Abstract
Transmembrane peptides contain polar residues in the interior of the membrane, which may alter the electrostatic environment and favor hydration in the otherwise nonpolar environment of the membrane core. Here, we demonstrate a general, nonperturbative strategy to probe hydration of the peptide backbone at specific depths within the bilayer using a combination of site-specific isotope labels, ultrafast two-dimensional infrared spectroscopy, and spectral modeling based on molecular dynamics simulations. Our results show that the amphiphilic pH-low insertion peptide supports a highly heterogeneous environment, with significant backbone hydration of nonpolar residues neighboring charged residues. For example, a leucine residue located as far as 1 nm into the hydrophobic bulk reports hydrogen-bonded populations as high as ∼20%. These findings indicate that the polar nature of these residues may facilitate the transport of water molecules into the hydrophobic core of the membrane.
Introduction
Lipid membranes are essential to numerous biological processes, and their multiple functions are rooted in their diverse interfacial environments (1, 2, 3, 4). On its own, a bilayer provides a nanometer-length gradient from a polar, aqueous environment at the interface to a nonpolar hydrophobic environment within the membrane center. However, the lipid-centric view of membranes may be too simplistic because in cell membranes, transmembrane proteins make up ∼50% of the mass, which can significantly alter the bilayer properties (5, 6, 7). In general, residue polarity follows the hydrophilicity of its environment. However, the presence of hydrophilic residues in the alkyl region of a membrane is common. For example, in mitochondrial respiratory chain proteins, as much as ∼24% of lipid-facing residues are polar or charged (4). Their purpose is not understood, but it has been hypothesized that these residues may be energetically favored within certain membrane potentials (8).
Polar residues may substantially alter the electrostatic potential and drive water toward the otherwise hydrophobic regions of the bilayer, but quantifying these effects remains challenging (5, 9). Here, we report a general strategy to study local hydration environments using a combination of ultrafast nonlinear infrared (IR) spectroscopy and nonperturbative, site-specific spectroscopic probes within the backbone of a transmembrane helix.
In this study, we use pH-(low) insertion peptides (pHLIPs) as model membrane peptides. pHLIPs are a family of small amphiphilic peptides that have been extensively studied for their pH-responsive folding and insertion into lipid bilayers. Under acidic conditions, a pHLIP exists as a membrane-embedded α-helix, a property of interest for medicinal applications. For example, recent interest in pHLIP stems from its ability to selectively insert into tumor cells with potential applications for cancer diagnosis and drug delivery (10, 11, 12, 13, 14, 15, 16). The pHLIP sequence is composed of hydrophilic residues interspersed within the hydrophobic region of the lipid bilayer (Fig. 1), providing a polar environment and potentially reducing the free energy for water molecules to penetrate into the alkyl region of the membrane. The specific sequence of pHLIP is AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT.
Figure 1.
(a) pHLIP sequence, colored according to residue hydrophobicity. Green indicates hydrophobic, red indicates acidic, blue indicates basic, and black indicates polar residues. (b) A helix wheel representation. (c) Positions of simulated water molecules (blue) and lipid ester oxygen atoms (gold). (d) Positions of selected peptide residues in the bilayer (from left to right: A13, L24, L28, and A32). To see this figure in color, go online.
IR spectroscopy of amide-I vibrational modes is commonly used as a sensitive nonperturbative probe of peptide structure and hydration (17, 18). A variety of strategies involving localized vibrational probes such as isotope labels or covalently modified residues have been valuable in extracting site-specific information (19, 20, 21, 22, 23). Here, we employ single-site 13C=18O isotope labels, which localize the IR signal to individual residue vibrations by shifting the labeled spectrum out of resonance with the main band, allowing its environment to be studied independently (24, 25, 26, 27, 28, 29, 30, 31).
Isotope-edited IR spectroscopy has been fruitful for uncovering site-specific information of peptides in solution as well as in the membrane (26, 27, 28, 29, 31, 32, 33, 34, 35, 36, 37, 38). For instance, Rothschild and co-workers (35) used isotope labeling to probe the local secondary structure and orientation of the membrane-anchoring region of an ion channel. However, the number of studies involving membrane peptides is small because of key challenges in resolving single-site isotope peaks. The low peptide/lipid ratio required to ensure monomers coupled with the relatively low concentration of the isotope-edited sites compared to unlabeled residues makes isotope peaks difficult to reliably interpret. Resolution-enhancing methods such as Fourier self-deconvolution can circumvent some of these issues, but this relies on strong signal/noise ratio to be effective (39). Two-dimensional (2D) IR (2D IR) spectroscopy has significant advantages for these vibrational modes that are difficult to measure. In brief, 2D IR is a pump-probe IR technique in which a pair of pump pulses excites a specific vibrational frequency, followed by a probe which detects vibrations over a broad frequency range. The signal scales with the fourth power of the dipole moment (40, 41, 42, 43), compared to the second-order scaling of Fourier transform IR (FTIR) spectroscopy, resulting in narrower line shapes, particularly in the isotope region (44). This mitigates overlap in congested spectra resulting in peaks that are easier to isolate.
Spectral features in 2D IR spectroscopy can be interpreted similarly to FTIR spectroscopy (45). For example, an oscillator in a water-exposed heterogeneous environment will exhibit a broader peak than one in a homogeneous environment because of the more diverse environments and faster fluctuations. Most importantly, hydrogen-bonded oscillators will produce peaks red shifted by ∼15 cm−1 per hydrogen bond (H-bond) from its characteristic frequency (46).
To interpret 2D IR data from an atomistic point of view, computational models based on electrostatic maps have been developed for generating amide-I IR spectra from molecular dynamics (MD) simulations (47). Agreement between computed and experimental line shapes implies that MD simulations accurately sample the molecular ensembles observed in the experiment. Over the past decade, these methods have proven useful in interpreting 2D IR spectra of biomolecules, as well as providing a quantitative framework for selecting potential isotope-labeled sites within proteins (47, 48, 49, 50, 51, 52, 53, 54, 55, 56). Here, we use 2D IR spectra of isotope-labeled pHLIP in combination with these computational tools to probe solvent penetration into a 1,2-dimyristoyl-sn-glycero-3-phosphocholine (DMPC) bilayer surrounding a transmembrane peptide.
