CELL BIOLOGY. For the article “HIF-1α binding to VHL is regulated by stimulus-sensitive proline hydroxylation,” by Fang Yu, Sarah B. White, Quan Zhao, and Frank S. Lee, which appeared in number 17, August 14, 2001, of Proc. Natl. Acad. Sci. USA (98, 9630–9635), the authors note that in the FlagGAL4-HIF-1 (550) fusion protein employed in the experiments described in Fig. 3 D and E, there is a glutamic acid residue between the penta-alanine polylinker and the indicated HIF-1 residues. Thus the peptide liberated following Factor Xa protease treatment of this protein is predicted to contain the following sequence: AAAAAEFSTQDTDLDLEMLAPYIPMDDDFQLR. The conclusions of the paper remain unchanged.
. 2001 Nov 27;98(25):14744.
Correction
Issue date 2001 Dec 4.
Copyright © 2001, The National Academy of Sciences
PMCID: PMC64652
This corrects the article "HIF-1α binding to VHL is regulated by stimulus-sensitive
proline hydroxylation" on page 9630.