Skip to main content
BioMed Research International logoLink to BioMed Research International
. 2019 May 8;2019:8702968. doi: 10.1155/2019/8702968

A Statistical Similarity/Dissimilarity Analysis of Protein Sequences Based on a Novel Group Representative Vector

Marwa A Abd Elwahaab 1,, Mervat M Abo-Elkhier 1, Moheb I Abo el Maaty 1
PMCID: PMC6530227  PMID: 31205946

Abstract

Similarity/dissimilarity analysis is a key way of understanding the biology of an organism by knowing the origin of the new genes/sequences. Sequence data are grouped in terms of biological relationships. The number of sequences related to any group is susceptible to be increased every day. All the present alignment-free methods approve the utility of their approaches by producing a similarity/dissimilarity matrix. Although this matrix is clear, it measures the degree of similarity among sequences individually. In our work, a representative of each of three groups of protein sequences is introduced. A similarity/dissimilarity vector is evaluated instead of the ordinary similarity/dissimilarity matrix based on the group representative. The approach is applied on three selected groups of protein sequences: beta globin, NADH dehydrogenase subunit 5 (ND5), and spike protein sequences. A cross-grouping comparison is produced to ensure the singularity of each group. A qualitative comparison between our approach, previous articles, and the phylogenetic tree of these protein sequences proved the utility of our approach.

1. Introduction

Sequence comparison is used to study structural and functional conservation and evolutionary relations among the sequences. The importance of similarity/dissimilarity of biological sequences returns to its relationship with the structures and functions. Proteins with similar sequences usually have similar structures. The rate of addition of new sequences to the databases is increasing exponentially [1]. Comparing these new sequences to those with known functions is a key way of understanding the biology of an organism. Thus, sequence analysis can be used to assign function to genes and proteins by the study of the similarities between the compared sequences. There are many tools and techniques that provide the sequence comparisons.

Sequence comparison can be classified into alignment-based methods and alignment-free methods [2, 3]. Alignment-based methods assign scores to different possible alignments, picking the alignment with the highest score. Some algorithms do global alignment or local alignment [46]. BLAST [7] and FASTA [8] are the most widely used applications. Alignment-based methods are computationally difficult with multiple sequence alignments at the same time. A wide range of scoring systems has been proposed such as amino acid substitution scoring matrices PAM and BLOSUM for protein alignment [9].

Alignment-free approaches overcome the limitations of alignment-based methods. Graphical representation approaches are one of them. Graphical representations are usually accompanied by numerical characterization and then a descriptor to describe each protein sequence. A similarity/dissimilarity analysis is then done using these descriptors by evaluating Euclidean distance or correlation angle among them. The smallest Euclidean distance or correlation angle is the more similar. Many graphical representations of DNA and protein primary sequences have been proposed. Some other approaches characterize numerically protein sequences without previous graphical representation and nongraphical representation methods [10, 11].

In this article, an alignment-free method is introduced. It is considered a nongraphical representation method. Three groups of protein sequences are selected to illustrate our approach. They are beta globin, NADH dehydrogenase subunit 5 (ND5), and spike protein sequences. They are selected as each group has sequences of similar range of lengths. The most common sequences of each group are selected. The selected sample is assumed to be unbiased and the population distribution of each group is normal. Therefore, the selected sample represents the group. Statistics can be used to estimate the population's parameters. The adjacency vector is introduced as a novel descriptor for protein sequences. It is computed for each sequence in the selected sample of three groups. A reference vector is then computed for each group. This vector acts as a representative of the group. Each sequence's degree of similarity in each group is measured according to its group's representative vector. So, a similarity/dissimilarity vector is constructed instead of ordinary similarity/dissimilarity matrix. Our approach is independent of the protein sequence length. It does not require any previous graphical representation. It is a mathematically simple approach.

2. Dataset, Technology, and Tools

The protein sequences used in this article are listed in Tables 1, 2, and 3. The sequences are downloaded from the National Center for Biotechnology Information (NCBI) “https://www.ncbi.nlm.nih.gov/” as FASTA files. These FASTA files are imported into Wolfram Mathematica 8 where all the results and figures are produced. The phylogenetic tree of these protein sequences is also created by the Basic Local Alignment Search Tool (BLAST) “https://blast.ncbi.nlm.nih.gov/Blast.cgi”.