Methods
Here, we provide a summary of the methods. Additional descriptions are provided in the Supporting Materials and Methods (Sections S1–S5).
Isotope site selection
Residues were selected through structure-based modeling of IR spectra as described below. First, computed main band amide-I spectra for pHLIP in a DMPC bilayer were used to confirm qualitative agreement with the experimental FTIR spectra of the unlabeled peptide. Similarly, isotope-labeled calculations were performed for all 36 residues to identify potential label sites according to the following criteria: 1) Peaks must be narrow and fully resolved from the main band, and 2) residues must be distributed throughout the backbone to sample different membrane depths. Using these two criteria, we selected four sites: A13 is located near the center of the membrane, L24 is primarily within the hydrophobic region but accessible to water, L28 lies at the lipid-water interface, and A32 is fully solvated according to coordinates obtained from simulations. All four isotope peaks are spectrally resolved from the main amide-I band (Fig. S1).
Isotope label synthesis
Isotope-enriched (13C,18O) alanine and leucine were synthesized in-house following the procedure of Marecek et al. (25) from FMOC-protected 13C alanine and 13C leucine (Sigma-Aldrich, St. Louis, MO). Labeled peptides were custom synthesized by Biosynthesis (Lewisville, TX). Peptides were lyophilized to remove residual trifluoroacetic acid before use.
Sample preparation
Unilamellar 100-nm DMPC vesicles were formed by reconstituting dried DMPC to 30 mM in 100 mM MOPS (3-(N-morpholino)propanesulfonic acid) buffer (pH 8.0) followed by extrusion. An aliquot of 2.4 mM pHLIP solution held at pH 8.0 was added to the vesicle suspension until the final peptide concentration was 0.6 mM for each sample. Samples were adjusted to their final pH of 4.0 (values reported here are uncorrected pH readings in D2O) and incubated for 30 min at room temperature before the start of each measurement. Samples were held at pH 4 for two reasons: 1) Previous literature (15) and circular dichroism measurements indicate helical character at this value (see Supporting Materials and Methods, Section S2 c), and 2) deprotonated carboxylate side-chain absorption overlaps with the isotope labels. pHLIP contains six carboxylate side chains, including glutamate and aspartate (57).
2D IR experiments
2D IR spectra were measured at room temperature with a custom-built pulse-shaper-based spectrometer (58). Spectra were collected at a fixed pump-probe delay, or waiting time (t2) of 500 fs and scanned coherence times (t1) up to 3 ps. The frequency resolution along the probe axis is 2.7 cm−1. Pump and probe polarization were perpendicular, and phase cycling was used to remove contributions due to pump scatter. 11.2 million laser shots were collected to produce each spectrum. Diagonal slices were taken 7 cm−1 from the detection axis (shown by the dashed line in Figs. 2 and 3) for comparison with analogous experimental and simulated spectra. All 2D spectra and diagonal slices were normalized to the maximal intensity of the main amide-I peak.
Figure 2.
(a) Experimental (left) and (b) simulated (right) 2D IR spectra of unlabeled pHLIP in a DMPC bilayer (pH 4.0). The isotope-labeled region at frequencies below [ω1, ω3] = 1600, 1610 cm−1 is scaled by a factor of five to highlight the features in this region. The red (positive) peaks represent the ground-state bleach and stimulated emission, and the blue (negative) peaks are due to excited-state absorption. To see this figure in color, go online.
Figure 3.
Experimental (left) and simulated (right) amide-I 2D IR spectra of all isotope-labeled pHLIPs in lipid vesicles. (a and b) A13-labeled peptide; (c and d) L24-labeled peptide; (e and f) L28-labeled peptide; (g and h) A32-labeled peptide. The insets indicate the label region. Because the isotope peaks are small compared to the main band, the insets are plotted at a lower contour level to highlight the features in this region. To see this figure in color, go online.
MD
MD simulations were carried out using Groningen Machine for Chemical Simulations. The initial box was constructed by inserting a single pHLIP into a bilayer consisting of 128 DMPC lipids (64 per leaflet) as generated using CHARMM-GUI (59, 60, 61, 62, 63, 64, 65). Simulations were carried out using the CHARMM36 force field and TIP3P water (66). The system was equilibrated for 2 ns, followed by a 10-ns NPT production run at 300 K and 1 atm. Proper equilibration and convergence was ensured by computing spectra at different points along the production trajectories.
Radial distribution functions (RDFs) and H-bond populations were calculated using built-in Groningen Machine for Chemical Simulations functions over the course of each simulation trajectory. Water RDFs were computed using the backbone carbonyl oxygen as a reference. The number of H-bonds in each simulation frame was computed using a 0.35-nm donor-acceptor distance cutoff and 30° (D-H-A) angle (67, 68).
Spectral calculations
Spectra were calculated from the frequency map parameterized by Tokmakoff and co-workers (47, 53, 54), and the transition charge coupling map was constructed by Jansen and co-workers using the charges defined by the CHARMM36 force field (69, 70). Frequency maps correlate electric fields at the C=O positions computed from MD to the frequency of each amide unit, which become the diagonal elements of the Hamiltonian. Off-diagonal elements, or couplings, are obtained using the nearest-neighbor map of Jansen and co-workers (48, 49, 50, 51, 52). Once a Hamiltonian trajectory is obtained, IR absorption and 2D IR spectra are computed through numerical integration of the Schrodinger equation (NISE) (49). Individual isotope spectra were calculated by red shifting the corresponding Hamiltonian site by 60 cm−1 to reflect the characteristic 13C=18O isotope shift and recomputing the spectrum (71, 72).
Results
Fig. 2 shows experimental (Fig. 2 a) and simulated (Fig. 2 b) 2D IR spectra of the main amide-I band of pHLIP in DMPC (pH 4) with the isotope region (insets). Both spectra are free of signals in the label region, aside from the sloping tail of the main band observed in the experimental spectra. The diagonal, where the excitation and detection frequency are the same, is qualitatively analogous to the signal obtained from an FTIR spectrum (26).
Fig. 3 shows the experimental and simulated spectra for the four isotope-labeled peptides studied here. The key observation is the appearance of peaks below 1610 cm−1 in both the experimental and simulated spectra corresponding to the labeled residues.
