Skip to main content
Marine Drugs logoLink to Marine Drugs
. 2019 Jun 12;17(6):350. doi: 10.3390/md17060350

Antimicrobial and Immunomodulatory Properties and Applications of Marine-Derived Proteins and Peptides

Hee Kyoung Kang 1,2, Hyung Ho Lee 2, Chang Ho Seo 2, Yoonkyung Park 1,3,*
PMCID: PMC6628016  PMID: 31212723

Abstract

Marine organisms provide an abundant source of potential medicines. Many of the marine-derived biomaterials have been shown to act as different mechanisms in immune responses, and in each case they can significantly control the immune system to produce effective reactions. Marine-derived proteins, peptides, and protein hydrolysates exhibit various physiologic functions, such as antimicrobial, anticancer, antioxidant, antihypertensive, and anti-inflammatory activities. Recently, the immunomodulatory properties of several antimicrobial peptides have been demonstrated. Some of these peptides directly kill bacteria and exhibit a variety of immunomodulatory activities that improve the host innate immune response and effectively eliminate infection. The properties of immunomodulatory proteins and peptides correlate with their amino acid composition, sequence, and length. Proteins and peptides with immunomodulatory properties have been tested in vitro and in vivo, and some of them have undergone different clinical and preclinical trials. This review provides a comprehensive overview of marine immunomodulatory proteins, peptides, and protein hydrolysates as well as their production, mechanisms of action, and applications in human therapy.

Keywords: marine organism, immunomodulatory peptide, protein hydrolysates, immune response

1. Introduction

The immune response plays a crucial role in maintaining human health by identifying and killing pathogens, aging cells, or tumor cells. Its functions can be affected by many factors, including pathogen presence, tissue injury, and cardiac infarction [1]. Immunomodulation refers to the ability of the immune system to control various life-threatening diseases, such as cancer, human immunodeficiency virus, multiple sclerosis, and aging [2,3,4]. Macrophages are mononuclear leukocytes, which function as primary defenders of the host and can recognize and eliminate microbial pathogens and cancer cells via phagocytosis. These cells are also involved in immune regulation by producing cytokines, such as interferon (IFN)-γ, tumor necrosis factor (TNF)-α, interleukin (IL)-1β, IL-6, IL-10, and IL-12. Clinically, immunomodulators can be classified as immunoadjuvants, immunostimulants, and immunosuppressants. Immunotherapy is the treatment of disease by modulating the host’s immune system. Currently, numerous drugs are used clinically to control human immune function, including levamisole, imiquimod, pidotimod, tilorone, cyclophosphamide, prostaglandin, cyclosporine A, thiocarbamate, niridazole, and penicillamine [5,6,7,8,9,10,11,12,13,14]. However, most synthesized immunomodulatory drugs exhibit toxicity and side effects, limiting their use to cases such as those of chronic diseases [15]. In contrast, the majority of naturally-derived immunomodulatory proteins or peptides do not show side effects and are less costly, suggesting their potential for use in immunotherapy.

The marine environment is rich in bioactive resources, but few studies have examined the ability of these resources to modulate the immune response. Approximately 2,210,000 species are thought to exist in the ocean, but only about 190,000 species have been recorded [16,17]. Peptides, proteins, and protein hydrolysates isolated from marine algae and fish can function as immunostimulants. The potential immunomodulatory activity of marine derivatives and their scientific analyses are now emerging. This review describes the immunomodulatory role of marine-derived biomaterials.

2. Brief Overview of the Immune System

The immune system is a host defense system that serves to remove potentially harmful substances known as pathogens. The immune system is divided into two subsystems: the innate and adaptive immune systems.

Innate immunity (natural or native immunity) is non-specific and provides the first line of defense through the skin, mucosal tissue, bone marrow (neutrophils, eosinophils, basophils, mast cells, monocytes, dendritic cells, and macrophages), or inflammatory components (cytokines, interferons, and defensins). Macrophages and neutrophils are important first-line responders in phagocytosis [18].

Adaptive immunity (specific or acquired immunity) is highly specific to dangerous pathogens and is the body’s second line of defense involving T lymphocytes and B lymphocytes. The adaptive immune response can be either humoral or cell-mediated. Humoral immunity is mediated by B lymphocytes, which release antibodies specific for the infectious pathogen. The cell-mediated response involves binding of T lymphocytes to the pathogen or infected cells, followed by lysis of these cells and the secretion of immune regulatory factors, such as cytokines. The three subtype of T lymphocytes are cytotoxic T cells, helper T (TH) cells, and regulatory T (suppressor T) cells. Cytotoxic T cells express a surface receptor, cluster of differentiation (CD)8+, which recognize endogenous antigens associated with major histocompatibility complex class I and kill infected cells. TH cells express the surface receptor CD4+ and recognize exogenous antigens complexed with major histocompatibility complex class II. TH cells secrete cytokines and help activate B and T lymphocytes and other immune cells [19]. Regulatory T cells help to control the immune response by preventing harmful immune activation and maintain tolerance, or prevent autoimmune diseases by maintaining self-tolerance.