Table 1.

The basic information of seven beta globin protein sequences.

No. Species Access No. Length
1 Human AAA16334 147
2 Chimpanzee CAA26204 125
3 Gorilla CAA43421 121
4 Mouse CAA24101 147
5 Rat CAA29887 147
6 Gallus CAA23700 147
7 Opossum AAA30976 147

Table 2.

The basic information of nine ND5 protein sequences.

No. Species Access No. Length
1 Human AP_000649 603
2 Gorilla NP_008222 603
3 Pigmy Chimpanzee NP_008209 603
4 Common Chimpanzee NP_008196 603
5 Fin Whale NP_006899 606
6 Blue Whale NP_007066 606
7 Rat AP_004902 610
8 Mouse NP_904338 607
9 Opossum NP_007105 602

Table 3.

The basic information of 29 spike protein sequences.

No. Access No. Class No. Abbreviation Length
1 CAB91145 I TGEVG 1447
2 NP058424 I TGEV 1447
3 AAK38656 I PEDVC 1383
4 NP598310 I PEDV 1383
5 NP937950 II HCoVOC43 1361
6 AAK83356 II BCoVE 1363
7 AAL57308 II BCoVL 1363
8 AAA66399 II BCoVM 1363
9 AAL40400 II BCoVQ 1363
10 AAB86819 II MHVA 1324
11 YP 209233 II MHVJHM 1376
12 AAF69334 II MHVP 1321
13 AAF69344 II MHVM 1324
14 AAP92675 III IBVBJ 1169
15 AAS00080 III IBVC 1169
16 NP 040831 III IBV 1162
17 AAS10463 SARS_CoVs GD03T0013 1255
18 AAU93318 SARS_CoVs PC4127 1255
19 AAV49720 SARS_CoVs PC4137 1255
20 AAU93319 SARS_CoVs PC4205 1255
21 AAU04646 SARS_CoVs civet007 1255
22 AAU04649 SARS_CoVs civet010 1255
23 AAV91631 SARS_CoVs A022 1255
24 AAP51227 SARS_CoVs GD01 1255
25 AAS00003 SARS_CoVs GZ02 1255
26 AAP30030 SARS_CoVs BJ01 1255
27 AAP50485 SARS_CoVs FRA 1255
28 AAP41037 SARS_CoVs TOR2 1255
29 AAQ01597 SARS_CoVs TaiwanTC1 1255

Table 1 shows the 1st sample set that consists of seven species of beta globin protein sequences. Their range of lengths is from 121 to 147. This sample set is applied before in [12]. Table 2 shows the 2nd sample set which consists of nine ND5 protein sequences. Their range of lengths is from 602 to 610. This sample set is applied before in [1225]. Table 3 shows the 3rd sample set which consists of 29 spike protein sequences. Their range of lengths is from 1162 to 1447. These viruses are coronavirus. They are classified into four classes: Class I that includes the porcine epidemic diarrhea virus (PEDV) and the transmissible gastroenteritis virus (TGEV). Class II includes the bovine coronavirus (BCoV), human coronavirus OC43 (HCoV-OC43), and the murine hepatitis virus (MHV). Class III contains the infectious bronchitis virus (IBV). The others are severe acute respiratory syndrome coronaviruses (SARS-CoV). This sample set is applied before in [26].

3. The Adjacency Vector

In this approach, a new vector is suggested to be a descriptor of a protein sequence. This vector is called the adjacency vector (Axy); x refers to the species' protein sequence and y refers to its related group. It counts the occurrence of all possible pairwise adjacencies obtained by reading the protein primary sequence from left to right. The protein sequence is composed of 20 common different amino acids which are “A,” “R,” “N,” “D,” “C,” “Q,” “E,” “G,” “H,” “I,” “L,” “K,” “M,” “F,” “P,” “S,” “T,” “W,” “Y,” and “V” as ordered alphabetically according to 1st letter code. Therefore, the adjacency vector (Axy) consists of 400 elements. Every 20 elements are related to each amino acid. The first 20 elements are related to “A” amino acid. The second 20 elements are related to “R” amino acid. The third 20 elements are related to “N” amino acid and so on by the same order which is illustrated previously according to 1st letter code. We borrow our idea from the 20 ×20 adjacency matrix [27].