Because no distinctive off-diagonal features are observed, the relevant information can be extracted from diagonal slices of the 2D spectra. Further, the main band remains unchanged for the different isotope labels (see Supporting Materials and Methods, Section S4). We focus our analysis on the diagonal slices in the isotope-labeled region (1550–1610 cm−1) as shown in Fig. 4 and interpret the experimental line shapes of each isotope-labeled site separately, comparing them to the simulations before discussing the overall environment of the peptide within the membrane.
Figure 4.
Diagonal slices of the experimental (upper panel) and simulated (lower panel) isotope region of all 2D IR spectra. These diagonals are also indicated as dashed lines in Fig. 3. To see this figure in color, go online.
Unlabeled pHLIP
The main amide-I band of the experimental spectrum is consistent with that of a primarily α-helical peptide, characterized by a single band centered at ∼1650 cm−1. There are no resolved spectral features in the isotope region (inset), indicating an absence of deprotonated carboxylate groups. The baseline is more clearly shown in Fig. 4, which contains the diagonal slices in the isotope region (1550–1610 cm−1). There are no resolved spectral features present in the unlabeled slice except a feature near 1600 cm−1 corresponding to the low frequency edge of the main band. There are also negative features on the low frequency side of several of these spectra. These arise from the interference between the fundamental (ground-state bleach) and overtone (excited-state absorption) bands of the 2D IR spectra. This feature has been observed in other proteins (26) and illustrates one challenge of interpreting 2D IR spectra without accurate structure-based models: this overlap and resultant negative peaks may alter or mask the underlying positive peaks.
The simulated 2D IR spectrum (Fig. 2 b) also appears as a single peak centered at 1650 cm−1. As expected, the simulated spectrum of unlabeled pHLIP shows no features in the isotope region (Fig. 4). Main band line shapes, however, are notably narrower and overall blue-shifted in the simulation. We attribute the origin of this discrepancy to the membrane environment for which the computational model has not yet been parametrized, and thus its heterogeneity is not accurately captured. As described in Supporting Materials and Methods (Section S7), simulated pHLIP spectra in water agree semiquantitatively with experiments (Fig. S10). In the membrane, the low polarity of the lipid tail groups produces a “vacuum-like” electrostatic environment, which, combined with the rigid geometry of the peptide, causes the residue line shapes to be significantly narrower compared to the solution.
Experimentally, main band spectra show no differences for the four isotope labels (Fig. 3), confirming that the peptide conformation is identical for the differently labeled peptides. Because isotopes do not perturb the conformation, these results confirm the consistency and reproducibility of the experiments, particularly because each sample was prepared starting from a different peptide. It is worth noting that there are no crosspeaks detected between the isotope peak and the main band; this is because of the weak coupling among residues in the vibrational Hamiltonian. Isotope peaks show qualitatively different features as a result of different environments. Below, we examine each isotope-labeled spectrum to assess the degree of hydration at each site by qualitative interpretation of the experimental diagonals combined with hydrogen bonding and analysis of water density near each site based on the MD simulations.
A13
The experimental A13 spectrum (Fig. 3 a) contains a single isotope peak centered at 1582 cm−1. The diagonal slice (Fig. 4) shows that this is a narrow peak, indicative of a uniform solvation environment. This peak is blue-shifted with respect to other isotopes, which supports the interpretation that this C=O is primarily dehydrated, and the sharpness of the peak compared to the other label sites indicates conformational homogeneity in the A13 region of the peptide.
Line shapes are in good qualitative agreement between experimental and simulated spectra; in the simulation, a single, blue-shifted isotope peak is present at 1592 cm−1, as expected for a residue in a nonpolar environment. Residue-specific coordinates extracted from the MD trajectory (Fig. 1) show that A13 is embedded near the center of the hydrophobic lipid tail region. The peak is further narrowed by the primarily hydrophobic neighboring residues within the helix, producing a nonpolar, homogeneous environment around this residue.
Further MD analysis involved counting the number of total H-bonds and donor-specific H-bonds per simulation frame using the backbone C=O at each labeled site as the H-bond acceptor. Donor-specific analysis included separately counting peptide-peptide and peptide-water H-bonds. Through this method, we determined that nearly all simulation frames included a single peptide-peptide H-bond. Any frames with two H-bonds contained one peptide-peptide and one peptide-water H-bond. Total H-bond counts for each site are given in Fig. 5 a and are further discussed in the next section.
Figure 5.
(a) Total H-bond populations. (b) Normalized radial distribution functions (RDFs) calculated for water, using the carbonyl oxygen atom as a reference. To see this figure in color, go online.
With this designation, we assign this single A13 peak to a 1-HB population wherein this residue forms helix-stabilizing H-bonds between the carbonyl O and the helical backbone. This type of H-bond is more stable and long-lived than a water H-bond, which results in the peak narrowness observed here.
The intensity and narrow linewidth is consistent with a single H-bond between the carbonyl O and the helical backbone, which is more stable and long-lived than a water H-bond (26, 46). Subsequent H-bond and hydration analysis from MD corroborates this interpretation, revealing a primarily singly hydrogen-bonded ensemble (Fig. 5 a). Compared to the peptide, H-bonds to water produce broader and less intense peaks (26, 46).
Simulated peaks are narrower than the experimental peaks, as observed not only in the main band but also in the isotope signals. Possible contributing factors are discussed in Supporting Materials and Methods (Section S7), and the sharpness of the peak supports the conjecture that the peptide environment in the simulations may be artificially homogeneous because of the membrane electrostatics.
L24
The experimental L24 diagonal slice appears qualitatively similar to the A13 peak but with a shoulder to the red of the main isotope peak, which is suggestive of a second distinct population within the sample. We have assigned the blue-shifted peak to an H-bond with the peptide, making up roughly 80% of the total ensemble. The red-shifted peak, comprising the remaining 20% of the population, is assigned to an H-bond with water because the low intensity and approximate 15 cm−1 red shift is consistent with a solvent H-bond (46). The shoulder illustrates that water molecules penetrate into the L24 region to transiently H-bond with the backbone.
