Skip to main content
PMC home page
Food Science and Biotechnology logoLink to Food Science and Biotechnology
. 2018 Jul 6;27(6):1781–1789. doi: 10.1007/s10068-018-0423-0

Antihypertensive peptides from whey proteins fermented by lactic acid bacteria

Eric Banan-Mwine Daliri 1, Byong H Lee 1,2, Byun-Jae Park 1, Se-Hun Kim 1, Deog-Hwan Oh 1,✉
PMCID: PMC6233406  PMID: 30483443

Abstract

In this study, whey proteins were fermented with 34 lactic acid bacteria for 48 h at 37 °C and their ability to inhibit angiotensin 1-converting enzyme (ACE) activity were compared. All the lactic acid bacteria displayed varying proteolytic abilities in whey. Their fermentates also displayed varying abilities to inhibit ACE in vitro. Seven fermentates showed strong ACE inhibitory abilities between 84.70 ± 0.67 and 52.40 ± 2.1% with IC50 values between 19.78 ± 1.73 and 2.13 ± 0.7 mg/ml. Pediococcus acidilactici SDL1414 showed the strongest ACE inhibitory activity of 84.7 ± 0.67% (IC50 = 19.78 ± 1.73 μg/ml). Mass spectrometry revealed that more than half (57.7%) of the low molecular weight peptides (< 7 kDa) in the P. acidilactici SDL1414 fermented samples were ACE inhibitory peptides. Our results show that P. acidilactici SDL1414 could be used as a starter culture in the dairy industry to develop antihypertensive functional foods for hypertension management.

Keywords: Fermentates, Angiotensin1-converting enzyme, Bioactive peptides

Introduction

Food proteins usually contain several biologically active peptides. However, these peptides remain inactive as long as they remain bonded to other amino acids in the primary structure (Daliri et al., 2017a). Once released through enzymatic proteolysis and/or microbial fermentation, the free forms of the peptides demonstrate health effects in the gut or after systemic absorption into blood circulation. Several bioactive peptides have been reported to lower blood sugar, serum cholesterol, high blood pressure and inhibit microbial and cancer growth (Sánchez and Vázquez, 2017). Existing synthetic antihypertensive drugs have numerous side effects and this has increased scientific interest in searching for antihypertensive peptides as alternative therapeutics to control systemic blood pressure and to prevent cardiovascular diseases (Daliri et al., 2017b). One important enzyme involved in blood pressure regulation is angiotensin I-converting enzyme (ACE). The enzyme is a transmembrane metallopeptidase found in biological fluids and in many tissues such as the lung, thoracic aorta, heart, kidney, and liver (Nakamura et al., 2013). The enzyme hydrolyzes angiotensin I (a decapeptide) to yield angiotensin II (an octapeptide) which binds to AT1 receptors on vascular smooth muscles and endothelial cells leading to vasoconstriction. Angiotensin II also inactivates the endothelium-dependent vasodilator bradykinin (a nanopeptide) and this leads to high blood pressure (Manzanares et al., 2015). Therefore, inhibition of ACE activity is a good target for antihypertensive agents. Whey proteins such as beta-lactoglobulin, alpha-lactalbumin, bovine serum albumin, and immunoglobulin exhibit diverse physiological functions and their hydrolysates have been shown to have ACE inhibitory activities (Ibrahim et al., 2017). For instance the fragment 208–216 sequence of serum albumin, fragments 102–105 and f146–149 sequences of β-lactoglobulin and also fragments 50–53 sequences of α-lactalbumin have ACE inhibitory properties (Ahn et al., 2009; Tavares et al., 2011). Many lactic acid bacteria (LAB) have been shown to degrade milk proteins to release bioactive peptides during diary fermentation. Such bacteria contain well developed proteolytic systems that break down proteins in the growth media into short amino acid chains (Daliri et al., 2017c). Given the proteolytic nature of LAB such as Lactobacillus acidophilus, L. brevis, Lactobacillus animalis and Lactococcus lactis, their use as microbial catalysts for producing ACE inhibitory peptides have been well documented (Brzozowski and Lewandowska, 2014; Hayes et al., 2007). Lactobacillus helveticus CP790 and Saccharomyces cerevisiae have been used as mixed cultures to produce potent ACE inhibitors such as Val-Pro-Pro and Ile-Pro-Pro from casein (Nakamura et al., 1995). Consuming milk containing the peptides effectively reduced high blood pressure in antihypertensive patients (Jauhiainen et al., 2010).

In this study we investigated the in vitro ACE inhibitory activity of 34 lactic acid bacteria during whey fermentation. Whey fermentates with the strongest ACE inhibition was analyzed by liquid chromatography-electrospray ionization-quantitative time-of-flight tandem mass spectrometry to identify the biopeptides that might have been involved in the inhibition.

Materials and methods

Chemicals and cultures

Unless specified, all chemical reagents were of analytical grade and were obtained from Sigma-Aldrich, South Korea. N-Hippuryl-His-Leu hydrate powder, ≥ 98% (HHL), ACE from rabbit lung, Phe-Gly, O-phthaldialdehyde (OPA), sodium tetraborate, sodium dodecyl sulfate, and whey from bovine milk (spray-dried) were purchased. Thirty-four lactic acid bacteria strains namely Pediococcus pentosaceus SDL1416, Pediococcus acidilactici SDL1405, Enterococcus lactis SCL1421, Lactobacillus plantarum JDFM44, Weissella confusa SCSB2320, Lactobacillus rhamnosus JDFM6, Pediococcus acidilactici SDL1414, Enterococcus faecalis MAD13, Streptococcus thermophilus SCML300, Pediococcus pentosaceus SDL1415, Lactobacillus rhamnosus JDFM33, Streptococcus thermophilus SCML337, Pediococcus pentosaceus SDL1409, Pediococcus pentosaceus SDL1401, Pediococcus acidilactici SDL1406, Leuconostoc mesenteroides JBNU10, Leuconostoc citreum SC53, Pediococcus acidilactici SKL1418, Lactobacillus pentosus SC48, Enterococcus faecium CK5, Pediococcus pentosaceus MAC11, Leuconostoc paramesenteroides SC46, Weissella koreensis JBNU2, Lactobacillus curvatus JBNU38, Weissella confusa SCKB2318, Enterococcus faecium SC54, Lactobacillus brevis SDL1411, Lactobacillus brevis SDL1408, Pediococcus acidilactici SCL1420, Lactobacillus plantarum SDL1413, Weissella cibaria SCCB2306, Lactobacillus arizonensis SC25, Pediococcus acidilactici DN9 and Pediococcus acidilactici SDL1402 were obtained from Soonchang Jang Ryu Saupso Company-Korea. Stock cultures were maintained at − 80 °C in de Man, Rogosa and Sharpe broth (MRS, MBCell-Korea), containing 20% (v/v) glycerol. Cultures were streaked on MRS agar and cultured at 37 °C for 24 h. Single colonies were then transferred into MRS broth at 37 °C and harvested at the exponential phase of growth. The viable bacterial count was determined by plate count on MRS agar. The basal growth medium for the lactic acid bacteria consisted of 2% (w/v) reconstituted whey powder in distilled water, supplemented with 1% glucose and 0.5% yeast extract (Becton–Dickinson Co., Cockeysville, MD). Whey powder was composed of 11% protein. The whey-based growth media were autoclaved at 121 °C for 15 min prior to inoculation with lactic acid bacteria.

Cultivation of lactic acid bacteria in whey media

To grow the lactic acid bacteria in whey-based growth media, 2 × 108 cfu/ml of each strain in the 24 h MRS broth at 37 °C were inoculated into 500 mL Erlenmeyer flask containing 200 ml of whey medium (pH 6). Cultivation was carried out at 37 °C with 150 rpm of agitation. After growth for 48 h, the media was centrifuged (10,000×g; 10 min) to remove precipitates. The supernatant (hydrolysate) was freeze-dried using TFD5505 table top freeze dryer (ilshinBioBase Co. Ltd, South Korea) and the freeze-dried samples were stored at − 80 °C for further analysis.

Determination of degree of protein hydrolysis

The degree of whey protein hydrolysis was carried out as reported earlier (Church et al., 1983). In brief, O-phthaldialdehyde (OPA) solution containing 40 mg of OPA dissolved in 1 ml of methanol, 100 ml of β-mercaptoethanol solution, 25 ml of 100 mM sodium tetraborate and 2.5 ml of 20% (w/w) sodium dodecyl sulfate (Sigma), was diluted to a final volume of 50 ml with water. The freeze-dried samples (5 mg/ml) were incubated with 1 ml OPA for 2 min at room temperature (~ 28 °C) and absorbance at 340 nm was measured. The amount of peptide liberated during the fermentation process was calculated using Phe-Gly as a standard.

Recovery of low molecular weight peptides (< 7000 Da)

The hydrolysate (700 mg) was dissolved in 2 ml distilled water and dialyzed against water using a 7000 Da molecular weight cut-off dialysis bag (Viskase Corporation, Chicago, Illinois) for 48 h to recover low molecular weight peptides. We chose this molecular cut-off because most reported ACE inhibitory peptides are less than 10 kDa (Abdel-Hamid et al., 2017; Georgalaki et al., 2017). After discarding the retentates, the dialysates (permeates) were freeze-dried. The protein concentrations were determined using Bradford reagent according to the manufacturer’s instructions.

In-vitro assay for ACE inhibitory activity

ACE inhibitory activity was measured by the procedures summarized in Table 1 (Cushman and Cheung, 1971). Briefly, 20 μl of the ACE inhibitor (LMW peptides) solution was mixed with 50 μl of 5 mM HHL in 100 mM sodium borate buffer (pH 8.3) containing 0.3 M NaCl and incubated at 37 °C for 5 min. The reaction was initiated by adding 10 μl of 0.1 U/ml ACE solution and the mixture was incubated at 37 °C for 30 min. The reaction was stopped by adding 100 μl of 1 M HCl and the reaction mixture was mixed with 1.0 ml of ethyl acetate. The mixture was vortexed for 60 s and centrifuged at 2000 × g for 5 min. An aliquot (800 µl) of ethyl acetate layer was transferred to a clean tube and evaporated on a water bath. Distilled water (800 µl) was then added to dissolve the hippuric acid (HA) remaining in the tube and the amount of HA formed was measured at 228 nm using a biospectrometer (Eppendorf Biospectrometer® fluorescence). The amount of HA liberated from HHL under this reaction conditions without an inhibitor was used as control. The extent of inhibition was calculated as 100% × [(B − A/B)] where A is the optical density (OD) in the presence of ACE and ACE inhibitory component, B is the OD without ACE inhibitor. For the determination of IC50, series of dilutions containing 5000, 500, 50, 5, 0.5, and 0.05 μg/ml of the peptides were prepared. The amount of peptides required to suppress 50% ACE activity was calculated from the regression curves observed for each fraction.

Table 1.

Procedure for assay of ACE inhibitory activity

Blank/μL Control/μL Test/μL
ACE 10 0 0
HCL 100 0 0
HHL (substrate) 50 50 50
ACE inhibitor 20 0 20
Buffer 0 20 0
Incubation at 37° for 5 min
 ACE 0 10 10
Incubation at 37° for 30 min
 HCL 100 100
 Ethyl acetate 1000 1000 1000
Open in a new tab

Identification of peptides by mass spectrometry

The peptide profile of the samples fermented with P. acidilactici SDL 1414 was determined using Liquid chromatography-electrospray ionization-quantitative time-of-flight tandem mass spectrometry experiments (LC-ESI-TOF–MS/MS). This fermentate was chosen for further analysis because it showed the lowest IC50 (highest potency). LC-ESI-TOF–MS/MS was performed at the National Instrumentation Center for Environmental Management of Seoul National University-Korea, using a method already described (Chang et al., 2014). Mass spectrometry was carried out using an integrated system comprising an autosampler (TempoTM nano LC system; MDS SCIEX, Canada), an auto-switching nano pumpand a hybrid quadrupole-time-of-flight (TOF) mass spectrometer (QStar Elite; Applied Biosystems, USA) with a fused silica emitter tip (New Objective, USA). Nano-electrospray ionization (ESI) was applied for sample ionization. The sample (2 μl) was injected into the LC-nano ESI–MS/MS system. The sample was initially trapped on a ZORBAX 300SB-C18 trap column (300-μm i.d × 5 mm, 5-μm particle size, 100 pore size, Agilent Technologies, part number 5065-9913) and washed for 6 min with gradient with 98% solvent A and 2% solvent B at a flow rate of 5 μL/min. Solvents A and B consisted of [water/acetonitrile (98:2, v/v), 0.1% formic acid] and [Water/acetonitrile (2:98, v/v), 0.1% formic acid] respectively. Separation was carried out using a ZORBAX 300SB-C18 capillary column (75-μm i.d × 150 mm, 3.5 μm particle size, 100 pore size, part number 5065-9911) at a flow rate of 300 nl/min with gradient at 2 to 35% solvent B over 30 min, then from 35 to 90% over 10 min, followed by 90% solvent B for 5 min, and finally 5% solvent B for 15 min. Electrospray was performed through a coated silica tip (FS360-20-10-N20-C12, PicoTip emitter, New Objective) at an ion spray voltage of 2000 eV. Using Analyst QS 2.0 software (Applied Biosystems, USA), the peptides were analyzed automatically. The range of m/z values was 200-2000.

Statistical analysis

All experiments were carried out in triplicates and the results were expressed as the mean ± standard deviation. The statistical analysis of data was performed using GraphPad Prism 5.0 (2007) statistical software system (GraphPad Software Inc. CA 92037 USA). P < 0.05 was considered significant.

Results and discussion

Degree of whey hydrolysis by lactic acid bacteria

The degree of whey protein hydrolysis by each of the 34 LAB was tested after fermentation for 48 h. LAB require exogenous amino acids for growth and they derive these amino acids from the protein substrates in which they are cultured. They do this by hydrolyzing proteins into oligopeptides using their cell-enveloped proteinase (Liu et al., 2010). Specific peptide transport systems then transport the oligopeptides into the cells where they are hydrolyzed into amino acids by various intracellular peptidases (Daliri et al., 2017c). All the LAB in this study showed varying abilities to hydrolyze whey (Fig. 1) and this agrees with earlier reports that showed that LAB protein digestion is strain dependent (Bounouala et al. 2017). We observed that L. plantarum JDFM44 showed the highest ability to hydrolyze whey proteins followed by L. plantarum SDL1413 (Fig. 1). This could be due to the release of large amounts of exopeptidases which hydrolyzed N-terminal amino acids from the proteins during the fermentation process. Ent. faecium CK-5, P. pentosaceus SDL1401, L. pentosus SC48 and P. acidilactici SDL1414 also showed > 50% degree of hydrolysis while the remaining strains showed low degrees of hydrolysis during the fermentation process.

Fig. 1.

Fig. 1

Open in a new tab

The degree of whey hydrolysis by 34 lactic acid bacteria after 48 h fermentation at 37 °C. Degree of hydrolysis is mean ± SEM of three independent experiments. Bars with different alphabets are significantly different (p < 0.05). Legend: 1—L. rhamnosus JDFM6; 2—P. Pentosaceus SDL1415; 3—P. Pentosaceus SDL1416; 4—L. rhamnosus JDFM33; 5—E. lactis SCL1421; 6—P. acidilacti SDL1405; 7—W. confusa SCSB2320; 8—P. acidilactici SDL1414; 9—S. thermophillus SCML300; 10—Ent. Faecalis MAD13; 11—L. planterum JDFM44; 12—Ent. fecium SC54; 13—P. acidilactici SCL1420; 14—W. koreensis JBNU2; 15—L. pentosus SC48; 16—Leu. paramesenteroides SC46; 17—P. acidilactici SKL1418; 18—L. brevis SDL1408; 19—L. brevis SDL1411; 20—W. confusa SCKB2318; 21—L. curvatus JBNU38; 22—Ent. fecium CK5; 23—S. thermophilus SCML337; 24—L. plantarum SDL1413; 25—L. arizonensis SC27; 26—L. pentosaceus SDL1409; 27—L. pentosus SDL1401; 28—P. acidilactici SDL1406; 29—Leu. mesenteroides JBNU10; 30—W. cibaria SCCB2306; 31—P. pentosaceus SDL1416; 32—P. acidilactici DM9; 33—P. pentosaceus MAC11; 34—L. citrium SC53

Determination of in vitro ACE inhibitory (ACEI) activity in low molecular weight (LMW) peptides

All the fermentates showed varying ACEI ability (data not shown) however, the fermentates that had ≥ 50% is shown in Table 2 and their IC50 were determined. When LMW peptides (< 7 kDa) were recovered from these samples, 17 fermentates had ACEI ability (data not shown). LMW peptides from P. acidilactici SDL1414 fermentation showed the strongest in vitro ACEI activity of 84.7 ± 0.67 with an IC50 value of 19.78 ± 1.73 μg/ml (Table 2). Captopril (a synthetic ACEI compound) showed an inhibition of 90.82 ± 10.3 and an IC50 value of 5 ± 0.1 μg/ml. Interestingly, we did not find any correlation between the degree of hydrolysis and ACE inhibitory potency. Since LMW peptides from P. acidilactici SDL 1414 fermentation showed the highest ACE inhibition, they were chosen for further studies using LC–ESI–MS/MS to identify the antihypertensive peptides generated during the fermentation process.

Table 2.

ACE-inhibitory activities in the low-molecular-weight fraction (< 7 kDa) of whey fermentates by lactic acid bacteria

Samples ACEI (%) aIC50 (μg/mL)
P. acidilactici SDL1414 84.70 ± 0.67 19.78 ± 1.73
L. plantarum JDFM44 84.00 ± 1.05 65.53 ± 7.99
Ent. faecium SC54 55.40 ± 1.73 70.50 ± 11.2
P. acidilactici DM9 54.90 ± 0.90 96.70 ± 20.86
L. berevis SDL1411 79.03 ± 3.40 1280 ± 300
P. pentosaceus SDL1409 72.90 ± 1.60 2070 ± 550
L. rhamnosus JDFM6 52.40 ± 2.10 2130 ± 700
Captopril (control) 90.82 ± 10.30 5.0 ± 0.10
Open in a new tab

aConcentration of peptide needed to inhibit 50% of original ACE activity. The data in this table represent samples that showed ACEI ability ≥ 50% out of 34 fermented samples

Peptides generated from whey during fermentation by Pediococcus acidilactici SDL1414

LC-ESI-TOF–MS/MS analysis of the LMW peptide profile showed that the peptides were generated from casein, beta lactoglobulin, lactophorin, polymeric immunoglobulin receptor and uncharacterized protein GP2 (Table 3). This indicates that P. acidilactici SDL1414 has the ability to hydrolyze different substrates present in the media relative to other lactic acid bacteria such as Bifidobacterium longum which preferentially hydrolyze only casein (Ha et al., 2015). During the fermentation process, a large number of peptides were generated from the C-terminus of β-CN but the N-terminal was resistant to hydrolysis probably due to the presence of several phosphoserine residues at that region (Kaspari et al., 1996). The resistance of the N-terminal region of β-CN to LAB hydrolysis has also been reported in earlier studies (Ha et al., 2015). Hydrolysis of the C-terminal region on the other hand could be due to its hydrophobic nature which makes it more accessible for hydrolysis (Chang et al., 2014). Other LAB including Lactobacillus helveticus (Griffiths and Tellez, 2013), Lactobacillus delbrueckii subsp. lactis lactis (Tsakalidou et al., 1999), S. thermophilus (Miclo et al., 2012), and Lactobacillus lactis (Juillard et al., 1995) also readily hydrolyze the C-terminal region of β-CN to generate large numbers of peptides during milk fermentation.

Table 3.

Whey-derived peptides identified by LC-ESI-TOF–MS/MS in the LMW peptides (< 7 kDa) fraction of the 48 h whey fermentates of whey by P. acidilactici SDL1414

Protein name Peptide sequence Prec MW Prec m/z Theor MW Theor m/z z
αS1-CN (f10–23) GLPQEVLNENLLRF 1640.9009 821.4577 1640.8885 821.4516 2
(f10–22) GLPQEVLNENLLR 1493.8313 747.9229 1493.8202 747.9174 2
(f1–23) RPKHPIKHQGLPQEVLNENLLRF 3281.7998 821.4572 3286.8779 822.7267 4
(f14-23) EVLNENLLRF 1245.6793 623.8469 1245.6718 623.8431 2
(f10-21) GLPQEVLNENLL 1337.7279 669.8712 1337.7191 669.8668 2
(f24-34) FVAPFPEVFGK 1236.6609 619.3377 1236.6543 619.3344 2
(f25-34) VAPFPEVFGK 1089.5898 545.8022 1089.5859 545.8002 2
(f24-38) FVAPFPEVFGKEKVNEL 1949.0464 650.6894 1949.0299 650.6839 3
(f80-98) HIQKEDVPSERYLGYLEQL  2316.1978  580.0567  2316.175  580.051 4
β-CN (f1-27) RELEELNVPGEIVESL 1823.9845 912.9995 1824.9469 913.4807 2
(f1-25) RELEELNVPGEIVE 1623.8574 812.936 1624.8308 813.4227 2
(f1-22) RELEELNVPGE 1283.6456 642.8301 1283.6357 642.8251 2
(f1-24) RELEELNVPGEIV 1494.8132 748.4139 1494.8042 748.4094 2
(f192-209) LYQEPVLGPVRGPFPIIV 1993.1543 665.392 1993.14 665.3873 3
(f193-209) YQEPVLGPVRGPFPIIV 1880.0715 941.043 1880.056 941.0353 2
(f193-208) YQEPVLGPVRGPFPII 1781.0021 891.5083 1780.9875 891.5011 2
(f194-209) QEPVLGPVRGPFPIIV 1699.9836 850.9991 1699.9662 850.9904 2
(f195-209) EPVLGPVRGPFPIIV 1588.9463 795.4804 1588.9341 795.4743 2
(f83-95) VVPPFLQPEVMGV 1410.7693 706.3919 1410.7581 706.3864 2
κ-CN (f161-169) TVQVTSTAV 904.49048 453.2525 904.48657 453.2505 2
(f155-169) SPPEINTVQVTSTAV 1541.8065 771.9105 1541.7937 771.9041 2
(f149-169) SPEVIESPPEINTVQVTSTAV 2276.0999 759.7072 2276.0825 759.7014 3
(f151-169) EVIESPPEINTVQVTSTAV 2012.0497 671.6905 2012.0314 671.6844 3
(f159-169) INTVQVTSTAV 1131.6196 566.8171 1131.6135 566.814 2
(f152-169) VIESPPEINTVQVTSTAV 1883.0045 942.5095 1882.9888 942.5016 2
(f150-169) PEVIESPPEINTVQVTSTAV 2109.0984 704.0401 2109.0842 704.0353 3
(f157-169) PEINTVQVTSTAV 1357.7208 679.8677 1357.7089 679.8618 2
(f151-169) EVIESPPEINTVQVTSTAV 2034.0271 679.0163 2034.0133 679.0117 3
(f151-165) EVIESPPEINTVQVT 1653.8649 827.9397 1653.8462 827.9304 2
(f151-163) EVIESPPEINTVQ 1453.7411 727.8778 1453.73 727.8723 2
(f149-162) SPEVIESPPEIN 1309.6481 655.8313 1309.6401 655.8273 2
(f149-163) SPEVIESPPEINTVQ 1717.8009 859.9077 1717.781 859.89 2
(f151-162) EVIESPPEIN 1125.5629 563.7887 1125.5554 563.785 2
(f116-141) MAIPPKKNQDKTEIPTINTIASGEPT 2793.4849 699.3785 2793.4583 699.3718 4
(f109-151)PPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLEDSPE 4523.3027 1131.833 4523.299 1131.81 4
(f106-149)MAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLED 4525.3066 1132.334 4525.263 1132.32 4
β-lg (f130-149) DEALEKFDKALKALPMHIRL 2353.2981 471.6669 2353.2827 471.6638 5
(f130-146) DEALEKFDKALKALPMH 1955.031 489.765 1955.0187 489.7619 4
(f130-145) DEALEKFDKALKALPM 1817.973 606.9983 1817.9597 606.9938 3
(f1-11) LIVTQTMKGLD 1217.6791 609.8468 1217.6689 609.8417 2
(153-162) PTQLEEQCHI 1162.5697 582.2921 1162.5619 582.2882 2
(147-156) IRLSFNPTQL 1187.6759 594.8452 1187.6663 594.8404 2
(f1-11) LIVTQTMKGL 1102.6472 552.3309 1102.642 552.3283 2
(f1-12) LIVTQTMKGLD  1217.6791  609.8468  1217.669  609.842 2
(f153-162) PTQLEEQCHI 1162.5697 582.2921 1162.562 582.288 2
(f147-156) IRLSFNPTQL 1187.6759 594.8452 1187.666 594.84 2
(f1-10) LIVTQTMKGL 1102.6472 552.3309 1102.624 552.328 2
Lactophorin (PP3) (f1-18) ILNKPEDETHLEAQPTDA 2019.999 674.3403 2019.9749 674.3323 3
(f1-17) ILNKPEDETHLEAQPTD 1948.9561 650.6593 1948.9377 650.6532 3
(f57-67) QPQSQNPKLPL 1231.6656 616.8401 1231.6561 616.8353 2
(f54-67) SSRQPQSQNPKLPL  1578.8573 527.293  1578.8478  527.2899  3
PIGR (f383-404) PGRPTGYSGSSKALVSTLVPLA 2157.1958 720.0726 2157.1794 720.0671 3
UP (GP2) (f455-473) SEGVAIDPARVLDLGPITR 1978.1027 660.3748 1978.0847 660.3688 3
Open in a new tab

CN casein, m/z mass to charge ratio, where z number of positively charged ions, Prec precision, Theor theoretical

αS1-CN alpha-S1-casein, κ-CN kappa-casein, β-CN beta-casein, β-lg beta lactoglobulin, PP3 proteose-peptone component 3, UP (GP2) uncharacterized protein GP2; PIGR polymeric immunoglobulin receptor

The N terminus of αS1-CN was also found to be resistant to P. acidilactici SDL1414 hydrolysis and this could also be due to the presence of phosphoserine residues in that region (Ha et al., 2015). The bacterium however readily hydrolyzed the C-terminus of the protein during the fermentation process.

The caseinomacropeptide or glycomacropeptide (f 106-169) segment of κ-CN is composed of glycan chains and has been reported to be resistant to hydrolysis in many studies (Svanborg et al., 2016). The resistance has been attributed to the presence of hydrophilic amino acids and their negative charges which cause increased electrostatic repulsion (Zahraa et al., 2010). However, in the present study, 17 different peptides were obtained from the region (Table 3), 9 of which have bear sequences already reported to have ACE inhibition (Table 4). P. acidilactici SDL1414 fermentation might have induced structural changes in the glycomacropeptide region to allow hydrolysis.

Table 4.

Antihypertensive and potential antihypertensive peptides generated by whey fermentation with P. acidilactici SDL1414 after 48 h at 37 °C compared with ACEI peptides reported in literature

Name ACEI peptides reported in literature Present studya References
αS1-CN (f14-23) EVLNENLLRF (f14-23) EVLNENLLRFb
(f10–23) GLPQEVLNENLLRF
(f10–22) GLPQEVLNENLLR
(f10-21) GLPQEVLNENLL 		Torres-Llanez et al. (2011)
(f23-34) FFVAPFPEVFGK (f24-38) FVAPFPEVFGKEKVNEL
(f24-34) FVAPFPEVFGK
(f25-34) VAPFPEVFGK 		Hayes et al. (2007)
β-CN (f7-16) NVPGEIVESL
(f6-14) LNVPGEIVE
(f2-11) ELEELNVPGE		 (f1-27) RELEELNVPGEIVESL
(f1-25) RELEELNVPGEIVE
(f1-22) RELEELNVPGE
(f1-24) RELEELNVPGEIV 		Hayes et al. (2007) and Jin et al. (2016)
(f74-97) NIPPLTQTPVVVPPFIQPEVMGVSK β-CN (f83-95) VVPPFLQPEVMGV Hayes et al. (2007)
(f191-209) LLYQEPVLGPVRGPFPIIV (f192-209) LYQEPVLGPVRGPFPIIV
(f193-209) YQEPVLGPVRGPFPIIV
(f193-208) YQEPVLGPVRGPFPII
(f194-209) QEPVLGPVRGPFPIIV
(f195-209) EPVLGPVRGPFPIIV 		Jin et al. (2016)
κ-CN (f161-169) TVQVTSTAV
(f64-69) VTSTAV		 (f161-169) TVQVTSTAV
(f155-169) SPPEINTVQVTSTAV
(f149-169) SPEVIESPPEINTVQVTSTAV
(f151-169) EVIESPPEINTVQVTSTAV
(f159-169) INTVQVTSTAV
(f152-169) VIESPPEINTVQVTSTAV
(f150-169) PEVIESPPEINTVQVTSTAV
(f157-169) PEINTVQVTSTAV
(f151-169) EVIESPPEINTVQVTSTAV 		Tavares et al. (2011)
β-lg (f142-148) ALPMHIR (f130-149) DEALEKFDKALKALPMHIRL
(f130-146) DEALEKFDKALKALPMH
(f130-145) DEALEKFDKALKALPM 		Tavares et al. (2011) and Nagpal et al. (2011)
Open in a new tab

aPeptides obtained from whey fermentation in the present study. Segments homologous to previously identified ACEI peptides are in bold letters

bPeptide identified in this study which is identical to a previously identified ACEI peptide

Many ACEI peptides have been reported to be present in whey. LC-ESI-TOF–MS/MS analysis of our low molecular weight peptides showed the presence of 52 different peptides (Table 3). Among these peptides, we identified 1 peptide, αS1-CN (f14-23) EVLNENLLRF, which has already been reported to be an ACE inhibitor (Torres-Llanez et al., 2011). Also, 28 peptides generated in this study had their C-terminal amino acid sequences homologous with previously identified ACEI peptides (Table 4), yet, the complete sequences observed in this study have not been reported before (Kumar et al., 2014; Minkiewicz et al., 2008).

The abundance of antihypertensive segments in these peptides may at least, in part, account for the strong ACE inhibitory activity of the fermentate and the low IC50 (19.78 ± 1.73 μg/ml) observed in this study. Though our ACEI peptides are less potent than captopril (IC50 = 5 μg/ml), natural antihypertensive peptides have high tissue affinities and hence may be more slowly eliminated from tissues compared to synthetic drugs (Koyama et al., 2014). The slow elimination could enhance a more sustained antihypertensive effect in consumers. There is therefore a demand for such bioactive functional ingredients and that warrants this type of research.

The current study shows that P. acidilactici SDL1414 could be used as a starter culture in the dairy industry to develop antihypertensive functional foods. The peptides in the fermentates could also be purified and used as nutraceuticals or supplements to reduce high blood pressure. However, in vivo studies regarding the stability of these peptides against gastrointestinal enzymes as well as their blood pressure lowering ability is warranted.

Acknowledgements

This work was funded by the Ministry of Small and Medium scale Enterprises and Startups. Grant Number C0502529. We also thank the central laboratory of Kangwon National University for their assistance in LC-MS analysis.

Compliance with ethical standards

Conflict of interest

The authors declare that they have no conflict of interest.

References

  1. Abdel-Hamid M, Otte J, De Gobba C, Osman A, Hamad E. Angiotensin I-converting enzyme inhibitory activity and antioxidant capacity of bioactive peptides derived from enzymatic hydrolysis of buffalo milk proteins. Int Dairy J. 2017;66:91–98. doi: 10.1016/j.idairyj.2016.11.006. [DOI] [Google Scholar]
  2. Ahn J, Park S, Atwal A, Gibbs B, Lee B. Angiotensin I-converting enzyme (ACE) inhibitory peptides from whey fermented by Lactobacillus species. J Food Biochem. 2009;33:587–602. doi: 10.1111/j.1745-4514.2009.00239.x. [DOI] [Google Scholar]
  3. Bounouala FZ, Roudj S, Karam N-E, Recio I, Miralles B. Casein hydrolysates by Lactobacillus brevis and Lactococcus lactis proteases. Peptide profile discriminates strain-dependent enzyme specificity. J. Agric. Food Chem. 2017;65:9324–9332. doi: 10.1021/acs.jafc.7b03203. [DOI] [PubMed] [Google Scholar]
  4. Brzozowski B, Lewandowska M. Prolyl endopeptidase-Optimization of medium and culture conditions for enhanced production by Lactobacillus acidophilus. Electron J Biotechnol. 2014;17:204–210. doi: 10.1016/j.ejbt.2014.07.003. [DOI] [Google Scholar]
  5. Chang OK, Roux É, Awussi AA, Miclo L, Jardin J, Jameh N, Dary A, Humbert G, Perrin C. Use of a free form of the Streptococcus thermophilus cell envelope protease PrtS as a tool to produce bioactive peptides. Int Dairy J. 2014;38:104–115. doi: 10.1016/j.idairyj.2014.01.008. [DOI] [Google Scholar]
  6. Church FC, Swaisgood HE, Porter DH, Catignani GL. Spectrophotometric assay using O-phthaldialdehyde for determination of proteolysis in milk and isolated milk proteins. J Dairy Sci. 1983;66:1219–1227. doi: 10.3168/jds.S0022-0302(83)81926-2. [DOI] [Google Scholar]
  7. Cushman D, Cheung H. Spectrophotometric assay and properties of the angiotensin-converting enzyme of rabbit lung. Biochem. Pharmacol. 1971;20:1637–1648. doi: 10.1016/0006-2952(71)90292-9. [DOI] [PubMed] [Google Scholar]
  8. Daliri EB-M, Oh DH, Lee BH. Bioactive peptides. Foods. 2017;6:32–42. doi: 10.3390/foods6050032. [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Daliri EB-M, Lee BH, Oh DH. Current trends and perspectives of bioactive peptides. Crit. Rev. Food. Sci. Nutr. 2017 doi: 10.1080/10408398.2017.1319795. [DOI] [PubMed] [Google Scholar]
  10. Daliri EB-M, Lee BH, Oh DH. Current perspectives on antihypertensive probiotics. Probiotics Antimicro Prot. 2017;9:91–101. doi: 10.1007/s12602-016-9241-y. [DOI] [PubMed] [Google Scholar]
  11. Georgalaki M, Zoumpopoulou G, Mavrogonatou E, Van Driessche G, Alexandraki V, Anastasiou R, Papadelli M, Kazou M, Manolopoulou E, Kletsas D, Devreese B. Evaluation of the antihypertensive angiotensin-converting enzyme inhibitory (ACE-I) activity and other probiotic properties of lactic acid bacteria isolated from traditional Greek dairy products. Int Dairy J. 2017;75:10–21. doi: 10.1016/j.idairyj.2017.07.003. [DOI] [Google Scholar]
  12. Griffiths MW, Tellez AM. Lactobacillus helveticus: the proteolytic system. Front Microbiol. 2013;4:30. doi: 10.3389/fmicb.2013.00030. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Ha GE, Chang OK, Jo S-M, Han G-S, Park B-Y, Ham J-S, Jeong S-G. Identification of antihypertensive peptides derived from low molecular weight casein hydrolysates generated during fermentation by Bifidobacterium longum KACC 91563. Korean J Food Sci Anim Resour. 2015;35:738. doi: 10.5851/kosfa.2015.35.6.738. [DOI] [PMC free article] [PubMed] [Google Scholar]
  14. Hayes M, Stanton C, Slattery H, O’Sullivan O, Hill C, Fitzgerald G, Ross R. Casein fermentate of Lactobacillus animalis DPC6134 contains a range of novel propeptide angiotensin-converting enzyme inhibitors. Appl. Environ. Microbiol. 2007;73:4658–4667. doi: 10.1128/AEM.00096-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  15. Ibrahim HR, Ahmed AS, Miyata T. Novel angiotensin-converting enzyme inhibitory peptides from caseins and whey proteins of goat milk. J. Adv. Res. 2017;8:63–71. doi: 10.1016/j.jare.2016.12.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  16. Jauhiainen T, Rönnback M, Vapaatalo H, Wuolle K, Kautiainen H, Groop P, Korpela R. Long-term intervention with Lactobacillus helveticus fermented milk reduces augmentation index in hypertensive subjects. Eur J Clin Nutr. 2010;64:424–431. doi: 10.1038/ejcn.2010.3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  17. Jin Y, Yu Y, Qi Y, Wang F, Yan J, Zou H. Peptide profiling and the bioactivity character of yogurt in the simulated gastrointestinal digestion. J. Proteom. 2016;141:24–46. doi: 10.1016/j.jprot.2016.04.010. [DOI] [PubMed] [Google Scholar]