The adjacency vector counts the possibilities of each pair. In other words, it counts the number of times that each pair is repeated along the sequence length. If the pair does not exist, its value in the adjacency vector is zero. For example, to evaluate the adjacency vector of the two short segments of “yeast Saccharomyces cerevisiae” protein [16, 19, 2224, 28]

Protein I: “WTFESRNDPAKDPVILWLNGGPGCSSLTGL”

Protein II: “WFFESRNDPANDPIILWLNGGPGCSSFTGL”

The two protein sequences are composed of 30 amino acids. Protein I is converted to 29 adjacent pairs that are WT, TF, FE, ES, SR, RN, ND, DP, PA, AK, KD, DP, PV, VI, IL, LW, WL, LN, NG, GG, GP, PG, GC, CS, SS, SL, LT, TG, GL as reading sequence from left to right. Protein II is converted to 29 adjacent pairs that are WF, FF, FE, ES, SR, RN, ND, DP, PA, AN, ND, DP, PI, II, IL, LW, WL, LN, NG, GG, GP, PG, GC, CS, SS, SF, FT, TG, GL as reading sequence from left to right. For example, “ND” pair has a count one in protein I and two in protein II. “DP” pair has a count two in both protein I and protein II. “SL” and “LT” pairs have a count one in protein I and zero in protein II.

Our approach is applied on three selected groups of protein sequences. The groups are beta globin, ND5, and spike protein sequences as illustrated in Tables 1, 2, and 3, respectively. The most common protein sequences are selected in each group. The selected sample is assumed to be unbiased and the population distribution of each group is normal. Therefore, the selected three samples can represent the three groups. The samples consist of seven beta globin, nine ND5, and 29 spike protein sequences.

Seven adjacency vectors for beta globin proteins, nine adjacency vectors for ND5 protein sequences, and 29 adjacency vectors for spike proteins are evaluated. For example:

  •  (1) Human (beta globin) protein sequence's first 20 elements of its adjacency vector (Ahuman  beta  globin) are as shown in Table 4.

  •  (2) Gorilla (ND5) protein sequence's last 20 elements of its adjacency vector (Agorilla  ND5) are as shown in Table 5.

Table 4.

AA AR AN AD AC AQ AE AG AH AI AL AK AM AF AP AS AT AW AY AV
1 0 1 0 0 0 0 1 4 0 3 0 0 1 0 0 1 0 1 2

Table 5.

VA VR VN VD VC VQ VE VG VH VI VL VK VM VF VP VS VT VW VY VV
5 0 0 0 1 1 0 1 0 0 0 1 0 3 1 1 2 0 0 1

4. The Group Representative Vector

The adjacency vector is used to describe each protein sequence individually in its corresponding group. This article provides a descriptor to the group itself. The median vector is selected to play the role of the group representative (GRy); y refers to its group. It acts as a reference vector for each group. The median is a better measure of central tendency. It separates the higher half from the lower half of the sample's data. It is not sensitive to extreme values like average.

The suggested group representative vector (GRy) is a vector which is composed of also 400 elements. Each element of 400 is the median of the corresponding elements in all adjacency vectors related to its sample that represents the group. Beta globin, ND5, and spike protein sequences' representative vectors are computed. For example:

  •   (1) Beta globin representative vector's (GRbeta  globin) 1st 20 elements are as shown in Table 6.

  •   (2) ND5 representative vector's (GRND5) last 20 elements are as shown in Table 7.

  •   (3) Spike proteins representative vector's (GRspike  proteins) 1st 20 elements are as shown in Table 8.

Table 6.

AA AR AN AD AC AQ AE AG AH AI AL AK AM AF AP AS AT AW AY AV
1 0 0 0 0 0 1 1 3 0 2 0 0 1 0 0 1 0 0 2

Table 7.

VA VR VN VD VC VQ VE VG VH VI VL VK VM VF VP VS VT VW VY VV
2.5 0 0 0 0 0 0 1 0 0 0.5 1 0 3.5 0 1 3.5 0 0 1

Table 8.

AA AR AN AD AC AQ AE AG AH AI AL AK AM AF AP AS AT AW AY AV
9 1 3 5 2 4 3 6 0 7 6 2 1 3 6 4 7 1 5 3

5. Similarity/Dissimilarity Analysis

A similarity/dissimilarity vector is introduced instead of the regular similarity/dissimilarity matrix [10, 11]. The similarity/dissimilarity matrix is a square symmetric matrix with zeros in its main diagonal. In order to evaluate this matrix, it is required to measure the degree of similarity between each protein sequence and others in the same group. If the 1st row represents human and the 2nd row represents gorilla, the similarity of all species according to human in 1st row is measured. Then the similarity is measured again of all species in 2nd row according to gorilla and so on. The calculations' number of this matrix equals ∑k=n1(K − 1)/2 where n is the number of compared species.

The similarity/dissimilarity vector is suggested to save time and number of calculations. It is a vector that has a number of elements equal to the number of protein sequences in the selected sample of each group. It measures the degree of similarity between each protein sequence's adjacency vector and the group representative vector. In other words, it measures the degree of similarity between each protein's descriptor and the “group representative.” It is simpler than previous matrix. It is calculated only one time for each sequence. The calculations' number of this vector equals n where n is the number of compared species.

To measure the degree of similarity, we suggest two methods:

(i) The 1 st Method. Evaluate the magnitude of the difference between each protein sequence' adjacency vector (Axy) and the group representative vector (GRy) of its sample as in

Dxy=AxyGRywhere:  a,b,c,d=a2+b2+c2+d2 (1)

(ii) The 2 nd Method. Compute the angle between each sequence's adjacency vector (Axy) and the group representative vector (GRy) in radians by

θxy=cos1Axy·GRyAxy×GRy (2)

For beta globin protein sequences, seven species are selected in our sample set: human, chimpanzee, gorilla, mouse, rat, gallus, and opossum, as illustrated in Table 1. There are seven adjacency vectors corresponding to them. The group representative GRbeta  globin is evaluated based on these seven adjacency vectors. Therefore, the similarity/dissimilarity vector has seven elements. The 1st element corresponds to human, 2nd element corresponds to chimpanzee, and so on, by the same order as in Table 1. In the similar manner, the ND5 similarity/dissimilarity vector and the 29 spike similarity/dissimilarity vector have nine elements and 29 elements as shown in Tables 2 and 3, respectively.

The similarity/dissimilarity vectors that are corresponding to beta globin, ND5, and spike protein sequences are illustrated in Tables 9, 10, and 11, respectively, based on the two methods discussed before.

Table 9.

Similarity/dissimilarity vector among 7 different species of beta globin protein sequences.

No. Species D x  beta  globin x  beta  globin) rad.
1 Human 0.5568 0.3657
2 Chimpanzee 0.5568 0.4098
3 Gorilla 0.5568 0.4185
4 Mouse 0.8602 0.6047
5 Rat 0.9165 0.6251
6 Gallus 1.0536 0.7480
7 Opossum 1.1136 0.7955

Table 10.

Similarity/dissimilarity vector among 9 different species of ND5 protein sequences.

No. Species D x  ND5 x  ND5) rad.
1 Pigmy chimpanzee 1.2530 0.2218
2 Common chimpanzee 1.3191 0.2357
3 Human 1.3856 0.2517
4 Gorilla 1.3892 0.2547
5 Fin Whale 1.5395 0.3006
6 Blue Whale 1.5459 0.3003
7 Mouse 2.0372 0.3873
8 Rat 2.1517 0.4130
9 Opossum 2.3367 0.4659

Table 11.

Similarity/dissimilarity vector among 29 different species of spike protein sequences.