This shoulder is not observed in the simulated spectrum. There is partial qualitative agreement as the peak appears as a narrow stretch on the blue side of the window, but the shoulder is absent, suggesting the absence of water within the L24 region in the MD simulation. Likewise, H-bond counts reveal a predominantly single H-bonded ensemble with no H-bonds to water (Fig. 5 a). Similarly, the RDF indicates a lack of water penetration within the range of 0.35 nm from the carbonyl. This discrepancy may arise from three sources: 1) Water penetration may be slow, and by consequence, our trajectories may not be sufficiently long; 2) the force field underestimates the degree of hydration within the L24 region of the membrane; and 3) although unlikely, interactions between peptides may contribute to hydrogen bonding. Previous literature has not cited multimerization at the experimental pH or concentration (73, 74), and control experiments have not detected any aggregation (Fig. S7), but peptide-peptide interactions cannot be entirely ruled out with the methods used here. The second suggestion is more plausible, as we have demonstrated in Supporting Materials and Methods (Section S7) that our system is converged within the 10 ns simulation time; although it is still conceivable that fluctuations slower than 10 ns are not captured, which indicates a need for more powerful, multiscale simulations, to more completely sample the structural ensembles within this model system.
Overall, the experimental line shapes suggest that this site is primarily enclosed within the hydrophobic bulk of the lipid membrane, as indicated by the sharp blue-shifted peak, and the shoulder on the red side corresponds to a small 2-HB population between the amide C=O and transient water.
L28
In contrast with the A13 and L24 sites, both experimental and simulated L28-labeled spectra appear broader and lower in intensity. Diagonal broadening supports the interpretation of multiple different H-bond populations within this region. The experimental diagonal band is composed of two peaks centered at 1573 and 1560 cm−1, respectively, indicative of 1-HB and 2-HB populations. We approximate the single H-bond population to compose 60% of the total ensemble and the double H-bond population to compose 40%. The red shifts and lower intensity of these peaks suggest that L28 is partially water exposed. The low intensity of the red-shifted peak also indicates a more heterogeneous environment at this position.
The simulated spectrum shows similar broadening; however, it appears more blue-shifted than the experimental spectrum with the two peaks centered at 1590 and 1575 cm−1 with roughly equivalent populations to those observed in experiment. We attribute the blue shift to the same artificially homogeneous environment described earlier, which is further discussed in Supporting Materials and Methods (Section S7). According to the MD trajectory, the L28 site is characterized by two distinct H-bonding populations in which the peptide backbone is H-bonded to water in ∼70% of the snapshots. This agrees semiquantitatively with experiments, and we hypothesize that part of the discrepancy in the estimated populations between experiments and this analysis are due to the nonlinear scaling of 2D IR signals discussed earlier. Whereas the MD analysis presents the 2-HB population to be greater than the 1-HB, experimental 2D IR signals show the opposite trend. These observations can be attributed to the transient nature of a peptide-solvent H-bond compared to a peptide-peptide H-bond, explaining the origin of the larger peptide H-bond peak. The RDF (Fig. 5 b) further supports this interpretation because it shows significant water density within the vicinity of the backbone at the L28 position. The first and second solvation shell peaks at 0.18 and 0.28 nm are sharp and narrow, showing that waters molecules are locked into well-defined conformations around the peptide. The presence of confined water is expected because the MD trajectory reveals that L28 resides in an area of intermediate polarity at the interface between the hydrophobic and solvated regions of the membrane where water networks may be severely disrupted compared to the bulk (Fig. 1).
A32
The experimental A32 label peak is weak and broadened, appearing on the red side of the isotope region as two peaks of approximately equal intensity at 1580 and 1565 cm−1. The bimodal character of this feature is reproduced in the simulated spectrum, albeit with an overall frequency shift toward lower frequencies, with the two peaks appearing at 1570 and 1580 cm−1. Additionally, the populations do not match those represented in experiment, with the single H-bond peak representing only 30% of the ensemble. H-bond analysis of the MD trajectory reveals that A32 also contains two distinct environments corresponding to 1-HB and 2-HB populations (Fig. 5 a). Similar to L28, the two peaks can be assigned to a single peptide H-bond (1565 cm−1) and a peptide H-bond plus a water H-bond (1580 cm−1), respectively. In a more quantitative analysis, discrepancies arise between computed H-bond populations and the estimated populations based on the A32 2D IR spectra, wherein simulations underestimate the hydrogen-bond populations at this site. This system was equilibrated with structural restraints to maintain a transmembrane, helical conformation, and although these constraints were relaxed during equilibration and removed during the production MD run, it is possible that the simulation may undersample the peptide conformational landscape. In particular, slower fluctuations beyond the nanosecond timescale cannot be captured by this 10-ns simulation. This may result in a higher helical character, which could lead to the recorded over- and underestimation of peptide and solvent H-bonds, respectively.
Discussion
In general, spectral predictions from MD simulations are in qualitative agreement with experimental 2D IR slices, which enables us to interpret the solvation environment of pHLIP in a DMPC bilayer. Consistently, spectral linewidths from simulation are narrower than their analogous experimental spectra in both the main amide-I and the amide-I isotope region. The source of the narrow line shapes can be attributed to two different factors: first, our trajectories are unlikely to sample the full conformational landscape of the peptide because structural rearrangements can occur on the microsecond timescales or beyond; and second, these computational models are predominantly parametrized for solvated peptides and may require further development to capture the heterogeneous environments produced by the bilayer. Supporting Materials and Methods (Section S7) show the effects of the membrane charges on the computed spectra. In brief, setting the lipid tail group charges to zero has minimal effect on the line shapes, which indicates that according to the model, the membrane has no effect on frequencies, essentially acting as a “vacuum” with respect to electrostatics. Thus, the line shapes may be artificially narrowed by this environment. As such, this leads to simulated spectra being more sensitive to single water molecules interacting with the backbone.
We have observed within our experiments that rigid residue-residue interactions that stabilize the helix backbone result in intense, blue-shifted line shapes compared to more solvated carbonyls. The A13 label indicates that effectively no water penetrates into the membrane and that this site is surrounded by both hydrophobic and bulky residues that likely also resist water penetration. L24, which is closely adjacent to the hydrophobic lipid tails and is neighbored by hydrophobic and bulky residues, reported a small degree of water penetration indicated by experimental hydrogen-bonded peaks. The L28 data depict two distinct states: one in which L28 is only H-bonding with other peptide residues and one in which it is water exposed. This site is an ideal candidate to investigate the role of the lipid structure, including aliphatic tail lengths, by performing similar analyses on membranes with distinct compositions. The A32 experimental data are consistent with a solvated residue, whereas the simulation underestimates the water content at this site.