3. Immunomodulatory Compounds from Marine Organisms

Over the past few decades, more than 16,000 marine organisms have been isolated from the oceans and have been widely studied. Marine-derived substances, such as proteins, peptides, glycoproteins, polysaccharides, and lipids show potential for controlling the immune system [20,21,22]. This review summarizes the developmental status of marine-derived immunomodulatory proteins, peptides, and protein hydrolysates from different organisms.

3.1. Immunomodulatory Proteins and Amino Acid

Marine biomaterials (proteins, enzymes, oligosaccharides, biopolymers, fatty acids, minerals, and pigments, etc.) described come from a variety of marine natural sources. Marine biomaterials contain large amounts of diverse proteins (10–47% (w/w)) with various bioactivities and functions. Many proteins in hemolymphs and hemocytes play important roles in the innate immune system by preserving several immune components, such as metalloproteins, glycoprotein, amino sulfonic acid, antimicrobial peptides (AMPs), protease inhibitors, and coagulation factors. Table 1 summarizes the immunomodulatory proteins and amino sulfonic acid (taurine) found in diverse marine biomaterials.

Table 1.

List of immunomodulatory proteins from diverse marine sources.

Name of Protein Source Protein Type Mechanism of Action Ref.
Hemocyanin Mollusk:
Concholepas concholepas, Megathura crenulata,
Fissurella latimarginata
Oxygen carrying metalloprotein Immunostimulatory activities against certain cancers without side effects; interact with T cells, monocytes, macrophages, and polymorphonuclear lymphocytes to improve the host immune response [23,24,25,26,27,28]
Lectin Clam: Crenomytilus grayanus, Mytilus trossulus, Fissurella latimarginata Glycoprotein C-type lectins recognize carbohydrates during the immune response.
Tachylectins recognize pathogen associated molecules via phagocytosis or the lectin pathway of the complement system.

The C-type lectins play a key role in carbohydrate recognition during immune response. Lectins have been reported as pathogenic recognizing receptors from marine invertebrates.

MTL stimulates the expression of proinflammatory cytokines (TNF-α and IFN-γ), but reduces the hyper-expressions of anti-inflammatory cytokine (IL-10).
[29,30,31,32,33,34]
Taurine Clam: Tapes philippinarum 2-Amino ethane sulfonic acid Cytoprotective and immunomodulatory effects in immune cells including lymphocytes, monocytes, and neutrophils; accumulation of phagocytes, contact with pathogens, activated cells (neutral and macrophages) produce toxic oxidants and various antibacterial substances using the peroxidase system and destroy the pathogens; scavenger to remove unwanted or harmful substances from the cells and protect them from oxidative stress; modulation of the immune system by activating NF-κB and activation PPAR-g. [35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64,65,66,67,68,69,70,71,72,73,74,75,76,77]

3.1.1. Hemocyanins

Hemocyanins are metalloproteins that use copper-binding sites to bind and transport oxygen in a variety of mollusks. Hemocyanins, like hemoglobin, are multi-subunit molecules with a functional subunit that binds oxygen. Hemocyanins isolated from several marine gastropods show potent immunostimulatory effects against certain cancers with tolerable side effects observed in a murine colon carcinoma model [23,24]. Hemocyanins have been used as innate immunostimulators to suppress the development of superficial bladder cancer, while hemocyanins obtained from Concholepas concholepas have been evaluated in clinical trials for treating superficial bladder cancer [25]. Keyhole limpet hemocyanin is an immunostimulator derived from circulating glycoproteins of the marine mollusk Megathura crenulata. Keyhole limpet hemocyanin interacts with T cell monocytes, macrophages, and polymorphonuclear lymphocytes to improve the host immune response (Figure 1) [26,27]. Hemocyanin isolated from a gastropod Fissurella latimarginata is a novel immunostimulator with higher immunostimulatory activities than traditional hemocyanins, such as keyhole limpet hemocyanin and Concholepas concholepas, which were isolated from a gastropod [28].

Figure 1.

Figure 1

Structural model of keyhole limpet hemocyanin chain A from the marine mollusk Megathura crenulata (Genbank: 3L6W_A) created using the SWISS-MODEL server (Swiss Institute of Bioinformatics, Basel, Switzerland, https://swissmodel.expasy.org/) [26].