Abbreviation Class no. D x  spike (θx  spike) rad.
1 TGEVG I 4.5266 0.4793
2 TGEV I 4.5266 0.4793
3 PEDVC I 4.1413 0.4473
4 PEDV I 4.1413 0.4473
5 HCoVOC43 II 3.7537 0.4299
6 BCoVE II 3.7377 0.4203
7 BCoVL II 3.7550 0.4233
8 BCoVM II 3.7216 0.4198
9 BCoVQ II 3.7216 0.4203
10 MHVA II 3.7095 0.4395
11 MHVJHM II 4.1183 0.4728
12 MHVP II 3.5651 0.4240
13 MHVM II 3.7014 0.4406
14 BVBJ III 3.9699 0.5002
15 IBVC III 3.8936 0.4863
16 IBV III 4.1243 0.5188
17 GD03T0013 SARS-CoVs 1.9824 0.2439
18 PC4127 SARS-CoVs 2.0075 0.2473
19 PC4137 SARS-CoVs 2.0224 0.2491
20 PC4205 SARS-CoVs 2.0099 0.2476
21 civet007 SARS-CoVs 2.0469 0.2519
22 civet010 SARS-CoVs 2.0125 0.2478
23 A022 SARS-CoVs 2.0518 0.2526
24 GD01 SARS-CoVs 1.9824 0.2445
25 GZ02 SARS-CoVs 1.9723 0.2433
26 BJ01 SARS-CoVs 1.9570 0.2413
27 FRA SARS-CoVs 2.0125 0.2481
28 TOR2 SARS-CoVs 1.9949 0.2458
29 TaiwanTC1 SARS-CoVs 1.9875 0.2449

The results in Table 9 show that the magnitude (Dx  beta  globin, where x: species) cannot measure the similarity/dissimilarity degree well among all beta globin sequences. The human, chimpanzee, and gorilla have the same value that is equal to 0.5568, while the similarity is well measured between mouse and rat. Also, the dissimilarity between opossum and human is very clear. The angle (θx  beta  globin) is successfully measured similarity/dissimilarity among all the species as shown in Figure 1. The closest values of both Dx  beta  globin and θx  beta  globin mean more similarity.

Figure 1.

Figure 1

Similarity/dissimilarity analysis results of 7 beta globin protein sequences based on θx  beta  globin.

The results in Table 10 show that both the magnitude (Dx  ND5) and the angle (θx  ND5) can measure similarity/dissimilarity degree well among ND5 protein sequences as shown in Figure 2. It is obvious that pigmy chimpanzee, common chimpanzee, human, and gorilla are very similar. Also it shows the similarity of the blue whale, fin whale, and the mouse and rat as pairs and the dissimilarity between human and opossum. These results are satisfied with [13, 14, 16, 18, 19, 2125].

Figure 2.

Figure 2

Similarity/dissimilarity analysis results of 9 ND5 protein sequences based on θx  ND5.

The results in Table 11 show that both Dx  spike and θx  spike classified the 3 classes of viruses and SARs_Covs well each as a single coherent class except only the “MHVJHM” virus. This virus belongs to class II but our approach cannot classify it well. The classification of 29 spike proteins into classes by our approach is illustrated in Figure 3. The MHVJHM virus is the only wrong classified sequence. It is colored red. Despite the wrong classification of MHVJHM virus, our approach corrects the broken classification of Class I in [26].

Figure 3.

Figure 3

Similarity/dissimilarity analysis results of 29 spike protein sequences (a) based on Dx  spike (b) based on θx  spike.

According to the results in Tables 9, 10, and 11, the angle θxy is preferred to be used as shown in Figures 1, 2, and 3.

6. Cross-Group Comparison

The group representative vector (GRy) carries the information of its group. A cross-group comparison is done to prove the singularity of each group. Tables 9, 10, and 11 are evaluated based on the group's sample set of protein sequences related to their corresponding group representative vector. Tables 12, 13, 14, and 15 are evaluated based on each group sample set of protein sequences with another group representative vector. The similarity/dissimilarity analysis among the seven beta globin sequences measured according to (GRND5) is illustrated in Table 12 and shown in Figure 4. The similarity/dissimilarity analysis among the ND5 sequences measured according to (GRbeta  globin) is illustrated in Table 13 and shown in Figure 5. The similarity/dissimilarity analysis among the beta globin sequences measured according to (GRspike) is illustrated in Table 14 and shown in Figure 6. The similarity/dissimilarity analysis among the ND5 sequences measured according to (GRspike) is illustrated in Table 15 and shown in Figure 7. The results show a big distortion that ensures the individuality of each group.

Table 12.

Similarity/dissimilarity vector among 7 different species of beta globin protein sequences according to (GRND5).

No. Species Dxy θxy
1 Human 1.38564 0.251674
2 Chimp 4.71593 1.20638
3 Gorilla 1.38924 0.254656
4 Mouse 2.03715 0.387323
5 Rat 2.15174 0.41301
6 Gallus 4.53211 1.08994
7 Opossum 2.33666 0.465884

Table 13.

Similarity/dissimilarity vector among 9 different species of ND5 protein sequences according to (GRbeta  globin).

No. Species Dxy θxy
1 Pigmy chimp 5.16914 1.20525
2 Common chimp 5.14101 1.18598
3 Human 5.12348 1.19282
4 Gorilla 5.07346 1.1745
5 Fin whale 4.82286 1.16274
6 Blue whale 4.86621 1.17307
7 Mouse 5.12445 1.2454
8 Rat 5.07346 1.23689
9 Opossum 4.81768 1.23466

Table 14.

Similarity/dissimilarity vector among 7 different species of beta globin protein sequences according to (GRspike).

No. Species Dxy θxy
1 Human 6.02661 0.839369
2 Chimp 7.52463 1.06606
3 Gorilla 6.1 0.852902
4 Mouse 6.18789 0.869323
5 Rat 6.18466 0.8689
6 Gallus 7.44849 1.04124
7 Opossum 6.32614 0.896635

Table 15.

Similarity/dissimilarity vector among 9 different species of ND5 protein sequences according to (GRspike).

No. Species Dxy θxy
1 Pigmy chimp 6.07207 0.847581
2 Common chimp 5.99667 0.833859
3 Human 6.02661 0.839369
4 Gorilla 6.1 0.852902
5 Fin whale 6.00083 0.833717
6 Blue whale 5.97244 0.828506
7 Mouse 6.18789 0.869323
8 Rat 6.18466 0.8689
9 Opossum 6.32614 0.896635

Figure 4.

Figure 4

Similarity/dissimilarity analysis results of 7 beta globin protein sequences based on (GRND5) (θxy).

Figure 5.

Figure 5

Similarity/dissimilarity analysis results of 9 ND5 protein sequences based on (GRbeta  globin) (θxy).

Figure 6.

Figure 6

Similarity/dissimilarity analysis results of 7 beta globin protein sequences based on (GRspike) (θxy).

Figure 7.

Figure 7

Similarity/dissimilarity analysis results of 9 ND5 protein sequences based on (GRspike) (θxy).

7. A Qualitative Comparison between Our Results and the Phylogenetic Tree of Protein Sequences

The phylogenetic tree is a branching diagram showing the evolutionary relationships among various biological species based upon similarities and differences in their sequences. A qualitative comparison between our results and the phylogenetic tree of protein sequences is used to prove the utility of our approach. The matching between the results and phylogenetic trees means matching with the naïve measure of sequence similarity (sequence homology).

The basic local alignment tool (BLAST) is used to draw the phylogenetic trees. The phylogenetic trees of beta globin's seven species, ND5 nine species, and 29 spike protein sequences are illustrated in Figures 8, 9, and 10, respectively.

Figure 8.

Figure 8

The phylogenetic tree of beta globin selected protein sequences by BLAST program.

Figure 9.

Figure 9

The phylogenetic tree of ND5 selected protein sequences by BLAST program.

Figure 10.

Figure 10

The phylogenetic tree of 29 spike protein sequences by BLAST program, 3 unknown leaves are for class III (IBVBJ, IBVC, and IBV: the tool cannot detect their names).

The qualitative comparison of the results of Tables 9, 10, and 11 and Figures 8, 9, and 10 shows the utility of our work especially the angle θx results.

8. Conclusion

The proposed method is an alignment-independent method. An adjacency vector is suggested as a descriptor of any protein sequence. It does not require any graphical representation. A group representative vector is introduced to represent each group of protein sequences. A similarity/dissimilarity vector is produced instead of the regular similarity/dissimilarity matrix. The similarity/dissimilarity analysis is done by two methods. Our approach is applied on three sample sets of three groups of protein sequences. Each sample has a different range of lengths than the others. Our approach does not depend on protein sequence length. It successfully measured similarity/dissimilarity among different lengths. It is very mathematically simple. A cross-grouping comparison is introduced to prove the singularity of each group. The results approved the utility of our approach compared with previous articles and phylogenetic tree obtained by BLAST program.