Altogether, these site-specific peptide probes enabled us to view water penetration into the hydrophobic region of the bilayer, which may be otherwise thermodynamically unfavorable in peptide-free bilayers. Previous literature has observed negligible water presence beyond the ester carbonyl in pure lipid membranes (75, 76, 77) and has also suggested that embedded amino acids and peptides may facilitate water diffusion across lipid bilayers and into the alkyl bulk (6, 78, 79, 80, 81, 82). Our results are consistent with this literature; however, additional methods beyond the scope of this study are required to rule out potential peptide multimers in the membrane.
Conclusions
Our results provide concrete experimental evidence of water permeation into the DMPC lipid bilayer using a series of site-specific probes of backbone hydration. Introducing single-residue 13C=18O isotope labels additionally allowed us to probe local environments at various embedding depths, and we captured increased hydration facilitated by a transmembrane peptide.
In summary, our conclusions are as follows: 1) We demonstrate the capabilities of isotope-edited 2D IR spectroscopy for examining site-specific hydration levels that are otherwise difficult to access with most common biophysical techniques; 2) residues in pHLIP that are fully inserted in the membrane core remain hydrated, and the polar residues may facilitate water penetration into the hydrophobic region of a DMPC bilayer; 3) MD simulations underrepresent solvation and water interactions; and 4) further improvements in electrostatic maps and MD should more accurately capture the effect of membrane electrostatics.
These studies showcase the advanced sensitivity of 2D IR over traditional FTIR experiments to successfully resolve low-concentration spectra above background signals. The diagonal slices of these 2D IR spectra give us an analog to FTIR spectra, which we can use to identify hydrogen-bond populations. Simulations serve to interpret experimental data from an atomistic perspective. Our evidence suggests that current models are unlikely to accurately reproduce hydrogen-bond ensembles within the bilayer, which may have important implications for modeling transmembrane proteins. Further improvements to the model will enable more quantitative comparisons between simulations and experiments.
Author Contributions
C.R.B. conceived the study. C.R.B. and J.C.F. designed the experiments. J.C.F. carried out the experiments and simulations. J.C.F. analyzed the data. C.R.B. and J.C.F. wrote the manuscript.
Acknowledgments
We thank Chi-Jui Feng (University of Chicago) for assistance in computing spectra from MD simulations, and Thomas la Cour Jansen (University of Groningen) for providing the NISE code.
This work has been supported by the Welch Foundation (F-1891) and the National Science Foundation (BIO-1815354). MD simulations were carried out at the Texas Advanced Computing Center.
Editor: Arne Gericke.
Footnotes
Supporting Material can be found online at https://doi.org/10.1016/j.bpj.2019.03.002.
Supporting Citations
References (83, 84, 85) appear in the Supporting Material.
Supporting Material
References
- 1.Henzler-Wildman K., Kern D. Dynamic personalities of proteins. Nature. 2007;450:964–972. doi: 10.1038/nature06522. [DOI] [PubMed] [Google Scholar]
- 2.Oh K.I., Smith-Dupont K.B., Gai F. Kinetics of peptide folding in lipid membranes. Biopolymers. 2015;104:281–290. doi: 10.1002/bip.22640. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Cymer F., von Heijne G., White S.H. Mechanisms of integral membrane protein insertion and folding. J. Mol. Biol. 2015;427:999–1022. doi: 10.1016/j.jmb.2014.09.014. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Müller D.J., Wu N., Palczewski K. Vertebrate membrane proteins: structure, function, and insights from biophysical approaches. Pharmacol. Rev. 2008;60:43–78. doi: 10.1124/pr.107.07111. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Johansson A.C., Lindahl E. Protein contents in biological membranes can explain abnormal solvation of charged and polar residues. Proc. Natl. Acad. Sci. USA. 2009;106:15684–15689. doi: 10.1073/pnas.0905394106. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Heyden M., Freites J.A., Tobias D.J. Assembly and stability of α-helical membrane proteins. Soft Matter. 2012;8:7742–7752. doi: 10.1039/C2SM25402F. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Siaw H.M.H., Raghunath G., Dyer R.B. Peripheral protein unfolding drives membrane bending. Langmuir. 2018;34:8400–8407. doi: 10.1021/acs.langmuir.8b01136. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.von Heijne G. Membrane protein structure prediction. Hydrophobicity analysis and the positive-inside rule. J. Mol. Biol. 1992;225:487–494. doi: 10.1016/0022-2836(92)90934-c. [DOI] [PubMed] [Google Scholar]
- 9.Wang Z., Jumper J.M., Sosnick T.R. A membrane burial potential with H-bonds and applications to curved membranes and fast simulations. Biophys. J. 2018;115:1872–1884. doi: 10.1016/j.bpj.2018.10.012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Fendos J., Barrera F.N., Engelman D.M. Aspartate embedding depth affects pHLIP’s insertion pKa. Biochemistry. 2013;52:4595–4604. doi: 10.1021/bi400252k. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Andreev O.A., Engelman D.M., Reshetnyak Y.K. pH-sensitive membrane peptides (pHLIPs) as a novel class of delivery agents. Mol. Membr. Biol. 2010;27:341–352. doi: 10.3109/09687688.2010.509285. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Andreev O.A., Karabadzhak A.G., Reshetnyak Y.K. pH (low) insertion peptide (pHLIP) inserts across a lipid bilayer as a helix and exits by a different path. Proc. Natl. Acad. Sci. USA. 2010;107:4081–4086. doi: 10.1073/pnas.0914330107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Vāvere A.L., Biddlecombe G.B., Lewis J.S. A novel technology for the imaging of acidic prostate tumors by positron emission tomography. Cancer Res. 2009;69:4510–4516. doi: 10.1158/0008-5472.CAN-08-3781. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Wiedman G., Wimley W.C., Hristova K. Testing the limits of rational design by engineering pH sensitivity into membrane-active peptides. Biochim. Biophys. Acta. 2015;1848:951–957. doi: 10.1016/j.bbamem.2014.12.023. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Hunt J.F., Rath P., Engelman D.M. Spontaneous, pH-dependent membrane insertion of a transbilayer alpha-helix. Biochemistry. 1997;36:15177–15192. doi: 10.1021/bi970147b. [DOI] [PubMed] [Google Scholar]
- 16.Barrera F.N., Weerakkody D., Engelman D.M. Roles of carboxyl groups in the transmembrane insertion of peptides. J. Mol. Biol. 2011;413:359–371. doi: 10.1016/j.jmb.2011.08.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Barth A., Zscherp C. What vibrations tell us about proteins. Q. Rev. Biophys. 2002;35:369–430. doi: 10.1017/s0033583502003815. [DOI] [PubMed] [Google Scholar]
- 18.Barth A. Infrared spectroscopy of proteins. Biochim. Biophys. Acta. 2007;1767:1073–1101. doi: 10.1016/j.bbabio.2007.06.004. [DOI] [PubMed] [Google Scholar]
- 19.van Wilderen L.J., Kern-Michler D., Bredenbeck J. Vibrational dynamics and solvatochromism of the label SCN in various solvents and hemoglobin by time dependent IR and 2D-IR spectroscopy. Phys. Chem. Chem. Phys. 2014;16:19643–19653. doi: 10.1039/c4cp01498g. [DOI] [PubMed] [Google Scholar]
- 20.Le Sueur A.L., Horness R.E., Thielges M.C. Applications of two-dimensional infrared spectroscopy. Analyst. 2015;140:4336–4349. doi: 10.1039/c5an00558b. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Chalyavi F., Hogle D.G., Tucker M.J. Tyrosine as a non-perturbing site-specific vibrational reporter for protein dynamics. J. Phys. Chem. B. 2017;121:6380–6389. doi: 10.1021/acs.jpcb.7b04999. [DOI] [PubMed] [Google Scholar]
- 22.Ma J., Pazos I.M., Gai F. Site-specific infrared probes of proteins. Annu. Rev. Phys. Chem. 2015;66:357–377. doi: 10.1146/annurev-physchem-040214-121802. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Serrano A.L., Waegele M.M., Gai F. Spectroscopic studies of protein folding: linear and nonlinear methods. Protein Sci. 2012;21:157–170. doi: 10.1002/pro.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.MacKenzie K.R., Prestegard J.H., Engelman D.M. A transmembrane helix dimer: structure and implications. Science. 1997;276:131–133. doi: 10.1126/science.276.5309.131. [DOI] [PubMed] [Google Scholar]
- 25.Marecek J., Song B., Raleigh D.P. A simple and economical method for the production of 13C,18O-labeled Fmoc-amino acids with high levels of enrichment: applications to isotope-edited IR studies of proteins. Org. Lett. 2007;9:4935–4937. doi: 10.1021/ol701913p. [DOI] [PubMed] [Google Scholar]
- 26.Baiz C.R., Tokmakoff A. Structural disorder of folded proteins: isotope-edited 2D IR spectroscopy and Markov state modeling. Biophys. J. 2015;108:1747–1757. doi: 10.1016/j.bpj.2014.12.061. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Shim S.H., Gupta R., Zanni M.T. Two-dimensional IR spectroscopy and isotope labeling defines the pathway of amyloid formation with residue-specific resolution. Proc. Natl. Acad. Sci. USA. 2009;106:6614–6619. doi: 10.1073/pnas.0805957106. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Smith A.W., Tokmakoff A. Amide I two-dimensional infrared spectroscopy of β-hairpin peptides. J. Chem. Phys. 2007;126:045109. doi: 10.1063/1.2428300. [DOI] [PubMed] [Google Scholar]
- 29.Ganim Z., Chung H.S., Tokmakoff A. Amide I two-dimensional infrared spectroscopy of proteins. Acc. Chem. Res. 2008;41:432–441. doi: 10.1021/ar700188n. [DOI] [PubMed] [Google Scholar]
- 30.Krejtschi C., Wu L., Keiderling T.A. Site-specific folding dynamics of isotopically labeled peptides studied by time-resolved infrared-spectroscopy. Biophys. J. 2009;96:73a. [Google Scholar]
- 31.Torres J., Kukol A., Arkin I.T. Site-specific examination of secondary structure and orientation determination in membrane proteins: the peptidic (13)C=(18)O group as a novel infrared probe. Biopolymers. 2001;59:396–401. doi: 10.1002/1097-0282(200111)59:6<396::AID-BIP1044>3.0.CO;2-Y. [DOI] [PubMed] [Google Scholar]
- 32.Sackett K., Shai Y. The HIV fusion peptide adopts intermolecular parallel β-sheet structure in membranes when stabilized by the adjacent N-terminal heptad repeat: a 13C FTIR study. J. Mol. Biol. 2005;350:790–805. doi: 10.1016/j.jmb.2005.05.030. [DOI] [PubMed] [Google Scholar]
- 33.Manor J., Arbely E., Arkin I.T. Use of isotope-edited FTIR to derive a backbone structure of a transmembrane protein. J. Phys. Chem. Lett. 2014;5:2573–2579. doi: 10.1021/jz501055d. [DOI] [PubMed] [Google Scholar]
- 34.Ludlam C.F., Sonar S., Rothschild K.J. Site-directed isotope labeling and ATR-FTIR difference spectroscopy of bacteriorhodopsin: the peptide carbonyl group of Tyr 185 is structurally active during the bR-->N transition. Biochemistry. 1995;34:2–6. doi: 10.1021/bi00001a001. [DOI] [PubMed] [Google Scholar]
- 35.Ludlam C.F., Arkin I.T., Rothschild K.J. Fourier transform infrared spectroscopy and site-directed isotope labeling as a probe of local secondary structure in the transmembrane domain of phospholamban. Biophys. J. 1996;70:1728–1736. doi: 10.1016/S0006-3495(96)79735-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Tatulian S.A. Attenuated total reflection Fourier transform infrared spectroscopy: a method of choice for studying membrane proteins and lipids. Biochemistry. 2003;42:11898–11907. doi: 10.1021/bi034235+. [DOI] [PubMed] [Google Scholar]
- 37.Rodionova N.A., Tatulian S.A., Tamm L.K. Characterization of two membrane-bound forms of OmpA. Biochemistry. 1995;34:1921–1929. doi: 10.1021/bi00006a013. [DOI] [PubMed] [Google Scholar]
- 38.Gordon L.M., Mobley P.W., Waring A.J. Conformational mapping of the N-terminal peptide of HIV-1 gp41 in lipid detergent and aqueous environments using 13C-enhanced Fourier transform infrared spectroscopy. Protein Sci. 2004;13:1012–1030. doi: 10.1110/ps.03407704. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Byler D.M., Susi H. Examination of the secondary structure of proteins by deconvolved FTIR spectra. Biopolymers. 1986;25:469–487. doi: 10.1002/bip.360250307. [DOI] [PubMed] [Google Scholar]
- 40.Ataka K., Kottke T., Heberle J. Thinner, smaller, faster: IR techniques to probe the functionality of biological and biomimetic systems. Angew. Chem. Int.Engl. 2010;49:5416–5424. doi: 10.1002/anie.200907114. [DOI] [PubMed] [Google Scholar]
- 41.Deflores L.P., Ganim Z., Tokmakoff A. Amide I′-II’ 2D IR spectroscopy provides enhanced protein secondary structural sensitivity. J. Am. Chem. Soc. 2009;131:3385–3391. doi: 10.1021/ja8094922. [DOI] [PubMed] [Google Scholar]
- 42.Zanni M.T. Two-dimensional infrared spectroscopy measures the structural dynamics of a self-assembled film only one molecule thick. Proc. Natl. Acad. Sci. USA. 2016;113:4890–4891. doi: 10.1073/pnas.1605263113. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Grechko M., Zanni M.T. Quantification of transition dipole strengths using 1D and 2D spectroscopy for the identification of molecular structures via exciton delocalization: application to α-helices. J. Chem. Phys. 2012;137:184202. doi: 10.1063/1.4764861. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Petti M.K., Lomont J.P., Zanni M.T. Two-dimensional spectroscopy is being used to address core scientific questions in biology and materials science. J. Phys. Chem. B. 2018;122:1771–1780. doi: 10.1021/acs.jpcb.7b11370. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Hamm P., Zanni M.T. Cambridge University Press; Cambridge, UK: 2011. Concepts and Methods of 2D Infrared Spectroscopy. [Google Scholar]
- 46.Kim Y.S., Hochstrasser R.M. Applications of 2D IR spectroscopy to peptides, proteins, and hydrogen-bond dynamics. J. Phys. Chem. B. 2009;113:8231–8251. doi: 10.1021/jp8113978. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Reppert M., Tokmakoff A. Computational amide I 2D IR spectroscopy as a probe of protein structure and dynamics. Annu. Rev. Phys. Chem. 2016;67:359–386. doi: 10.1146/annurev-physchem-040215-112055. [DOI] [PubMed] [Google Scholar]
- 48.Jansen T., Knoester J. Nonadiabatic effects in the two-dimensional infrared spectra of peptides: application to alanine dipeptide. J. Phys. Chem. B. 2006;110:22910–22916. doi: 10.1021/jp064795t. [DOI] [PubMed] [Google Scholar]
- 49.Jansen T.L., Knoester J. Waiting time dynamics in two-dimensional infrared spectroscopy. Acc. Chem. Res. 2009;42:1405–1411. doi: 10.1021/ar900025a. [DOI] [PubMed] [Google Scholar]
- 50.Jansen T.L., Auer B.M., Skinner J.L. Two-dimensional infrared spectroscopy and ultrafast anisotropy decay of water. J. Chem. Phys. 2010;132:224503. doi: 10.1063/1.3454733. [DOI] [PubMed] [Google Scholar]
- 51.Liang C., Jansen T.L. An efficient N(3)-scaling propagation scheme for simulating two-dimensional infrared and visible spectra. J. Chem. Theory Comput. 2012;8:1706–1713. doi: 10.1021/ct300045c. [DOI] [PubMed] [Google Scholar]
- 52.Liang C., Louhivuori M., Knoester J. Vibrational spectra of a mechanosensitive channel. J. Phys. Chem. Lett. 2013;4:448–452. doi: 10.1021/jz3019258. [DOI] [PubMed] [Google Scholar]
- 53.Reppert M., Tokmakoff A. Electrostatic frequency shifts in amide I vibrational spectra: direct parameterization against experiment. J. Chem. Phys. 2013;138:134116. doi: 10.1063/1.4798938. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Reppert M., Roy A.R., Tokmakoff A. Isotope-enriched protein standards for computational amide I spectroscopy. J. Chem. Phys. 2015;142:125104. doi: 10.1063/1.4915271. [DOI] [PubMed] [Google Scholar]
- 55.Ghosh A., Ostrander J.S., Zanni M.T. Watching proteins wiggle: mapping structures with two-dimensional infrared spectroscopy. Chem. Rev. 2017;117:10726–10759. doi: 10.1021/acs.chemrev.6b00582. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Edington S.C., Flanagan J.C., Baiz C.R. An empirical IR frequency map for ester C═O stretching vibrations. J. Phys. Chem. A. 2016;120:3888–3896. doi: 10.1021/acs.jpca.6b02887. [DOI] [PubMed] [Google Scholar]
- 57.Venyaminov S. Yu, Kalnin N.N. Quantitative IR spectrophotometry of peptide compounds in water (H2O) solutions. I. Spectral parameters of amino acid residue absorption bands. Biopolymers. 1990;30:1243–1257. doi: 10.1002/bip.360301309. [DOI] [PubMed] [Google Scholar]