3.1.2. Lectins

Lectin, a glycoprotein that controls immune function, has been widely reported through innate immune responses leading to pathogen recognition and endocytosis, and adaptive immune responses such as B and T activation, and apoptosis [29]. Lectins are found in many different plants and animals. Lectins isolated from clam are homologous and modulate the innate immune response [30]. Three types of lectins have been identified: Ca2+-dependent (C-type), R-type, and metal independent galectins. C-type lectins recognize broad endogenous ligands and pathogens that regulate intercellular interactions and play a major role in carbohydrate recognition during the immune response [31]. These proteins are also very important in autoimmune diseases. Tachylectin, isolated from hemocytes of the horseshoe crab Carcinoscorpius rotundicauda, recognizes pathogens [32]. Microbes recognition occurs via phagocytosis or the lectin pathway in the complement system. The lectin from the mussel Mytilus trossulus stimulates the induction of proinflammatory cytokines such as TNF-α and IFN-γ but reduces the anaphylaxis of the anti-inflammatory cytokine IL-10 in human peripheral blood cells (Figure 2) [33]. Lectins, derived from the hemolymph of crustaceans, are considered as active precursors of antibodies because they play an important role in antimicrobial activity as well as immune recognition [34].

Figure 2.

Figure 2

Structural model of lectin from the mussel Mytilus trossulus (Genbank: AKI29293.1) created using the SWISS-MODEL server (https://swissmodel.expasy.org/) [33].

3.1.3. Taurine

Taurine (2-amino ethane sulfonic acid) is an amino acid that is widely distributed in animal tissues including in the marine clam (Figure 3). Marine organisms are a rich source of taurine, but it is also produced by many other organisms. Taurine has cytoprotective and immunomodulatory effects and is enriched in immune cells including lymphocytes, monocytes, and neutrophils [35]. This suggests that high taurine levels in phagocytes mediating inflammatory lesions indicate a role in innate immunity [36]. Taurine accumulates in phagocytes; after contacting a pathogen, activated cells (neutral and macrophages) produce toxic oxidants and various antibacterial substances through the peroxidase system, and act at inflammatory sites to kill pathogens. Toxic oxidants are components of the innate immune system and protect the host from infections by killing pathogens, but they may also damage the host tissue. Taurine also acts as a scavenger to remove unwanted or harmful substances from the cells and protect cells from oxidative stress. Taurine modulates the immune system by activating NF-κB, a potent signal transducer for inflammatory cytokines [35]. Additionally, peroxisome proliferator-activated receptor-γ (PPAR-γ) is activated by taurine in the liver to control the regulation of glucose metabolism and adiposeness. Thus, the activation of PPAR-γ by taurine protects retinal neuronal damage in diabetic retinopathy [37].

Figure 3.

Figure 3

Molecular structure of taurine created using the Chemdraw (PerkinElmer, Waltham, MA USA) [35].

3.2. Antimicrobial and Immunomodulatory Peptides

Studies of functional peptides that control immune responses are actively being conducted [38]. Although immunomodulatory peptides are known to enhance immune responses such as lymphocyte proliferation, natural killer (NK) cell activity, and cytokine regulation, the specific mechanisms of these activities remain unclear [39]. For example, the interactions of immunomodulatory peptides with the human nervous, digestive, cardiovascular, and immune systems are not well-understood [40]. For this reason, it is necessary to understand the interaction between peptides and these systems for the development of specific immunomodulatory peptides.

Marine-derived AMPs are defense molecules with the potential to enhance innate immunity [41]. The discovery that marine AMPs target specific cells confirmed the potential of these molecules as drug candidates [42]. Therefore, marine-derived AMPs are important sources of molecules with immunological regulatory properties. Table 2 and Table 3 summarize immunomodulatory peptides that have been identified in diverse marine sources.

Table 2.

Antimicrobial and immunomodulatory peptides from marine organisms.

Name of peptide Source Mechanism of action Ref.
Callinectin Blue crab: Callinectes sapidus, Mediterranean mussel: Mytilus galloprovincialis Antibacterial activity against gram-negative bacteria, binding to anti-callinectin-like peptides antibodies in blue crab hemocytes [43,44]
Clavanin A, clavanin-MO Tunicate: Styela clava Antimicrobial activity against Gram-negative, Gram-positive drug-resistant bacteria and fungi;
immunomodulation by inhibiting the inflammatory response that causes sepsis and destroys certain biofilms; affect components of the immune system and influence inflammatory response; cytokine modulations (down-regulation of IL-12 and TNF-α, up-regulation of IL-1) in mice
[45,46]
Crustin Crustacean: Carcinus maenas, Pacifastacus leniusculus, Fenneropenaeus chinensis, Scylla serrata, Scylla paramamosain, Penaeus monodon Antimicrobial activity against marine Gram-positive bacteria; release from the hemocytes of crustacean by exocytosis [47,48,49,50,51]
Defensin Oyster: Crassostrea virginica. Crassostrea gigas
Mediterranean mussel: Mytilus galloprovincialis
M. edulis
Antimicrobial peptides (AMPs) acting as host defense peptides that disrupt the membrane of microbial pathogens, and play a major role in immunomodulation by acting in the innate and adaptive immune response; after bacterial infection, increased MGD-1 in M. galloprovincialis plasma and MGD-2 stimulates release from hemocytes [52,53,54,55]
Myticin Mediterranean mussel: Mytilus galloprovincialis Reached in the bacteria by transportation through hemocytes; antibacterial activity against Gram-positive bacteria (myticin A, myticin B, myticin C) and the fungus Fusarium oxysporum and E. coli (myticin C) and acts as immunomodulator in vivo; immune-related gene expression following in vivo immunostimulation in mussels [56,57,58]
Mytilin Mollusk: Mytilus edulis (mytilin A and mytilin B), M. galloprovincialis (mytilin C, mytilin D, mytilin G1) Antimicrobial activities; transported through hemocytes to reach bacteria, and cells containing mytilin act as phagocytosing bacteria to prevent microbes from entering the circulatory system [59,60]
Mytimycin Blue mussel: Mytilus edulis, Mediterranean mussel: M. galloprovincialis Antifungal activity; defense against invading pathogenic microbes; the gene responsible for mytomycin is mainly expressed in circulatory hemocytes [55,59,61]
Phosvitin-derived peptide Pt5 Fish: Danio rerio Antimicrobial activity and immunomodulatory activity; increase the survival rate of zebrafish infected by Aeromonas hydrophila, decrease the number of A. hydrophila in the blood, spleen, kidneys, liver, and muscles; inhibition expression of IL-1β, IL-6, TNF-α, and IFN-γ within the spleen and head kidneys of A. hydrophila-infected zebrafish, but increased the expression of IL-10 and IL-14 [62]
Salmo salar natural killer (NK)-lysin Fish: Salmo salar Antimicrobial activity; Salmo salar NK-lysin-derived peptides induce expression of IL-1β and IL-8 in Salmo salar head kidney leukocytes [63,64]
Scygonadin Mud crab: Scylla serrata AMPs for host defense to protect the reproductive system of organisms [65,66]
Thalassospiramides A and D Bacteria: Thalassospira sp. Suppression of LPS-induced NO production in RAW 264.7 macrophages; inhibition of IL-5 expression in TH-2-mediated inflammatory diseases such as asthma [67,68]
Tilapia piscidin 3 (TP3) and tilapia piscidin 4 (TP4) Fish: Oreochromis niloticus Antimicrobial, wound-healing, and antitumor activity; increased expression of several immune-related genes in O. niloticus muscle (IL-1β, IL-6, IL-8, TGF-β, IκB), decreased expression of TLR5 after Vibrio vulnificus infection, down-regulation of IL-1β, IL-8 TLR5, TGF-β, and IκB after Streptococcus agalactiae infection [69]

Table 3.

The amino acid sequences for marine-derived antimicrobial and immunomodulatory peptides.

Peptide Source Amino acid sequences Ref./Genbank
Callinectin Callinectes sapidus WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY-NH2 [43]
Clavanin-A, clavanin-MO Styela clava Clavanin A: VFQFLGKIIHHVGNFVHGFSHVF-NH2
Clavanin-MO: FLPIIVFQFLGKIIHHVGNFVHGFSHVF-NH2
[45,46]
Crustin Scylla serrata EASRVPPYLGRDCKHWCKDNNQALYCCGPPGITYPPFIRNHPGKCPSVRSTCTGVRSYRPKLCPHDGACDFRSKCCYDACVEHHVCKTV [47]
ADW11096.1
Defensin Crassostrea gigas GFGCPGNQSKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK [52]
ACQ76262.1
Myticin C Mytilus galloprovincialis QSIPCTSYYCSKFCGSAGCSLYGCYKLHPGKICYCLHCRRAESPLALSGSARNVNEQNKE [58]
AEZ79080.1
Mytilin B Mytilus galloprovincialis SCASRCKGHCRARRCGYYVSVLYRGRCYCKCLRCSSEHSMKFPENEGSSPSDMMPQNENENTEFGQDMPTGETEQGETGI [59]
AAD45013.1
Mytomycin Mytilus edulis DCCHRPYYYHCWDCTAATPYCGYRPCNIFGCGCTCRTEPHGKSCYERGDRCRCYT [61]
AET85056.1
Phosvitin-derived peptide Pt5 Danio rerio SRMSKTATIIEPFRKFHKDRYLAHHSATKDTSSGSAAASFEQMQKQNRFLGNDIP [62]
Salmo salar NK-lysin Salmo salar KGTCWVCKWALNKVKKSISTSSSPETLKQKLLSVCDKVGFLKSMCKGLMKKHLWVLIEELSTSDDVRTICVNIKACKPKE [63] XP_013985382
Scygonadin Scylla serrata GQALNKLMPKIVSAIIYMVGQPNAGVTFLGHQCLVESTRQPDGFYTAKMSCASWTHDNPIVGEGRSRVELEALKGSITNFVQTASNYKKFTIDEVEDWIASY [65]
AAW57403.1
Thalassospiramides A and D Thalassospira sp. cyclic lipopeptides contained rigid 12-membered ring containing an α,β-unsaturated carbonyl moiety [67]
TP3 and TP4 Oreochromis niloticus TP3: FIHHIIGGLFSVGKHIHSLIHGH,
TP4: FIHHIIGGLFSAGKAIHRLIRRRRR
[69]

3.2.1. Callinectin

Callinectin is a proline- and arginine-rich AMP composed of 32 amino acids, including four cysteine residues, and shows antibacterial activity against gram-negative bacteria. Callinectin was isolated from hemocytes of the blue crab Callinectes sapidus and Mediterranean mussel Mytilus galloprovincialis with the amino acid sequence WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY-NH2 (Figure 4) [43]. Callinectin has three isoforms, hydroxy-N-formylkynurenine group, N-formylkynurenine, and hydroxyl tryptophan, and has diverse functional groups according to changes in the tryptophan residues. Tryptophan modification of callinectin isoforms were reported in the AMPs of marine animals [44]. Callinectin strongly binds to anti-callinectin-like peptide antibodies in blue crab hemocytes and shows the potential for immunomodulation [43].

Figure 4.

Figure 4

Structures of callinectin. Simulations of the three-dimensional structures were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [43].

3.2.2. Clavanin A and Clavanin-MO

Clavanin A (VFQFLGKIIHHVGNFVHGFSHVF-NH2) was isolated from hemocytes of the marine tunicate Styela clava [45]. Clavanin A shows broad antimicrobial activity both in vitro and in vivo against Gram-negative and Gram-positive drug-resistant bacteria and fungi. Clavanin-MO (FLPIIVFQFLGKIIHHVGNFVHGFSHVF-NH2) was synthesized by adding five hydrophobic amino acids to the N-terminus of clavanin A, which improved its cell interaction and ability to penetrate cell membranes compared to clavanin A (Figure 5). Clavanin-MO shows antibacterial activity against Escherichia coli and Staphylococcus aureus, and has been shown to suppress inflammatory responses that cause sepsis and destroy certain biofilms [46]. Both clavanin A and clavanin-MO affect components of the immune system and influence the inflammatory response through their immunomodulatory properties in C57BL/6 mice. The peptides increased the level of IL-10, an anti-inflammatory cytokine, and decreased the levels of IL-12 and TNF-α, two pro-inflammatory cytokines that boost inflammation and may lead to excessive damage [46].

Figure 5.

Figure 5

Structures of clavanin A (a) and clavanin-MO (b). Simulations of the three-dimensional structures for A and B were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [46].

3.2.3. Crustin

Crustins, found in crustaceans, are cysteine-rich AMPs with a typical whey acidic protein (WAP) domain and play an important role in innate immune mechanisms [47]. The WAP domain is a conserved motif containing twelve cysteine residues with six disulfide bonds (Figure 6). Crustins with specific activity against marine Gram-positive bacteria Corynebacterium glutamicum have been reported in various crustaceans such as C. maenas, Pacifastacus leniusculus, Scylla paramamosain, and Penaeus monodon (MW 7–14 kDa). Crustins are released from the hemocytes of crustaceans by exocytosis [47,48,49,50,51].

Figure 6.

Figure 6

Amino acid sequences of crustin from the haemocyte of the mud crab Scylla serrata (Genbank: ADW11096.1) [47]. (a) Amino acid residues in the open square box indicate a putative signal sequence. Cysteine residues that participate in the formation of intramolecular disulfide bonds are red characters and the WAP domain is denoted in the gray box. Six disulfide bonds indicated green lines. (b) Structural model of active crustin of S. serrata created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.4. Defensin

Defensins are small cysteine-rich cationic AMPs that act as host defense peptides (Figure 7). Defensin was found in various sources, including animals, plants, and insects. The human defensins are classified into the α-defensins and β-defensins on the basis of their sequence homology and their cysteine residues. The first marine defensin was isolated by acidified gill extraction from Crassostrea virginica [52,53]. Defensins are antimicrobial peptides that disrupt the membrane of microbial pathogens and play a major role in immunomodulation by acting in the innate and adaptive immune response [54]. Marine-derived defensins were isolated from the oysters C. gigas and C. virginica and mussels Mytilus edulis and M. galloprovincialis. Three types of defensins (Cg-Defs) were identified in the pacific oyster C. gigas (Cg-defh1 and Cg-defh2) and hemocytes. Two defensins, MGD1 and MGD2, derived from M. galloprovincialis showed potent antimicrobial activity by activating the immune response [55]. Following bacterial infection, an increase of MGD-1 in M. galloprovincialis plasma and MGD-2 stimulated the release from hemocytes.

Figure 7.

Figure 7

Amino acid sequences of defensin from the oysters Crassostrea gigas (Genbank: ACQ76262.1) [52]. (a) Amino acid residues in the open square box indicate a putative signal sequence. The active defensin is denoted in the gray box. (b) Structural model of defensin of C. gigas created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.5. Myticin

Myticin is also a cysteine-rich AMP derived from the Mediterranean mussel M. galloprovincialis. It has three isoforms, myticin A, myticin B, and myticin C. Myticin A (4.438 Da) and B (4.562 Da) were identified in the hemocytes and plasma of M. galloprovincialis and showed antibacterial activity against Gram-positive bacteria [56]. Myticin C showed antibacterial activity against the fungus Fusarium oxysporum and E. coli as well as Gram-positive bacteria and acted as an immunomodulator in vivo [57]. RT-qPCR analysis revealed immune-related Myticin C gene expression following in vivo immunostimulation in mussels, indicating its important role in innate immune defense (Figure 8) [58].

Figure 8.

Figure 8

Amino acid sequences of myticin C from the Mediterranean mussel Mytilus galloprovincialis (Genbank: AEZ79080.1) [58]. (a) Amino acid residues in the open square box indicate a putative signal sequence. The mature peptides are denoted in the gray box. Black-lined amino acid residues indicate C-terminal regions. (b) Structural model of myticin C of M. galloprovincialis created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.6. Mytilin

Mytilins are cysteine-rich cationic AMPs found in marine mollusks. Mytilin A and mytilin B, isoforms mytilin C, mytilin D, and mytilin G1 were isolated from Mytilus edulis and M. galloprovincialis (Figure 9). All mytilin isoforms show potent antimicrobial activities [59,60]. Mytilins are transported through hemocytes to reach bacteria, and cells containing mytilin act as phagocytosing bacteria to prevent microbes from entering the circulatory system [60].

Figure 9.

Figure 9

Amino acid sequences of mytilin B from the Mediterranean mussel Mytilus galloprovincialis (Genbank: AAD45013.1) [59]. (a) Amino acid residues in the open square box indicate a putative signal sequence. (b) Structural model of active mytilin B of M. galloprovincialis created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.7. Mytimycin

Mytimycin is an antifungal peptide (6233.5 Da) isolated from the blue mussel Mytilus edulis and M. galloprovincialis [55,59]. Mytimycin, which consists of 12 cysteines connecting six disulfide bridges and an C-terminal extension that contains an EF-hand domain (Ca2+ binding motif), defends against invading pathogenic microbes. The gene responsible for mytimycin is mainly expressed in circulatory hemocytes (Figure 10) [61].

Figure 10.

Figure 10

Amino acid sequences of mytimycin from the blue mussel Mytilus edulis (Genbank: AET85056.1) [61]. (a) Amino acid residues in the open square box indicate a putative signal sequence. Cysteine residues that participate in the formation of intramolecular disulfide bonds are red characters and the mature peptide is denoted in the gray box. Six disulfide bonds are indicated by green lines. Black-lined amino acid residues indicate EF hands, Ca2+ binding motif. (b) Structural model of active mytimycin of M. edulis created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.8. Phosvitin-Derived Peptide (Pt5)

Zebrafish phosvitin-derived peptide Pt5, consisting of the C-terminal 55 residues of phosvitin, has been shown to have antimicrobial activity and immunomodulatory activity comparable to phosvitin in vitro. Amino acid sequence of Pt5 was SRMSKTATIIEPFRKFHKDRYLAHHSATKDTSSGSAAASFEQMQKQNRFLGNDIP (Figure 11). Pt5 has been reported to increase the survival rate of zebrafish infected by Aeromonas hydrophila by significantly decreasing the number of A. hydrophila in the blood, spleen, kidneys, liver, and muscles. Pt5 also inhibits the expression of proinflammatory cytokine genes (IL-1β, IL-6, TNF-α, and IFN-γ) in the spleen and head kidneys of A. hydrophila-infected zebrafish, but increased the expression of anti-inflammatory cytokine genes (IL-10 and IL-14) [62].

Figure 11.

Figure 11

Structural model of Zebrafish phosvitin-derived peptide Pt5, created using the SWISS-MODEL server (https://swissmodel.expasy.org/) [62].

3.2.9. Salmo Salar NK-Lysin-Derived Peptides

NK-lysin are AMPs composed of 74 to 78 residues and that contain six cysteine residues that form three disulfide bonds and a C-terminal region that contains a saposin B-type domain (Figure 12). Peptide activity depends on these intact disulfide bonds, and the antimicrobial activity of NK-lysin was inhibited when the peptide was pre-treated with dithiothreitol [63]. NK-lysin from Atlantic salmon (Salmo salar) induced the expression of proinflammatory cytokines (IL-1β and IL-8) in the S. salar head kidney leukocytes. NK-lysin modulates the immune response, suggesting its potential for enhancing the immune response in fish [64].

Figure 12.

Figure 12

Amino acid sequences of NK-lysin from Atlantic salmon (Salmo salar) (Genbank: XP_013985382) [63]. (a) Amino acid residues in the open square box indicate a putative signal sequence. Cysteine residues that participate in the formation of intramolecular disulfide bonds are red characters and the saposin B domain is denoted in the gray box. (b) Structural model of active NK-lysin (saposin B) created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.10. Scygonadin

Scygonadin (10.8 kDa) is an anionic AMP isolated from the seminal plasma of the mud crab Scylla serrata (Figure 13) [65,66]. Scygonadin are AMPs involved in the host defense by protecting the reproductive system of organisms [66].

Figure 13.

Figure 13

Amino acid sequences of scygonadin from the seminal plasma of the mud crab Scylla serrata (Genbank: AAW57403.1) [65]. (a) Amino acid residues in the open square box indicate a putative signal sequence. (b) Structural model of active scygonadin of S. serrata created using the SWISS-MODEL server (https://swissmodel.expasy.org/).

3.2.11. Thalassospiramides A and D

Thalassospiramides A and D, which are cyclic lipopeptides, were isolated from Thalassospira sp. Thalassospiramide D differs in structure at the N-terminus in which the proteinogenic serine residue in thalassospiramide A is replaced with the nonstandard phenylalanine-based statine residue 4-amino-3-hydroxy-5-phenylpentanoic acid (Figure 14) [67]. Thalassospiramides A and D suppressed lipopolysaccharide (LPS)-induced nitric oxide (NO) production by murine macrophage RAW 264.7 cells [68]. Thalassospiramides A and D were inhibited by IL-5, which plays an important role in TH2-mediated inflammatory diseases such as asthma.

Figure 14.

Figure 14

Chemical structures of thalassospiramide A (a) and thalassospiramide D (b) created using the Chemdraw. Lipopeptide side chain indicated by two elliptical circles [67,68].

3.2.12. Tilapia Piscidin 3 (TP3) and Tilapia Piscidin 4 (TP4)

The tilapia piscidins are a group of peptides with antimicrobial, wound-healing, and antitumor functions. TP3 (FIHHIIGGLFSVGKHIHSLIHGH) and TP4 (FIHHIIGGLFSAGKAIHRLIRRRRR) are AMPs isolated from Oreochromis niloticus (Figure 15). TP3 and TP4 significantly increased the expression of several immune-related genes in muscle (IL-1β, IL-6, IL-8 TGF-β, and IκB) and decreased the expression of Toll-like receptor 5 (TLR5) after Vibrio vulnificus infection. Infection with Streptococcus agalactiae significantly decreased IL-1β, IL-8, TLR5, TGF-β, and IκB. TP3 and TP4 show potential for development as drug candidates to combat fish bacterial infections in aquaculture [69].

Figure 15.

Figure 15

Structures of TP3 (a) and TP4 (b). Simulations of the three-dimensional structures for A and B were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [69].

3.3. Immunomodulatory Protein Hydrolysates

Protein hydrolysates derived from various proteins have been reported to have a wide range of biological activities, such as anti-inflammatory, anticancer, antioxidant, antimicrobial, anti-hypertensive, and immunomodulatory activities [17,20,70,71]. During protein hydrolysis, peptide bond cleavage results in the formation of bioactive peptides with different sizes. Several proteolytic enzymes were successfully used to produce immunomodulatory protein hydrolysates. These enzymes include pancreatin, KojizymeTM, trypsin, Alcalase®, Flavourzyme®, ProtamexTM, α-chymotrypsin, pepsin, Neutrase®, and thermolysin.