9. Future Work

We hope to make the method available to include ambiguous amino acid residues and nonstandard amino acids. We hope also to include the analyses of partial or gapped sequences.

Data Availability

All data is mentioned clearly in the manuscript in Section 2 under the title “Dataset.” In this section, we illustrate the data in three tables: Tables 1, 2, and 3. We also mention in the 1st paragraph of dataset that data are downloaded from “Gene Bank.” All data files are with extension “. fasta”.

Conflicts of Interest

The authors declare that they have no conflicts of interest.

Supplementary Materials

Supplementary Materials

It is a figure which summarizes our approach. It is submitted under the name of Graphical Abstract.

References

  • 1.Yu C., Deng M., Yau S. S.-T. DNA sequence comparison by a novel probabilistic method. Information Sciences. 2011;181(8):1484–1492. [Google Scholar]
  • 2.Yang X., Wang T. Linear regression model of short k-word: a similarity distance suitable for biological sequences with various lengths. Journal of Theoretical Biology. 2013;337:61–70. doi: 10.1016/j.jtbi.2013.07.028. [DOI] [PubMed] [Google Scholar]
  • 3.Dai Q., Guo X., Li L. Sequence comparison via polar coordinates representation and curve tree. Journal of Theoretical Biology. 2012;292:78–85. doi: 10.1016/j.jtbi.2011.09.030. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Needleman S. B., Wunsch C. D. A general method applicable to the search for similarities in the amino acid sequence of two proteins. Journal of Molecular Biology. 1970;48(3):443–453. doi: 10.1016/0022-2836(70)90057-4. [DOI] [PubMed] [Google Scholar]
  • 5.Smith T. F., Waterman M. S. Identification of common molecular subsequences. Journal of Molecular Biology. 1981;147(1):195–197. doi: 10.1016/0022-2836(81)90087-5. [DOI] [PubMed] [Google Scholar]
  • 6.Gotoh O. An improved algorithm for matching biological sequences. Journal of Molecular Biology. 1982;162(3):705–708. doi: 10.1016/0022-2836(82)90398-9. [DOI] [PubMed] [Google Scholar]
  • 7.Altschul S. F., Gish W., Miller W., Myers E. W., Lipman D. J., Mol J. Basic local alignment search tool. Journal of Molecular Biology. 1990;215(3):403–410. doi: 10.1016/S0022-2836(05)80360-2. [DOI] [PubMed] [Google Scholar]
  • 8.Lipman D. J., Pearson W. R. Rapid and sensitive protein similarity searches. Science. 1985;227(4693):1435–1441. doi: 10.1126/science.2983426. [DOI] [PubMed] [Google Scholar]
  • 9.Henikoff S., Henikoff J. G. Amino acid substitution matrices from protein blocks. Proceedings of the National Academy of Sciences. 1992;89(22):10915–10919. doi: 10.1073/pnas.89.22.10915. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Randic M., Zupan J., Balaban A. T., Topic D. V. Graphical representation of proteins. Chemical Reviews. 2011;111:790–862. doi: 10.1021/cr800198j. [DOI] [PubMed] [Google Scholar]
  • 11.Jin X., Jiang Q., Chen Y., et al. Similarity/dissimilarity calculation methods of DNA sequences: a survey. Journal of Molecular Graphics and Modelling. 2017;76:342–355. doi: 10.1016/j.jmgm.2017.07.019. [DOI] [PubMed] [Google Scholar]
  • 12.Li C., Yu X., Yang L., Zheng X., Wang Z. 3-D maps and coupling numbers for protein sequences. Physica A: Statistical Mechanics and its Applications. 2009;388(9):1967–1972. doi: 10.1016/j.physa.2009.01.017. [DOI] [Google Scholar]
  • 13.He P.-A., Li X.-F., Yang J.-L., Wang J. A novel descriptor for protein similarity analysis. Match: Communications in Mathematical and in Computer Chemistry. 2011;65:445–458. [Google Scholar]
  • 14.El-Lakkani A., El-Sherif S. Similarity analysis of protein sequences based on 2D and 3D amino acid adjacency matrices. Chemical Physics Letters. 2013;590:192–195. doi: 10.1016/j.cplett.2013.10.032. [DOI] [Google Scholar]
