regulatory networks in Salvia miltiorrhiza. BMC Genomics. 2014;15:1–12. doi: 10.1186/1471-2164-15-277. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Zhang H, et al. Identification and characterization of Salvia miltiorrhizain miRNAs in response to replanting disease. PloS One. 2016;11:e0159905. doi: 10.1371/journal.pone.0159905. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Voinnet O. Origin biogenesis and activity of plant microRNAs. Cell. 2009;136:669–687. doi: 10.1016/j.cell.2009.01.046. [DOI] [PubMed] [Google Scholar]
  • 67.Ha M, Kim VN. Regulation of microRNA biogenesis. Nat. Rev. Mol. Cell Biol. 2014;15:509–524. doi: 10.1038/nrm3838. [DOI] [PubMed] [Google Scholar]
  • 68.Zhang H, Xia R, Meyers BC, Walbot V. Evolution, functions, and mysteries of plant ARGONAUTE proteins. Curr. Opin. Plant Biol. 2015;27:84–90. doi: 10.1016/j.pbi.2015.06.011. [DOI] [PubMed] [Google Scholar]
  • 69.Fahlgren N, et al. High-throughput sequencing of Arabidopsis microRNAs: evidence for frequent birth and death of MIRNA genes. PloS One. 2007;2:e219. doi: 10.1371/journal.pone.0000219. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Meyers BC, et al. Criteria for annotation of plant microRNAs. Plant Cell. 2008;20:3186–3190. doi: 10.1105/tpc.108.064311. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Skoog F, Murashige T. A revised medium for rapid growth and bioassays with tobacco tissue culture. Physiologia plantarum. 1962;15:473–497. doi: 10.1111/j.1399-3054.1962.tb08052.x. [DOI] [Google Scholar]
  • 72.Altschul SF, et al. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 1997;25:3389–3402. doi: 10.1093/nar/25.17.3389. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73.Kumar S, Stecher G, Tamura K. MEGA7: Molecular Evolutionary Genetics Analysis version 7.0 for bigger datasets. Molecular Biology and Evolution. 2016;33:1870–1874. doi: 10.1093/molbev/msw054. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.Rozas J, Rozas R. DnaSP, DNA sequence polymorphism: an interactive program for estimating population genetics parameters from DNA sequence data. Comput. Appl. Biosci. 1995;11:621–625. doi: 10.1093/bioinformatics/11.6.621. [DOI] [PubMed] [Google Scholar]
  • 75.Livak KJ, Schmittgen TD. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C(T)) Method. Methods. 2001;25:402–408. doi: 10.1006/meth.2001.1262. [DOI] [PubMed] [Google Scholar]
  • 76.Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human genome. Genome Biol. 2009;10:R25. doi: 10.1186/gb-2009-10-3-r25. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77.Zuker M. Mfold web server for nucleic acid folding and hybridization prediction. Nucleic Acids Res. 2003;31:3406–3415. doi: 10.1093/nar/gkg595. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES