Abstract
A plant expression platform with eukaryotic post-translational modification (PTM) machinery has many advantages compared to other protein expression systems. This promising technology is useful for the production of a variety of recombinant proteins including, therapeutic proteins, vaccine antigens, native additives, and industrial enzymes. However, plants lack some of the important PTMs, including furin processing, which limits this system for the production of certain mammalian complex proteins of therapeutic value. Furin is a ubiquitous proprotein convertase that is involved in the processing (activation) of a wide variety of precursor proteins, including blood coagulation factors, cell surface receptors, hormones and growth factors, viral envelope glycoproteins, etc. and plays a critical regulatory role in a wide variety of cellular events. In this study, we engineered the human furin gene for expression in plants and demonstrated the production of a functional active recombinant truncated human furin in N. benthamiana plant. We demonstrate that plant produced human furin is highly active both in vivo and in vitro and specifically cleaved the tested target proteins, Factor IX (FIX) and Protective Antigen (PA83). We also demonstrate that both, enzymatic deglycosylation and proteolytic processing of target proteins can be achieved in vivo by co-expression of deglycosylating and furin cleavage enzymes in a single cell to produce deglycosylated and furin processed target proteins. It is highly expected that this strategy will have many potential applications in pharmaceutical industry and can be used to produce safe and affordable therapeutic proteins, antibodies, and vaccines using a plant expression system.
Introduction
In recent years, numerous studies have demonstrated the plant transient expression systems as a promising expression platform with high expression capacity, which provide safe, cost-effective production of a variety of biologically active proteins in a relatively short period of time [1–5]. Since plants possess eukaryotic PTM machinery, this technology is especially useful for the production of mammalian complex proteins, where PTMs play a critical role in the proper folding and functional activity [6]. Despite the significant similarities between mammalian and plant cell PTM machinery, plants lack the ability to make a number of important PTMs present in mammalian cells [6]. Furin is a mammalian subtilisin/kex2p like endoprotease, belonging to the proprotein convertase family. It is responsible for the post-translational cleavage of a number of precursor proteins. Although the existence of a kex2p like pathway was reported earlier in Nicotiana tabacum plant [7], no furin cleavage activity was observed in plants [8]. The human furin protein is a 794 amino acid long, membrane-associated protease. It possesses a signal peptide, propeptide, and subtilisin-like catalytic domain characterized by a catalytic triad of three amino acids: aspartate, histidine and serine. Furin also contains a cysteine rich domain, homo B domain, which is essential for catalytic activity. It is anchored in the plasma membrane by a transmembrane domain and the cytoplasmic domain, which regulates the localization of furin in the cellular trans-Golgi network [9]. The luminal and extracellular domains of human furin share a homology with other members of the proprotein convertase (PC) family. Notably, the highest sequence similarity is found in the subtilisin-like catalytic domain, where aspartate, histidine and serine residues form a strictly conserved catalytic triad [10]. The catalytic domain of furin is 54–70% identical to other PCs [10]. Furin cleavage of propeptides is essential for maturation of the precursor proteins. For example, furin processing is essential for the gamma carboxylation of glutamic acid residues [11], disulfide bridge formation [12, 13], regulating the synthesis of multiple mature peptides [14, 15], and directing intracellular targeting [16]. Furin is involved in the cleavage of serum proteins including blood clotting factors, cell surface receptors, hormones, growth factors and their receptors [9, 17] mainly at Arg-X-Lys/Arg-Arg (RXK/RR) consensus sequence [18,19]. A number of studies have reported that a mutation found at the furin cleavage site of certain precursor proteins is associated with the onset of the various types of diseases [9]. For example, the envelope proteins of influenza virus [20], HIV [21], dengue fever [22] and several filoviruses including ebola and marburg virus [23] must be cleaved by furin-like proteases to become functionally active. Furin also functions in the cleavage of papillomaviruses [24], anthrax toxin [25] and pseudomonad exotoxin [26] during entry into the host cells. It should be noted that, recombinant blood clotting factors VII, VIII, IX, and protein C, which are currently used in the treatment of a number of diseases are mainly prepared from donated human blood and therefore, have a viral contamination risk and also very expensive [27–29]. Defects in factor IX (FIX) synthesis result in hemophilia B (Christmas disease), an X-linked disorder. Different expression systems have been used to produce recombinant FIX [30], however, all attempts were impeded by limitations in PTM, safety, and high costs. A plant transient expression system could be an alternative expression system for the production of safe and affordable blood clotting factors, such as FIX to be used as a hemophilia B treatment. As previously stated, plants lack a number of important mammalian PTMs, such as gamma carboxylation, furin processing, sialylation, mannose-6-phosphate modification, sulfation, and etc. [6]. Therefore, engineering of plants that can produce recombinant proteins in their native forms would be very important for their functionality. FIX is expressed as a precursor polypeptide that requires posttranslational processing. In order to produce functionally active FIX in plants, FIX must be cleaved in vivo by PACE (Paired basic Amino acid Cleaving Enzyme)/furin processing enzyme. Given that furin cleavage is involved in many different cellular events, production of functionally active furin is necessary for the production of a variety of pharmaceutically valuable precursor proteins. Since human furin is a transmembrane protein, it therefore, would be challenging to produce a highly soluble and fully functional active human furin in plants. At this point, although co-expression of full length human furin and latent transforming growth factor-b1 in N. benthamiana plants was recently reported [8], there was no direct confirmation of furin expression; for example, western blot analysis using a specific antibody of plant produced human furin was not reported in the study [8]. Additionally, there were no reports regarding the isolation of furin from plants or the in vitro assessment of plant produced recombinant furin. In this study, we engineered a human furin gene for production in plants. For the first time we have shown that this truncated version of recombinant human furin is highly expressed, soluble and functionally active in N. benthamiana plants. We also described a method for producing furin processed proteins in plant cells by co-expressing human furin with target proteins of interest in vivo. We transiently co-expressed a hemophilia B therapeutic candidate, FIX, and an anthrax vaccine candidate, protective antigen (PA) of B. anthracis along side human furin in N. benthamiana. Our results showed that human furin cleaved all target proteins. We also demonstrated that both the enzymatic deglycosylation and proteolytic processing of target proteins were achieved in vivo by introducing and co-expressing deglycosylating and furin cleavage enzymes in the same plant cells.
Materials and methods
Cloning, expression and production of recombinant human furin and FIX in N. benthamiana plants
Human furin and FIX genes were engineered for expression in N. benthamiana plants and synthesized at Biomatik Corporation. Full length furin (amino acids 26–794) was transiently expressed in N. benthamiana plants. The signal peptide (amino acids 1–25) was removed from the furin sequence (GenBank Accession No. NP_002560), and N. tabacum PR-1a signal peptide (MGFVLFSQLPSFLLVSTLLLFLVISHSCRA) was added to the N-terminus. The KDEL sequence (the ER retention signal) and the His6 tag (the affinity purification tag) were added to the C-terminus. A truncated form of furin (amino acids 26–595) was expressed with a PR-1a signal peptide at N-terminus and His6-KDEL at C-terminus. The resulting sequences were inserted into the pEAQ vector [31] using AgeI/XhoI sites resulting in pEAQ-Furin (full length)-His6-KDEL and pEAQ-Furin (truncated)-His6-KDEL constructs. To transiently express the FIX (amino acids 29–461) in N. benthamiana plants, the signal peptide (amino acids 1–28) was removed from the FIX sequence (GenBank Accession No. NP_000124) and replaced with a N. tabacum PR-1a signal peptide (MGFVLFSQLPSFLLVSTLLLFLVISHSCRA). Like the furin constructs, a KDEL sequence and the His6 tag were added to the C-terminus. The human FIX gene was also synthesized at Biomatik Corporation with a FLAG tag positioned at the N-terminal, between PR-1a signal peptide and propeptide sequence. These sequences were inserted into the pEAQ vector as previously described using the same restrictions sites resulting in pEAQ-FIX-His6-KDEL and pEAQ-FLAG-FIX-KDEL constructs. All of the expression constructs described above were then transformed into the Agrobacterium tumefaciens strain AGL1 using electroporation. Agrobacterium growth, plant growth, plant infiltration, plant leaf tissue harvesting, plant extraction, homogenization and further analysis were performed as described previously [4]. Leaf tissue was harvested at 4–7 dpi (day post infiltration) and homogenized in three volumes of extraction buffer (20 mM sodium phosphate, 150 mM sodium chloride, pH 7.4). After centrifugation of the crude extract at 13 000 g for 20 min samples were run on SDS-PAGE, and transferred to a Polyvinylidene fluoride (PVDF) membranes (Millipore, Billerica, MA) for western blot analysis. The His tagged proteins were probed with a purified mouse anti-His tag primary antibody (Cat. no. 652502, BioLegend) and anti-mouse horseradish peroxidase (HRP)-conjugated IgG secondary antibody (Cat. No. ab98790, Abcam). The FLAG tagged recombinant FIX protein was detected using anti-FLAG mAb (Cat. No.637301, BioLegend), followed by HRP goat anti-rat IgG antibody (Cat. No. 405405, BioLegend). N. benthamiana plants infiltrated with an empty pEAQ vector was used as a negative control. The pEAQ binary expression vector was kindly provided by Dr. George P. Lomonossoff (John Innes Centre, Biological Chemistry Department).
Cloning and expression of Endo H, PNGase F and PA83 in N. benthamiana
Endo H (Endo-ß-N-acetylglucosaminidase), PNGase F (Peptide N-Glycosidase F) and B. anthracis PA83 genes were engineered for expression in plants, cloned and expressed as described recently [4]. Endo H or PNGase F sequences were inserted into the pBI121 expression vectors resulting in pBI-Endo H-FLAG-KDEL or pBI-PNGase F-FLAG-KDEL constructs. The PA83 gene sequence was inserted into the pEAQ or pBI vectors resulting in pEAQ-PA83-His6-KDEL or pBI-PA83-His6-KDEL constructs. Agrobacterium growth, plant growth, plant infiltration, plant leaf tissue harvesting, extraction, homogenization and further analysis were performed as described previously [4].
Co-expression of human furin with FIX and PA83 of B. anthracis and evaluation of its cleavage activity in vivo
To co-express a human furin with FIX, pEAQ-Furin/pEAQ-FIX (His6 and FLAG tagged) constructs were used for agrobacterium mediated infiltration of N. benthamiana plant leaves. Similarly, furin was co-expressed with B. anthracis PA83, using pEAQ-Furin/pBI-PA83 constructs in the same manner. These constructs were transformed into A. tumefaciens AGL1, which was used to infiltrate into 6–7 week old N. benthamiana plants. This was conducted in the absence of an A. tumefaciens AGL1 strain harboring a silencing suppressor, since pEAQ vector contained both genes of interest and the suppressor of silencing in a single plasmid. In order to achieve a complete furin processing of FIX and B. anthracis PA83 proteins in vivo, plant infiltration was optimized using different ratios of A. tumefaciens strain AGL1, expressing furin or target proteins. Leaf samples were taken at 4–7 dpi and homogenized in three volumes of extraction buffer (20 mM sodium phosphate, 150 mM sodium chloride, pH 7.4) using a mortar and pestle. Samples were run on 10% SDS-PAGE, followed by western blotting as described above. Since both furin and PA83 are His6-tagged proteins, they were detected using a purified mouse anti-His tag antibody (BioLegend, Cat. no. 652502). To confirm the site-specific cleavage of FIX by furin, the anti-FLAG antibody (BioLegend, Cat. No. 637301) and anti-FIX antibody (Cat. no. F9-1020A, CoaChrom Diagnostica, Austria) were also used.
Co-expression of human Furin with PA83 of B. anthracis and deglycosylation enzymes Endo H or PNGase F in N. benthamiana
To co-express the human furin, PA83 and deglycosylation enzymes, Endo H or PNGase F, pEAQ-Furin/pEAQ-PA83-His6-KDEL/pBI-Endo H or pEAQ-Furin/pEAQ-PA83-His6-KDEL/pBI-PNGase F constructs were used in the agrobacterium mediated infiltration of N. benthamiana leaves. Agrobacterium growth, plant growth, plant infiltration, plant leaf tissue harvesting, extraction and homogenization and western blot analysis were performed as described above. To test the effect of pH on oligomer formation, the protein extraction was performed as follows: N. benthamiana plants, which were infiltrated with i) PA83 and Endo H or ii) PA83, Endo H and furin constructs, were homogenized in PBS (pH 7.4) or in 20 mM MES-Tris buffer, pH 5.0, containing 145 mM NaCI. Boiled and un-boiled samples were then analyzed by western blotting.
Co-expression of human Furin with deglycosylation enzymes Endo H or PNGase F
To co-express a human furin with Endo H or PNGase F, pEAQ-Furin/pBI-Endo H or pEAQ-Furin/pBI-PNGase F constructs were used for plant infiltration. Leaf tissue was harvested at 5 dpi and homogenized in three volumes of extraction buffer (20 mM sodium phosphate, 150 mM sodium chloride, pH 7.4) and samples were run on SDS-PAGE and transferred to PVDF membranes (Millipore, Billerica, MA) for western blot analysis as previously described. Western blot analysis was performed as described above using a purified mouse anti-His tag antibody (Cat. no. 652502, BioLegend) as a primary antibody and an anti-mouse horseradish peroxidase (HRP)- conjugated IgG as a secondary antibody (Cat. No. ab98790, Abcam).
Purification of plant produced furin by Ni-NTA column
Plant produced furin was partially purified as described previously [4]. Briefly, 25 grams of frozen plant leaves, infiltrated with the pEAQ-Furin (truncated)-His6-KDEL construct, were ground using mortar and pestle in a phosphate extraction buffer (20 mM sodium phosphate, 300 mM sodium chloride, 10 mM imidazole, pH 7.4). The plant cell extract was filtered through Miracloth and centrifuged at 20,000 g for 25 minutes and then filtered through a 0.45 μm syringe filter (Millipore). The clarified total protein extract was then purified using HisPur Ni-NTA resin (Cat. No. 88221, Thermo Fisher Scientific) by following a previously used protocol [4]. Endo H or PNGase F deglycosylated and non-deglycosylated furin proteins were purified using the same procedure described above. These partially purified furin proteins were concentrated and stored at -80°C until used for experimentation.
In vitro cleavage of PA83 and APRIL proteins with plant produced or commercial furin
To assess the in vitro cleavage activity of plant produced furin, a plant produced deglycosylated PA83 (dPA83) and APRIL (Cat no. SRP3189-20UG, Sigma) proteins were used as furin substrates. dPA83 was produced in N. benthamiana plants by co-expressing PA83 with Endo H, as described previously [4]. A total of 5 μg plant produced, Ni-NTA column purified dPA83 was incubated with the various concentrations of plant produced human furin (0, 1, 5, 25, 50, 100 ng) in 20 mM HEPES, 0.1% Triton X-100, 0.2 mM CaCl2, pH 7.5, at 25°C for 2 hours. To compare the in vitro activity of plant produced furin with commercial human furin, 5 μg plant produced, Ni-NTA column purified dPA83 was incubated with various concentrations (0, 1, 5, 25, 50, 100 ng) of commercial human furin (New England Biolabs, NEB), in 20 mM HEPES, 0.1% Triton X-100, 0.2 mM CaCl2, pH 7.5, at 25°C for 2 hours. To test the APRIL protein cleavage by plant produced furin, 5 μg APRIL protein was incubated with 25 ng plant produced or commercial furin (NEB, Cat. no P8077S) in 20 mM HEPES, 0.1% Triton X-100, 0.2 mM CaCl2, pH 7.5, at 25°C for 2 hours. dPA83 samples that were incubated with plant produced furin were run on SDS-PAGE followed by western blot analysis. dPA83 cleavage by furin (with plant produced or commercial furin) was analyzed by SDS-PAGE and western blotting using 4.5 μg or 100 ng of dPA83 protein from each sample, respectively. 2.5 μg of the APRIL protein, cleaved by plant produced or commercial recombinant furin was analyzed on SDS-PAGE.
For the assessment of in vitro cleavage activity of plant produced deglycosylated furin proteins, 5.0 μg dPA83 protein was incubated with the increasing concentrations (1, 5, 25, 50, 100 ng) of purified, recombinant Endo H or PNGase F deglycosylated human furin in 20 mM HEPES, 0.1% Triton X-100, 0.2 mM CaCl2, pH 7.5, at 25°C for 2 hours. The effect of in vitro deglycosylation on commercial furin enzyme activity, 5.0 μg of recombinant dPA83 with 50 ng of Endo H or 50 ng of PNGase F deglycosylated human furin as described above. Equal amount of the dPA83 protein (2.5 μg) from each sample was analyzed by SDS-PAGE.
SDS-PAGE and western blot analysis
SDS-PAGE analysis of furin cleaved proteins was performed using 10–12% acrylamide gels as described previously [4]. SDS-PAGE was performed under reducing condition by preparing samples in 5X Laemmli Buffer (100 mM Tris, 2% SDS, 20% glycerol, 4% β-mercaptoethanol, pH 6.8). For western blot analysis, protein samples were run on 10–12% acrylamide gels, followed by transfer to a PVDF membrane (Millipore, Billerica, MA). The membranes were blocked using a 0.5% I-block solution (Applied Biosystems, Carlsbad, CA). His6 tagged furin, FIX and PA83 proteins were detected as described above. The membranes were washed with a Phosphate-buffered saline, containing 0.1% Tween- 20 (PBS-T). After washing, membranes were incubated with an anti-mouse horseradish peroxidase (HRP)- conjugated secondary antibody (Cat. No. ab98790, Abcam) or anti-rabbit HRP-conjugated secondary antibody (Cat. No. ab97051, Abcam).The images of protein bands were acquired using the GeneSnap software on a GeneGenome using a chemiluminescent substrate (SuperSignal West Pico, Thermo Fisher Scientific, Grand Island, NY) and quantified using the Gene Tools software (Syngene Bioimaging, UK).
Results
Engineering and production of recombinant human furin in N. benthamiana plants and purification of His tagged recombinant furin using the Ni-NTA column chromatography
As described in Materials and Methods, the human furin gene was engineered for expression in N. benthamiana plants using N. benthamiana codons, synthesized de-novo at Biomatik Corporation. In this study, the furin gene was expressed as a full length or truncated form in N. benthamiana. First, we tried to co-express the full length human furin with PA83 protein in N. benthamiana. However, when full length furin was co-expressed with the PA83 protein in N. benthamina plants there was little or no cleavage of PA83 (data not shown). In addition, very little or no specific furin protein band was detected in western blot when crude extract prepared from plants infiltrated with furin construct was probed with the specific antibody (data not shown). We therefore engineered a truncated form of human furin to produce a functionally active and highly soluble recombinant furin in N. benthamiana, using plant based transient expression system. Fig 1A demonstrates the confirmation of the production of human furin in N. benthamiana by western blot analysis. Fig 1A, 1B and 1C demonstrate that, plant produced, truncated human furin migrates as a ~60 kDa protein as expected. In order to examine the functional cleavage activity of human furin in vitro, recombinant human furin was purified using Ni-NTA column as described in Materials and Methods. SDS-PAGE and western blot analyses of Ni-NTA purified, plant produced recombinant furin is demonstrated in Fig 1B and 1C, respectively. As can be seen from Fig 1B and 1C, two bands of plant produced furin were observed in the gel, perhaps due to the presence of multiple glycosylated forms (non-glycosylated, high mannose N-glycosylation, differences in O-glycosylation [32], or the presence of furin with unoccupied N-glycan sites, where one or two glycosylation sites (out of 3) are not occupied by glycan). Protein bands that were observed on the blot at ~50 kDa, ~37 kDa and smaller (Fig 1C), are probably due to the proteolytic degradation of plant produced furin.
Assessment of the in vitro cleavage activity of plant produced furin using an APRIL substrate protein
The commercially available APRIL protein was used to evaluate in vitro cleavage activity of plant produced recombinant furin. APRIL is a proliferation-inducing ligand and a member of the tumor necrosis factor superfamily of proteins, which regulate immune responses and induces apoptosis [33]. The recombinant murine APRIL is a 21.9 kDa protein. The post-translational clevage by furin, results in the release of a C-terminal 16.8 kDa polypeptide fragment. To test the cleavage activity of plant produced furin, recombinant APRIL protein was incubated with plant produced human furin or commercial human furin (NEB) as described in Materials and Methods. Recombinant APRIL protein was cleaved by both plant produced and commercial furin resulting in the 16.8 kDa fragment (Fig 2). These results confirm that plant produced human furin is enzymatically active in vitro and specifically cleaves the APRIL protein.
Assessment of in vitro cleavage activity of plant produced furin using the substrate protein, PA83
To assess in vitro cleavage activity of plant produced furin, plant produced recombinant PA83 was used as a furin substrate. Protective antigen (PA83) is an 83 kDa protein that is secreted by the Gram-positive bacterium Bacillus anthracis, which binds the anthrax toxin receptor. After binding to the receptor, the PA83 antigen is cleaved by furin, the products (PA63 and PA20) localize to the cell surface, and are released into the extracellular environment [25]. PA83 protein (deglycosylated) was selected as suitable furin cleavage substrate as it generates two protein fragments with distinctly different molecular masses of 63 kDa (PA63) and 20 kDa (PA20) (see Fig 3D below), that could be easily visualized using SDS-PAGE. To test the cleavage activity of plant produced furin, a plant produced PA83 protein was incubated with different concentrations of purified furin as described in Materials and Methods. Protein samples were analyzed by SDS-PAGE (Fig 3A) and western blot analysis (Fig 3B). As shown in Fig 3A and 3B increasing the concentration of plant produced furin, the generation of PA63 and PA20 fragments are increased. Fig 3A and 3B show that 5 μg plant produced PA83 protein is about 85% cleaved by 25 ng plant produced furin resulting in the formation of the respective PA63 and PA20 fragments. As shown in Fig 3C, SDS-PAGE demonstrates that plant produced PA83 protein, is almost fully cleaved by a 20 ng of commercial furin (NEB). Based on these data, plant produced truncated furin is enzymatically active displaying about 75% relative activity compared to commercial human furin in vitro.
Assessment the in vivo cleavage activity of plant produced furin by co-expression with FIX protein
FIX is expressed as a precursor polypeptide that requires posttranslational processing to yield a mature protein [34]. This precursor polypeptide of FIX undergoes several post translational modifications (PTMs), including the removal of the signal peptide (aa 1–28); carboxylation of the first 12 glutamic acid residues downstream from the18-amino acid propeptide sequence (aa 29–46) in the region rich in glutamic acid (aa 47–92, called the γ-carboxyglutamic acid or “Gla” domain) at the N terminus. Proper γ-carboxylation of the Gla domain is required for binding to calcium and phospholipids that is critical for proper protease activity during coagulation [34]. In vivo, vitamin K-dependent gamma-carboxylase binds to the 18-amino acid propeptide of FIX, which is then cleaved and is required for optimal binding of the Gla domain to Ca++ and phospholipids. When overexpressed in CHO cells, furin facilitates propeptide cleavage of FIX even when the recombinant protein is over-expressed at very high levels [35–37]. Therefore, expression of an active propeptide processing enzyme of furin in plants is critical for the production of functionally active FIX in plants. We performed in vivo co-expression of His6-tagged human FIX with human furin in N. benthamiana plants for possible cleavage of FIX by plant produced furin. The results are demonstrated in Fig 4. As can be seen from Fig 4A, since furin cleavage removes a fragment with 18-amino acid residues (Fig 4D), no visible shift in the molecular mass was observed. Therefore, we engineered a new FIX construct, with FLAG epitope at the N-terminal (Fig 4E). When FIX construct was co infiltrated with furin as a mixture at a ratio of OD600 (optical density, OD600) 0.9 (FIX) and 0.1 (furin), the FIX protein was detected with anti-FLAG antibody (Fig 4A). When FIX and furin were co infiltrated at a ratio of OD600 0:6 (FIX) and 0.4 (furin) no FIX band could be detected with anti-FLAG antibody (Fig 4B). However, when the blot was probed with anti-FIX antibody, FIX bands were observed in both samples (Fig 4C). This confirms the loss of the FLAG epitope of the FIX protein was a result of furin cleavage. These data demonstrate that plant produced human furin is functionally active in vivo and specifically cleaved the plant produced FIX in plant cells.
Assessment of the in vivo cleavage activity of plant produced furin by co-expression with PA83
As mentioned above, B. anthracis PA is an 83-kDa protein (PA83) and after binding to receptors, PA83 is cleaved by cell surface furin and the 63 kDa (PA63) and 20 kDa (PA20) polypeptides are released [25, 38] and cell-bound PA63 then rapidly heptamerizes to form a pre-pore [39]. The in vivo cleavage activity of the plant produced furin was evaluated by co-expression with PA83 of B. anthracis. We also co-expressed PA83 with furin and deglycosylation enzymes Endo H or PNGase F to produce furin cleaved and deglycosylated PA83 proteins in vivo. The in vivo cleavage activity of the plant produced furin was evaluated by co-expression with PA83 and deglycosylation enzymes as follows: i) two genes, a human furin gene was co-expressed with PA83 to generate furin cleaved PA83 protein in vivo; ii) three genes, plant produced furin, Endo H and PA83 genes were co-expressed in vivo to generate furin cleaved and Endo H deglycosylated PA83 protein; iii) three genes, plant produced furin, PNGase F and PA83 genes were co-expressed to generate furin cleaved and PNGase F deglycosylated PA83. It should be noted that both PNGase F and Endo H are deglycosylation enzymes, secreted by the Gram-negative bacterium Flavobacterium meningosepticum and Gram-positive bacterium Streptomyces plicatus, respectively [40–42]. PNGase F cleaves asparagine-linked high-mannose, hybrid and complex oligosaccharides from glycoproteins, except oligosaccharides containing a (1–3)-linked core fucose that are commonly found in plant glycoproteins. Endo H is an enzyme that cleaves oligomannose-type and hybrid glycans, however, it does not cleave the complex N-linked glycans [43]. PNGase F deglycosylation removes the oligosaccharide intact, but results in an amino acid change due to the deamidation of asparagine to aspartate in the N-X-S/T site. Endo H catalyzes the cleavage between two N-Acetyl-D-glucosamine (GlcNAc) residues of the chitobiose core of N-linked glycans, and leaves single GlcNAc moiety, with no concomitant deamidation of asparagine [42]. Functionally active recombinant PNGase F and Endo H enzymes were recently produced in N. benthamiana plants. The in vivo deglycosylation by PNGase F and Endo H were successfully applied to the production of pharmaceutically important recombinant non-N-glycosylated proteins in plants [4, 44–46]. Notably, it was shown that the deglycosylation efficiency of plant produced Endo H was similar to those of commercial Endo H (NEB) in vitro, however, was greater than that of plant produced recombinant PNGase F in vivo [4]. Western blot analysis of PA83 proteins, co-expressed with modifying enzymes (furin, Endo H and PNGase F) are presented in Fig 5. In Fig 5A, if we compare PA83 protein, expressed alone (Fig 5A, lane 3) with PA83, co-expressed with furin (Fig 5A, lane 6), a shift of about 20 kDa resulting from a size reduction is observed. Similarly, if compare PA83, co-expressed with PNGase F (Fig 5A, lane 1), with PA83, co-expressed with PNGase F and furin (Fig 5A, lane 4) the same shift is observed. This 20 kDa size reduction is also evident if we compare PA83, co-expressed with Endo H (Fig 5A, lane 2) with PA83, co-expressed with Endo H and furin (Fig 5A, lanes 5). Finally, if we compare PA83 protein, expressed alone (Fig 5A, lane 3) with PA83 co-expressed with Endo H (Fig 5A, lane 2) or PNGase F (Fig 5A, lane 1) a gel shift is also observed due to deglycosylation of PA83 molecule (Fig 5A, lane 1 and 2), which is consistent with our previously published work [4]. All of the above results demonstrate that the PA83 protein undergoes two modifications in vivo: i) it is successfully cleaved by plant produced furin and ii) successfully deglycosylated by plant produced bacterial Endo H or PNGase F. As shown in Fig 5, a high molecular mass band (Fig 5A, as indicated and lane 5) was observed in plant-produced Endo H deglycosylated and furin cleaved PA83, suggesting heptamerization of furin cleaved and Endo H deglycosylated PA63 in vivo. As can be seen in Fig 5A, a high molecular band was also observed with PNGase F deglycosylated PA83 (Fig 5, lane 4), but not with glycosylated PA83 (Fig 5A, lane 6), suggesting that formation of the heptamerized form of glycosylated PA63 is probably blocked by plant N-linked glycans. This could explain why plant produced glycosylated PA83 has no biological activity and could not form lethal toxin (LeTx) in vitro [32, 44]. It should be noted that PA83 protein is not glycosylated in its native host, but contains six potential N-linked glycosylation sites that is aberrantly glycosylated when expressed in plants, and aberrantly glycosylated PA83 has no biological activity, and cannot form lethal toxin [44]. It was shown that acidic pH promotes oligomerization, which is SDS-resistant [45]. We, further tested the effect of pH on oligomer formation in boiled and un-boiled samples of PA63 protein, produced in N. benthamiana plants by co-expressing of PA83, Endo H and furin constructs. Boiled and un-boiled samples were analyzed by western blotting. In Fig 5B, high molecular mass proteins (oligomers) were not detected in the samples, prepared from N. benthamiana plants, infiltrated with PA83 and Endo H constructs (Fig 5B, lanes 1–4), however, they were detected in the samples, prepared from N. benthamiana plants, infiltrated with PA83, Endo H and furin constructs (Fig 5B, lanes 5–8). These findings suggesting that formation of high molecular mass oligomers in these samples is likely due to the furin processing of PA83 and production of PA63. The formation of PA63 oligomer is higher at pH 5.0 in both boiled and un-boiled samples (Fig 5B, lanes 6,8), and also is higher at pH 7.4 in un-boiled samples, but significantly lower at pH 7.4 in boiled sample, suggesting that the dissociation of oligomer occurs at pH 7.4 in conjunction with boiling in SDS sample buffer. Overall, these results are consistent with previously published work [45], suggesting the heptamerization of furin cleaved, Endo H deglycosylated PA63 occurs in vivo in N. benthamiana plants.
Co-expression of furin with Endo H and PNGase F in vivo. Assessment of the cleavage activity of plant produced, deglycosylated furin in vitro
Human furin protein has three potential N-glycosylation sites, Asn (387), Asn (440) and Asn (553). The human furin gene was co-expressed with both Endo H or PNGase F to produce deglycosylated forms of the enzyme. Co-expression of furin with Endo H or PNGase F reduced the molecular mass of furin (Fig 6A, as indicated), compared with non-deglycosylated forms, suggesting the in vivo deglycosylation of plant produced furin. Fig 6A shows that, a complete deglycosylation was observed when furin co-expressed with Endo H, but was not completely deglycosylated when co-expressed with PNGase F. These results are consistent with our recent findings that deglycosylation efficiency of plant produced Endo H is greater than that of plant produced PNGase F [4].
To test the effect of in vitro deglycosylation on furin cleavage activity, furin proteins that were co-expressed with Endo H and PNGase F were purified from plant tissue using the Ni-NTA column as described in Materials and Methods above. Fig 6 demonstrates a SDS-PAGE analysis of plant produced dPA83 incubated with plant produced or commercial furin (NEB). As can be seen in Fig 6, plant produced human furin treated with PNGase F (Fig 6B) and Endo H (Fig 6C) does not exhibit cleavage activity. Similarly, when commercial human furin (NEB) was treated with commercial Endo H or PNGase F (Fig 6D), no cleavage was observed for the substrate PA83. These results demonstrate that N-glycosylation is necessary for the proper folding and catalytic activity of plant produced or commercial human furin (NEB). It should be noted that the effect of deglycosylation on the enzymatic activity of human furin has not been reported previously. However, previous studies have shown that site-directed mutagenesis of two N-glycosylation sites (Asn387 and Asn440), negated furin activation [46]. In contrary to in vitro deglycosylated furin (plant produced or commercial furin), plant produced furin was fully active in vivo and successfully cleaved PA83 protein, when PA83 was co-expressed with Endo H or PNGase F and furin. This resulted in a ~20 kDa size reduction of PA83 and the formation of PA63 protein (Fig 5). A possible explanation for this discrepancy may reflect potential differences in protein folding in vitro and in vivo, as molecular chaperones assist protein folding. Notably, our previous studies [4, 44] showed that even though PA83 proteins treated with PNGase F either in vitro or in vivo have identical amino acid sequences, the lethal toxin neutralizing activity and immunogenicity of plant produced in vivo deglycosylated PA83 was greater than that of in vitro deglycosylated PA83 [44]. In addition, our recent studies demonstrated that the plant produced form of PA83 deglycosylated in vivo by Endo H appeared to be more stable at elevated temperatures compared to form treated with Endo H in vitro, suggesting potential differences in protein folding of in vivo and in vitro deglycosylated forms [4].
Discussion
Recently a series of strategies and approaches have been utilized to successfully develop a system for the efficient recombinant production and subsequent PTM of proteins in plants, which are important for proper folding, functionality and stability [4, 44, 47, 48]. In this study, we engineered the human furin gene for expression in N. benthamiana plants resulting in the production of a highly soluble, functionally active enzyme. We show that plant produced furin has about 75% relative activity of commercial human furin in vitro. The major goal of this study was to achieve furin processing in plants and apply the technology to the PTM of proteins, in which furin cleavage is necessary for maturation and activation. Moreover, we demonstrate that plant produced truncated form of human furin is active in vivo and specifically cleaved target proteins, FIX and PA83. As described above, furin modifies proteins of vitamin K-dependent coagulation Factors (Factors VII, IX and protein C). Defects in FIX synthesis result in hemophilia B (Christmas disease), an X-linked disorder. Currently, patients with hemophilia B are mainly treated with FIX, obtained from concentrates made from human blood and recombinant FIX produced in CHO cells. However, such preparations of FIX are extremely expensive and difficult to obtain, especially in developing countries. To date, all attempts at producing recombinant Factor IX using different expression systems have been hampered by limitations in post-translation processing, safety concerns, and high cost. There remains an urgent need for a safe and affordable therapeutic treatment for hemophilia B. Thus, the findings in this study may open the door for the production of affordable, safe (pathogen free), functionally active human clotting factors, such as FIX, Factor VII and protein C in plants using transient expression technology. In this study, we also demonstrate that both enzymatic deglycosylation and proteolytic processing of PA83 protein were achieved in vivo by introducing the respective enzymatic repertoire into a eukaryotic system. The PA83 protein does not carry N-linked glycans in the native hosts, but contains potential N-linked glycosylation sites, which are aberrantly glycosylated during expression in plants [4, 44, 47, 48]. Glycosylated PA83 has no biological activity, and therefore, cannot form a lethal toxin [32, 44]. It has low immunogenicity compared to the deglycosylated form [4, 32, 44], and is also highly unstable especially at elevated temperatures [4]. Thus, deglycosylation of PA83 or PA63 is important for functional activity. Plant produced, PNGase F [44, 47] or Endo H deglycosylated forms of PA83 [4] were more stable compared to the glycosylated counterpart and had a superior immunogenicity. However, further improvement in the potency, immunogenicity and stability of the anthrax vaccine is still needed. In vivo processing of PA83 the protein and production of deglycosylated PA63 protein in plants could potentially be used to develop a new vaccine candidate against anthrax, based on heptamerized PA63, which can be produced in vitro (without the need of costly commercial cleavage enzymes, i.e. furin or trypsin) or in vivo. This technology has potential applications in molecular farming and can be used to produce subunit vaccines, therapeutic proteins, and antibodies in eukaryotic system. Recombinant human furin has not been previously produced in plants, therefore, the technology developed in this study supports the utility of plants as an efficient expression system for the production of active, endotoxin-free recombinant human furin.
Acknowledgments
The authors are grateful to Dr. George P. Lomonossoff (John Innes Centre, Biological Chemistry Department) and Plant Bioscience Limited for kindly providing pEAQ binary expression vector. We thank Dr. Keith Ballard at Liberty BioSecurity, Dr. Munevver Aksoy and Mr. Nicholas Lambourn, at Akdeniz University for editorial assistance.
Data Availability
All relevant data are within the manuscript.
Funding Statement
This study was supported by the Scientific and Technological Research Council of Turkey (TUBITAK) (www.tubitak.gov.tr) through the projects coded 114Z863 and 115S077 to Tarlan Mamedov. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1.Yusibov VM, Mamedov TG. (2010) Plants as an alternative system for expression of vaccine antigens. Proc. ANAS (Biol. Sci.) 65:195–200. [Google Scholar]
- 2.Klimyuk V, Pogue G, Herz S, Butler J, Haydon H (2014) Production of recombinant antigens and antibodies in Nicotiana benthamiana using 'magnifection' technology: GMP-compliant facilities for small and large-scale manufacturing. Curr Top Microbiol Immunol 375: 127–154. 10.1007/82_2012_212 . [DOI] [PubMed] [Google Scholar]
- 3.Křenek P, Šamajová O, Luptovčiak I, Doskočilová A, Komis G, Šamaj J (2015) Transient plant transformation mediated by Agrobacterium tumefaciens: Principles, methods and applications. Biotechnol Adv 33(6 Pt 2): 1024–1042. 10.1016/j.biotechadv.2015.03.012 . [DOI] [PubMed] [Google Scholar]
- 4.Mamedov T., Cicek K., Gulec B., Ungor R., Hasanova G. (2017) In vivo production of non-glycosylated recombinant proteins in Nicotiana benthamiana plants by co-expression with Endo-β-N-acetylglucosaminidase H (Endo H) of Streptomyces plicatus. PLoS One. 12, e0183589 10.1371/journal.pone.0183589 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Rybick E. (2018) History and Promise of Plant-Made Vaccines for Animals In Prospects of Plant Based Vaccines in Veterinary Medicine (MacDonald J., eds.), pp. 1–22. Cham: Springer; 10.1080/21645515.2017.1356497 PMID: 28846485. [DOI] [Google Scholar]
- 6.Gomord V, Faye L. (2004) Posttranslational modification of therapeutic proteins in plants. Curr Opin Plant Biol 7: 171–181. 10.1016/j.pbi.2004.01.015 . [DOI] [PubMed] [Google Scholar]
- 7.Kinal H., Park C.M., Berry J.O., Koltin Y., Bruenn J.A. (1995) Processing and secretion of a virally encoded antifungal toxin in transgenic tobacco plants—evidence for a Kex2p pathway in plants. Plant Cell. 7: 677–688. 10.1105/tpc.7.6.677 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Wilbers R.H., Westerhof L.B., Van Raaij D.R., Van Adrichem M., Prakasa A.D., Lozano-Torres J.L., Bakker J., Smant G., Schots A. (2016) Co-expression of the protease furin in Nicotiana benthamiana leads to efficient processing of latent transforming growth factor-β1 into a biologically active protein. Plant Biotechnol. J. 14: 1695–1704. 10.1111/pbi.12530 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Nakayama K. (1997) Furin: a mammalian subtilisin/Kex2p-like endoprotease involved in processing of a wide variety of precursor proteins. Biochem. J. 327: 625–635. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Thomas G. (2002) Furin at the Cutting Edge: From Protein Traffic to Embryogenesis and Disease. Nat Rev Mol Cell Biol.3(10):753–66. 10.1038/nrm934 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Pan L.C., Price P.A. (1985) The propeptide of rat bone y-carboxyglutamic acid protein shares homology with other vitamin K-dependent protein precursors. Proc. Natl. Acad. Sci. USA. 82:6109–6113. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Steiner D.F. (1982) Proteolytic processing of secretory Proteins In Molecular Genetic Neuroscience (Schmitt F.O., Bird S.J., Bloom F.E. eds.), pp.149–160. New York: Raven Press. [Google Scholar]
- 13.Wise R.J.,R.J., Pittman D.D., Handin R.I., Kaufman R.J., Orkin S.H. (1988) The propeptide of von Willebr and factor independently mediates the assembly of von Willebr and multimers. Cell. 52, 229–236. . [DOI] [PubMed] [Google Scholar]
- 14.Douglass J., Civelli O., Herbert E. (1984) Polyprotein gene expression: generation of diversity of neuroendocrine peptides. Annu. Rev. Biochem. 53, 665–715. 10.1146/annurev.bi.53.070184.003313 . [DOI] [PubMed] [Google Scholar]
- 15.Thomas G., Thorne B.A., Thomas L., Allen R.G., Hruby D.E., Fuller R., Thorner J. (1988) Yeast KEX2 endopeptidase correctly cleaves a neuroendocrine prohormone in mammalian cells. Science. 241, 226–230. . [DOI] [PubMed] [Google Scholar]
- 16.Sevarino K.A., Stork P., Ventimiglia R., Mandel G., Goodman R.H. (1989) Amino-terminal sequences of prosomatostatin direct intracellular targeting but not processing specificity. Cell. 57, 11–19. . [DOI] [PubMed] [Google Scholar]
- 17.Bravo D.A., Gleason J.B., Sanchez R.I., Roth R.A., Fuller R.S. (1994) Accurate and efficient cleavage of the human insulin proreceptor by the human proprotein-processing protease furin. Characterization and kinetic parameters using the purified, secreted soluble protease expressed by a recombinant baculovirus. J. Biol. Chem. 269, 25830–25837. . [PubMed] [Google Scholar]
- 18.Bresnahan P.A., Leduc R., Thomas L., Thorner J., Gibson H.L., Brake A.J. (1990) Human fur gene encodes a yeast KEX2-like endoprotease that cleaves pro-beta-NGF in vivo. J. Cell Biol. 111, 2851–2859. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Hatsuzawa K., Murakami K., Nakayama K. (1992) Molecular and enzymatic properties of furin, a Kex2-like endoprotease involved in precursor cleavage at Arg-X-Lys/Arg-Arg sites. J. Biochem. 111, 296–301. . [DOI] [PubMed] [Google Scholar]
- 20.Stieneke-Gröber A., Vey M., Angliker H., Shaw E., Thomas G., Roberts C., Klenk H.D., Garten W. (1992) Influenza virus hemagglutinin with multibasic cleavage site is activated by furin, a subtilisin-likeendoprotease. EMBO J. 11, 2407–2414. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Bour S., Geleziunas R., Wainberg M.A. (1995) The human immunodeficiency virus type 1 (HIV-1) CD4 receptor and its central role in promotion of HIV-1 infection. Microbiol. Rev. 59, 63–93. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Zybert I.A., Van der Ende-Metselaar H., Wilschut J., Smit J.M. (2008) Functional importance of dengue virus maturation: infectious properties of immature virions. J. Gen. Virol. 89, 3047–3051. 10.1099/vir.0.2008/002535-0 . [DOI] [PubMed] [Google Scholar]
- 23.Volchkov V.E., Feldmann H., Volchkova V.A., Klenk H.D. (1998) Processing of the Ebola virus glycoprotein by the proprotein convertase furin. Proc. Natl. Acad. Sci. USA. 95, 5762–5767. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Day P.M., Schiller J.T. (2009) The role of furin in papillomavirus infection. Future Microbiol. 4, 1255–1262. 10.2217/fmb.09.86 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Gordon V.M., Leppla S.H. (1994) Proteolytic activation of bacterial toxins: role of bacterial and host cell proteases. Infect. Immun. 62, 333–340. 10.2217/fmb.09.86 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Inocencio N.M., Moehring J.M., Moehring T.J. (1994) Furin activates Pseudomonas exotoxin A by specific cleavage in vivo and in vitro. J. Biol. Chem. 269, 31831–31835. . [PubMed] [Google Scholar]
- 27.Hedner U. (2001) Recombinant factor VIIa (Novoseven) as a hemostatic agent. Semin Hematol. 38(Suppl 12), 43–47. . [DOI] [PubMed] [Google Scholar]
- 28.Roth D.A., Kessler C.M., Pasi J., Rup B., Courter S.G., Tubridy K.L. (2001) Human recombinant factor IX: safety and efficacy studies in hemophilia B patients previously treated with plasma-derived factor IX concentrates. Blood. 98, 3600–3606. . [DOI] [PubMed] [Google Scholar]
- 29.Berbard G.R., Vincent J.L., Laterre P.F., LaRosa S.P., Dhainaut J.F., Lopez-Rodriguez A., Steingrub J.S., Garber G.E., Helterbrand J.D., Ely E.W., Fisher C.J. (2001) Efficacy and safety of recombinant human activated protein C for severe sepsis. New Engl. J. Med. 344, 699–709. 10.1056/NEJM200103083441001 . [DOI] [PubMed] [Google Scholar]
- 30.Orlova N.A., Kovnir S.V., Vorobiev I.I., Gabibov A.G. (2012) Coagulation Factor IX for Hemophilia B Therapy. Acta Naturae. 4, 62–73. . [PMC free article] [PubMed] [Google Scholar]
- 31.Sainsbury F., Thuenemann E.C., Lomonossoff G.P. (2009) pEAQ: versatile expression vectors for easy and quick transient expression of heterologous proteins in plants. Plant Biotechnol. 7, 682–693. 10.1111/j.1467-7652.2009.00434.x . [DOI] [PubMed] [Google Scholar]
- 32.Chichester J A., Manceva S.D., Rhee A., Coffin M.V., Musiychuk K., Mett V., et al. (2013) A plant-produced protective antigen vaccine confers protection in rabbits against a lethal aerosolized challenge with Bacillus anthracis Ames spores. Hum Vaccin Immunother 9, 544–552. 10.4161/hv.23233 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Wu Y., Bressette D., Carrell J.A., Kaufman T., Feng P., Taylor K. et al. (2000).Tumor necrosis factor (TNF) receptor superfamily member TACI is a high affinity receptor for TNF family members APRIL and BLyS. J Biol Chem. 10, 275(45), 35478-85. 10.1074/jbc.M005224200 . [DOI] [PubMed] [Google Scholar]
- 34.Mann K.G., Nesheim M.E., Church W.R., Haley P., Krishnaswamy S.(1990)Surface-dependent reactions of the vitamin K-dependent enzyme complexes.Blood. 1,76(1),1–16.. [PubMed] [Google Scholar]
- 35.Wasley L.C., Rehemtulla A., Bristol J.A., Kaufman R.J. (1993) PACE/furin can process the vitamin K-dependent pro-factor IX precursor within the secretory pathway. J. Biol. Chem. 268, 8458–8465. . [PubMed] [Google Scholar]
- 36.Rehemtulla A., Dorner A.J., Kaufman R.J. (1992) Regulation of PACE propeptide-processing activity: requirement for a post endoplasmic reticulum compartment and autoproteolytic activation. Proc. Natl. Acad. Sci. USA. 89, 8235–8239. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Rehemtulla A., Barr P.J., Rhodes C.J., Kaufman R.J. (1993) PACE4 is a member of the mammalian propeptidase family that has overlapping but not identical substrate specificity to PACE. Biochemistry. 32, 11586–I 1590. 10.1021/bi00094a015 . [DOI] [PubMed] [Google Scholar]
- 38.Gordon V.M., Klimpel K.R., Arora N., Henderson M.A., Leppla S.H. (1995) Proteolytic activation of bacterial toxins by eukaryotic cells is performed by furin and by additional cellular proteases. Infect. Immun. 63: 82–87. . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Molloy SS, Bresnahan PA, Leppla SH, Klimpel KR, Thomas G (1992) Human furin is a calcium-dependent serine endoprotease that recognizes the sequence Arg-X-X-Arg and efficiently cleaves anthrax toxin protective antigen. J Biol Chem 267: 16396–16402. . [PubMed] [Google Scholar]
- 40.Plummer T. H., Elder J. H., Alexander S., Phelan A. W. and Tarantino A. L. (1984) Demonstration of peptide N-glycosidase F activity in endo-$-N-acetylglucosaminidase F preparations. J Biol Chem 259: 10700–4 (1984).. [PubMed] [Google Scholar]
- 41.Tarentino A. L., Quinones G., Trumble A., Changchien L. M., Duceman B., Maley F. and Plummer T. H. Molecular cloning and amino acid sequence of peptide- N4-(N-acetyl—D-glucosaminyl)asparagine amidase from Flavobacterium meningosepticum. (1990) J Biol Chem 265:6961–6966. , [PubMed] [Google Scholar]
- 42.HaÈgglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P. (2004) A new strategy for identificationof N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichmentand partial deglycosylation. J Proteome Res 3:556–66.. [DOI] [PubMed] [Google Scholar]
- 43.Miyazono K, Thyberg J, Heldin CH. (1992) Retention of the transforming growth factor-β1 precursor inthe Golgi complex in a latent endoglycosidase H-sensitive form. Journal of Biological Chemistry 267: 5668–5675. . [PubMed] [Google Scholar]
- 44.Mamedov T, Chichester JA, Jones RM, Ghosh A, Coffin MV, et al. (2016) Production of functionally active and immunogenic non-glycosylated protective antigen from Bacillus anthracis in Nicotiana benthamiana by co-expression with peptide-N-glycosidase F (PNGase F) of Flavobacterium meningosepticum. PLoS One 21;11(4):e0153956 10.1371/journal.pone.0153956 . [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Milne JC, Furlong D, Hanna PC, Wall JS, Collier RJ.Anthrax protective antigen forms oligomers during intoxication of mammalian cells.J Biol Chem. 1994, 269(32):20607–12. . [PubMed] [Google Scholar]
- 46.Henrich S., Cameron A., Bourenkov G.P., Kiefersauer R., Huber R., Lindberg I., Bode W., Than M.E. (2003) The crystal structure of the proprotein processing proteinase furin explains its stringent specificity. Nat. Struct. Biol. 10, 520–526. 10.1038/nsb941 [DOI] [PubMed] [Google Scholar]
- 47.Mamedov T, Ghosh A, Jones RM, Mett V, Farrance CE, et al. (2012) Production of non glycosylated recombinant proteins in Nicotiana benthamiana plants by co-expressing bacterial PNGase F. Plant Biotechnol J 10:773–782. 10.1111/j.1467-7652.2012.00694.x . [DOI] [PubMed] [Google Scholar]
- 48.Mamedov T, Yusibov V. (2013) In vivo deglycosylation of recombinant proteins in plants by co-expression with bacterial PNGase F. Bioengineered 4(5):338–42. 10.4161/bioe.23449 . [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
All relevant data are within the manuscript.