  • 15.Hou W., Panb Q., Peng Q., He M. A new method to analyze protein sequence similarity using dynamic time warping. Genomics. 2017;109:123–130. doi: 10.1016/j.ygeno.2016.12.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Wen J., Zhang Y. A 2D graphical representation of protein sequence and its numerical characterization. Chemical Physics Letters. 2009;476:281–286. doi: 10.1016/j.cplett.2009.06.017. [DOI] [Google Scholar]
  • 17.Hu H., Li Z., Dong H., Zhou T. Graphical representation and similarity analysis of protein sequences based on fractal interpolation. IEEE/ACM Transactions on Computational Biology and Bioinformatics. 2017;14(1):182–192. doi: 10.1109/TCBB.2015.2511731. [DOI] [PubMed] [Google Scholar]
  • 18.Wang L., Peng H., Zheng J. ADLD: a novel graphical representation of protein sequences and its application. Computational and Mathematical Methods in Medicine. 2014;2014:15. doi: 10.1155/2014/959753.959753 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Wu H., Zhang Y., Chen W., Mu Z. Comparative analysis of protein primary sequences with graph energy. Physica A: Statistical Mechanics and its Applications. 2015;437:249–262. doi: 10.1016/j.physa.2015.04.017. [DOI] [Google Scholar]
  • 20.Li Y., Liu Q., Zheng X., He P. UC-curve: a highly compact 2D graphical representation of protein sequences. International Journal of Quantum Chemistry. 2014;114(6):409–415. doi: 10.1002/qua.24581. [DOI] [Google Scholar]
  • 21.He P. A., Zhang Y. P., Yao Y. H., Tan Y. F., Nan X. Y. The graphical representation of protein sequences based on the physicochemical properties and its applications. Journal of Computational Chemistry. 2010;31:2136–2142. doi: 10.1002/jcc.21501. [DOI] [PubMed] [Google Scholar]
  • 22.Hu H. F-curve, a graphical representation of protein sequences for similarity analysis based on physicochemical properties of amino acids. MATCH Communications in Mathematical and in Computer Chemistry. 2015;73(3):749–764. [Google Scholar]
  • 23.Sun D., Xu C., Zhang Y. A novel method of 2D graphical representation for proteins and its application. MATCH - Communications in Mathematical and in Computer Chemistry. 2016;75(2):431–446. [Google Scholar]
  • 24.Abo El Maaty M. I., Abo-Elkhier M. M., Abd Elwahaab M. A. 3D graphical representation of protein sequences and their statistical characterization. Physica A: Statistical Mechanics and its Applications. 2010;389(21):4668–4676. doi: 10.1016/j.physa.2010.06.031. [DOI] [Google Scholar]
  • 25.Zhang Y.-P., Sheng Y-J., Zheng W., He P.-A., Ruan J.-S. Novel numerical characterization of protein sequences based on individual amino acid and its application. BioMed Research International. 2015;2015:8. doi: 10.1155/2015/909567.909567 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Ping P., Zhu X., Wang L. Similarities/dissimilarities analysis of protein sequences based on PCA-FFT. Journal of Biological Systems. 2017;25(01):29–45. doi: 10.1142/S0218339017500024. [DOI] [Google Scholar]
  • 27.Randić M., Novič M., Vračko M. On novel representation of proteins based on amino acid adjacency matrix. SAR and QSAR in Environmental Research. 2008;19(3-4):339–349. doi: 10.1080/10629360802085082. [DOI] [PubMed] [Google Scholar]
  • 28.Yao Y., Kong F., Dai Q., He P. A sequence-segmented method applied to the similarity analysis of long protein sequence. MATCH: Communications in Mathematical and in Computer Chemistry. 2013;70:431–450. [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplementary Materials

It is a figure which summarizes our approach. It is submitted under the name of Graphical Abstract.

Data Availability Statement

All data is mentioned clearly in the manuscript in Section 2 under the title “Dataset.” In this section, we illustrate the data in three tables: Tables 1, 2, and 3. We also mention in the 1st paragraph of dataset that data are downloaded from “Gene Bank.” All data files are with extension “. fasta”.


Articles from BioMed Research International are provided here courtesy of Wiley

RESOURCES