- 58.Edington S.C., Gonzalez A., Baiz C.R. Coordination to lanthanide ions distorts binding site conformation in calmodulin. Proc. Natl. Acad. Sci. USA. 2018;115:E3126–E3134. doi: 10.1073/pnas.1722042115. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Lee J., Cheng X., Im W. CHARMM-GUI input generator for NAMD, GROMACS, AMBER, openMM, and CHARMM/OpenMM simulations using the CHARMM36 additive force field. J. Chem. Theory Comput. 2016;12:405–413. doi: 10.1021/acs.jctc.5b00935. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Wu E.L., Cheng X., Im W. CHARMM-GUI membrane builder toward realistic biological membrane simulations. J. Comput. Chem. 2014;35:1997–2004. doi: 10.1002/jcc.23702. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61.Jo S., Lim J.B., Im W. CHARMM-GUI membrane builder for mixed bilayers and its application to yeast membranes. Biophys. J. 2009;97:50–58. doi: 10.1016/j.bpj.2009.04.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Jo S., Kim T., Im W. Automated builder and database of protein/membrane complexes for molecular dynamics simulations. PLoS One. 2007;2:e880. doi: 10.1371/journal.pone.0000880. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Jo S., Kim T., Im W. CHARMM-GUI: a web-based graphical user interface for CHARMM. J. Comput. Chem. 2008;29:1859–1865. doi: 10.1002/jcc.20945. [DOI] [PubMed] [Google Scholar]
- 64.Brooks B.R., Brooks C.L., III, Karplus M. CHARMM: the biomolecular simulation program. J. Comput. Chem. 2009;30:1545–1614. doi: 10.1002/jcc.21287. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Jo S., Cheng X., Im W. CHARMM-GUI PDB manipulator for advanced modeling and simulations of proteins containing nonstandard residues. Adv. Protein Chem. Struct. Biol. 2014;96:235–265. doi: 10.1016/bs.apcsb.2014.06.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Jorgensen W.L., Chandrasekhar J., Klein M.L. Comparison of simple potential functions for simulating liquid water. J. Chem. Phys. 1983;79:926–935. [Google Scholar]
- 67.Abraham M.J., Murtola T., Lindahl E. GROMACS: high performance molecular simulations through multi-level parallelism from laptops to supercomputers. SoftwareX. 2015;1–2:19–25. [Google Scholar]
- 68.van der Spoel D., van Maaren P.J., Tîmneanu N. Thermodynamics of hydrogen bonding in hydrophilic and hydrophobic media. J. Phys. Chem. B. 2006;110:4393–4398. doi: 10.1021/jp0572535. [DOI] [PubMed] [Google Scholar]
- 69.Huang J., MacKerell A.D., Jr. CHARMM36 all-atom additive protein force field: validation based on comparison to NMR data. J. Comput. Chem. 2013;34:2135–2145. doi: 10.1002/jcc.23354. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 70.la Cour Jansen T., Dijkstra A.G., Knoester J. Modeling the amide I bands of small peptides. J. Chem. Phys. 2006;125:44312. doi: 10.1063/1.2218516. [DOI] [PubMed] [Google Scholar]
- 71.Husseini F.S., Robinson D., Hirst J.D. Computing infrared spectra of proteins using the exciton model. J. Comput. Chem. 2017;38:1362–1375. doi: 10.1002/jcc.24674. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Wang L., Middleton C.T., Skinner J.L. 2DIR spectroscopy of human amylin fibrils reflects stable β-sheet structure. J. Am. Chem. Soc. 2011;133:16062–16071. doi: 10.1021/ja204035k. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 73.Daumar P., Wanger-Baumann C.A., Lewis J.S. Efficient (18)F-labeling of large 37-amino-acid pHLIP peptide analogues and their biological evaluation. Bioconjug. Chem. 2012;23:1557–1566. doi: 10.1021/bc3000222. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 74.Reshetnyak Y.K., Segala M., Engelman D.M. A monomeric membrane peptide that lives in three worlds: in solution, attached to, and inserted across lipid bilayers. Biophys. J. 2007;93:2363–2372. doi: 10.1529/biophysj.107.109967. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 75.Hansen F.Y., Peters G.H., Miskowiec A. Diffusion of water and selected atoms in DMPC lipid bilayer membranes. J. Chem. Phys. 2012;137:204910. doi: 10.1063/1.4767568. [DOI] [PubMed] [Google Scholar]
- 76.Das J., Flenner E., Kosztin I. Anomalous diffusion of water molecules in hydrated lipid bilayers. J. Chem. Phys. 2013;139:065102. doi: 10.1063/1.4817322. [DOI] [PubMed] [Google Scholar]
- 77.von Hansen Y., Gekle S., Netz R.R. Anomalous anisotropic diffusion dynamics of hydration water at lipid membranes. Phys. Rev. Lett. 2013;111:118103. doi: 10.1103/PhysRevLett.111.118103. [DOI] [PubMed] [Google Scholar]
- 78.Kong X., Zhao Z., Jiang J. Dipeptides embedded in a lipid bilayer membrane as synthetic water channels. Langmuir. 2017;33:11490–11495. doi: 10.1021/acs.langmuir.7b02060. [DOI] [PubMed] [Google Scholar]
- 79.Kristensen K., Ehrlich N., Andresen T.L. Single-vesicle detection and analysis of peptide-induced membrane permeabilization. Langmuir. 2015;31:2472–2483. doi: 10.1021/la504752u. [DOI] [PubMed] [Google Scholar]
- 80.Fiedler S., Broecker J., Keller S. Protein folding in membranes. Cell. Mol. Life Sci. 2010;67:1779–1798. doi: 10.1007/s00018-010-0259-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81.Jusoh S.A., Helms V. Helical integrity and microsolvation of transmembrane domains from Flaviviridae envelope glycoproteins. Biochim. Biophys. Acta. 2011;1808:1040–1049. doi: 10.1016/j.bbamem.2011.01.004. [DOI] [PubMed] [Google Scholar]
- 82.Perkins R., Vaida V. Phenylalanine increases membrane permeability. J. Am. Chem. Soc. 2017;139:14388–14391. doi: 10.1021/jacs.7b09219. [DOI] [PubMed] [Google Scholar]
- 83.Holzwarth G., Doty P. The ultraviolet circular dichroism of polypeptides. J. Am. Chem. Soc. 1965;87:218–228. doi: 10.1021/ja01080a015. [DOI] [PubMed] [Google Scholar]
- 84.Venyaminov SYu, Baikalov I.A., Yang J.T. Circular dichroic analysis of denatured proteins: inclusion of denatured proteins in the reference set. Anal. Biochem. 1993;214:17–24. doi: 10.1006/abio.1993.1450. [DOI] [PubMed] [Google Scholar]
- 85.Lewis R.N., McElhaney R.N. Membrane lipid phase transitions and phase organization studied by Fourier transform infrared spectroscopy. Biochim. Biophys. Acta. 2013;1828:2347–2358. doi: 10.1016/j.bbamem.2012.10.018. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.