  18. Juillard V, Laan H, Kunji E, Jeronimus-Stratingh CM, Bruins AP, Konings WN. The extracellular PI-type proteinase of Lactococcus lactis hydrolyzes beta-casein into more than one hundred different oligopeptides. J. Bacteriol. 1995;177:3472–3478. doi: 10.1128/jb.177.12.3472-3478.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  19. Kaspari A, Diefenthal T, Grosche G, Schierhorn A, Demuth H-U. Substrates containing phosphorylated residues adjacent to proline decrease the cleavage by proline-specific peptidases. Biochim Biophys Acta Protein Struct Molec Enzym. 1996;1293:147–153. doi: 10.1016/0167-4838(95)00238-3. [DOI] [PubMed] [Google Scholar]
  20. Koyama M, Hattori S, Amano Y, Watanabe M, Nakamura K. Blood pressure-lowering peptides from neo-fermented buckwheat sprouts: a new approach to estimating ACE-inhibitory activity. PloS one. 2014;9:e105802. doi: 10.1371/journal.pone.0105802. [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Kumar R, Chaudhary K, Sharma M, Nagpal G, Chauhan JS, Singh S, Gautam A, Raghava GP. AHTPDB: a comprehensive platform for analysis and presentation of antihypertensive peptides. Nucleic acids research. 2014;43:D956–D962. doi: 10.1093/nar/gku1141. [DOI] [PMC free article] [PubMed] [Google Scholar]
  22. Liu M, Bayjanov JR, Renckens B, Nauta A, Siezen RJ. The proteolytic system of lactic acid bacteria revisited: a genomic comparison. BMC genomics. 2010;11:36. doi: 10.1186/1471-2164-11-36. [DOI] [PMC free article] [PubMed] [Google Scholar]
  23. Manzanares P, Salom JB, García-Tejedor A, Fernández-Musoles R, Ruiz-Giménez P, Gimeno-Alcañíz JV. Unraveling the mechanisms of action of lactoferrin-derived antihypertensive peptides: ACE inhibition and beyond. Food & function. 2015;6:2440–2452. doi: 10.1039/C5FO00580A. [DOI] [PubMed] [Google Scholar]
  24. Miclo L. Roux Em, Genay M, Brusseaux Em, Poirson C, Jameh N, Perrin C, Dary A. Variability of hydrolysis of β-, αs1-, and αs2-caseins by 10 strains of Streptococcus thermophilus and resulting bioactive peptides. J. Agric. Food Chem. 2012;60:554–565. doi: 10.1021/jf202176d. [DOI] [PubMed] [Google Scholar]
  25. Minkiewicz P, Dziuba J, Iwaniak A, Dziuba M, Darewicz M. BIOPEP database and other programs for processing bioactive peptide sequences. J. AOAC Int. 2008;91:965–980. [PubMed] [Google Scholar]
  26. Nagpal R, Behare P, Rana R, Kumar A, Kumar M, Arora S, Morotta F, Jain S, Yadav H. Bioactive peptides derived from milk proteins and their health beneficial potentials: an update. Food & function. 2011;2:18–27. doi: 10.1039/C0FO00016G. [DOI] [PubMed] [Google Scholar]
  27. Nakamura K, Naramoto K, Koyama M. Blood-pressure-lowering effect of fermented buckwheat sprouts in spontaneously hypertensive rats. J Funct Foods. 2013;5:406–415. doi: 10.1016/j.jff.2012.11.013. [DOI] [Google Scholar]
  28. Nakamura Y, Yamamoto N, Sakai K, Takano T. Antihypertensive effect of sour milk and peptides isolated from it that are inhibitors to angiotensin I-converting enzyme. J Dairy Sci. 1995;78:1253–1257. doi: 10.3168/jds.S0022-0302(95)76745-5. [DOI] [PubMed] [Google Scholar]
  29. Oh NS, Lee JY, Oh S, Joung JY, Kim SG, Shin YK, Lee K-W, Kim SH, Kim Y. Improved functionality of fermented milk is mediated by the synbiotic interaction between Cudrania tricuspidata leaf extract and Lactobacillus gasseri strains. Appl Microbiol Biotechnol. 2016;100:5919–5932. doi: 10.1007/s00253-016-7414-y. [DOI] [PubMed] [Google Scholar]
  30. Sánchez A, Vázquez A. Bioactive peptides: A review. Food Quality Safety. 2017;1:29–46. doi: 10.1093/fqsafe/fyx006. [DOI] [Google Scholar]
  31. Svanborg S, Johansen A-G, Abrahamsen RK, Schüller RB, Skeie SB. Caseinomacropeptide influences the functional properties of a whey protein concentrate. Int Dairy J. 2016;60:14–23. doi: 10.1016/j.idairyj.2015.12.007. [DOI] [Google Scholar]
  32. Tavares T, del Mar Contreras M, Amorim M, Pintado M, Recio I, Malcata FX. Novel whey-derived peptides with inhibitory effect against angiotensin-converting enzyme: in vitro effect and stability to gastrointestinal enzymes. Peptides. 2011;32:1013–1019. doi: 10.1016/j.peptides.2011.02.005. [DOI] [PubMed] [Google Scholar]
  33. Torres-Llanez M, González-Córdova A, Hernandez-Mendoza A, Garcia H, Vallejo-Cordoba B. Angiotensin-converting enzyme inhibitory activity in Mexican Fresco cheese. J Dairy Sci. 2011;94:3794–3800. doi: 10.3168/jds.2011-4237. [DOI] [PubMed] [Google Scholar]
  34. Tsakalidou E, Anastasiou R, Vandenberghe I, Van Beeumen J, Kalantzopoulos G. Cell-wall-bound proteinase of Lactobacillus delbrueckii subsp. lactis ACA-DC 178: characterization and specificity for β-casein. Appl. Environ. Microbiol. 1999;65:2035–2040. doi: 10.1128/aem.65.5.2035-2040.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  35. Zahraa N. Le peptide κ-CN (f106-109) du lait: propriétés nutritionnelles, biologiques et techno-fonctionnelles. Mémoire de M2 UHP Nancy 1, France (2010)

Articles from Food Science and Biotechnology are provided here courtesy of Springer

RESOURCES