Immunomodulatory protein hydrolysates have not been reported to be cytotoxic, unlike protein hydrolysates with antibacterial or anticancer activity [70]. Antimicrobial peptides are important in the first line of the host defense system against pathogenic microorganisms that easily come in contact with the host through the environment [52,53]. Antimicrobial peptides from marine protein hydrolysates are increasingly isolated and reported during the last few years [72,73,74,75,76]. Since there are few reports of marine-derived protein hydrolysates having both antibacterial and immunomodulatory activity, this review summarizes the immunomodulatory protein hydrolysates isolated from diverse marine sources (Table 4).

Table 4.

Immunomodulatory protein hydrolysates from diverse marine sources.

Name of hydrolysate Source/amino acid sequence, MW Treated enzymes Mechanism of action Ref.
Chlorella protein hydrolysate Algae: Chlorella vulgaris
(<5000 Da)
Pancreatin Enhanced hemopoiesis, leukocyte count, peritoneal exudate cells, macrophage activity; stimulation of both humoral and cell-mediated immune functions (T-dependent antibody response and reconstitution of delayed-type hypersensitivity response) in BALB/c mice [77]
Ecklonia protein hydrolysate Algae: Ecklonia cava KojizymeTM Increases in lymphocytes, monocytes, and granulocytes; increase in numbers of CD4+ T cells, CD8+ T cells, and CD45R/B220+ B cells; down-regulation of TNF-α and IFN-γ, up-regulation of IL-4 and IL-10 in ICR mice [78]
Porphyra protein hydrolysate Algae: Porphyra columbina Alcalase®, trypsin, combination of both protease Cytokine modulations (inhibition of TNF-α and IFN-γ, increase of IL-10) in rat splenocytes [79]
Porphyra columbina protein hydrolysate Algae: Porphyra columbina Flavourzyme® and fungal protease concentrate Immunomodulatory effects on rat macrophages and lymphocytes, activates NF-κB- and MAPK-dependent pathways, and mainly induces IL-10 production; inhibition of TNF-α, IL-1β, and IL-6 [80]
Edible red algae protein hydrolysate Algae: Porphyra tenera Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, amyloglucosidase (AMG), Celluclast®, Dextrozyme®, Maltogenase, Promozyme, Termamyl®, Viscozyme® Inhibition of LPS-induced NO production by murine macrophage RAW 264.7 cells [81]
Edible microalgae Spirulina protein hydrolysate Algae: Spirulina maxima
LDAVNR (686 Da), MMLDF (655 Da)
Trypsin, pepsin, α-chymotrypsin Inhibited histamine release and production from RBL-2H3 mast cells; interference with signaling pathways dependent on Ca2+ and microtubules (LDAVNR); inhibition of phospholipase Cγ activation and reactive oxygen species formation (MMLDF); NF-κB translocation and formation of IL-4 [82]
Oyster peptide-based enteral
nutrition formula
Oyster: Crassostrea hongkongensis Bromelain, pepsin, trypsin Enhanced spleen lymphocyte proliferation and activity of NK cells in BALB/c mice [83]
Oyster protein hydrolysate Oyster: Crassostrea gigas
(<3 kDa)
Protease from Bacillus sp. SM98011 Enhanced spleen lymphocyte proliferation; macrophage phagocytosis and NK cell cytotoxicity in BALB/c mice [15]
Paphia undulata meat protein hydrolysate Mollusk: Paphia undulata
PHTC, VGYT, EF, LF and EGAL,
WI, or WL
Protease from Bacillus subtilis Enhanced mice spleen lymphocyte proliferation ability ex vivo [84]
Cyclina sinensis protein hydrolysate Venus clam: Cyclina sinensis
RVAPEEHPVEGRYLV (1750.81 Da)
Pepsin Enhanced macrophage phagocytosis, increased production of NO, TNF-α, IL-6, and IL-1β, and up-regulated protein levels of iNOS, NF-κB, and NLRP3 in RAW 264.7 cells; down-regulation of the expression of inhibitor of IκB-α; stimulation of macrophage activities by activating the NF-κB signaling pathway [85]
Rudi tapes protein hydrolysate Short-necked clam: Ruditapes philippinarum
QCQQAVQSAV (876 Da)
Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, α-chymotrypsin, papain, pepsin, trypsin NO inhibitory activity in LPS-stimulated RAW 264.7 macrophages [86]
Shellfish Mytilus protein hydrolysate Shellfish: Mytilus coruscus
GVSLLQQFFL (1151.37 Da)
Alcalase®, Flavourzyme®, Neutrase®, α-chymotrypsin, papain, pepsin, trypsin Inhibited LPS-induced NO production in RAW264.7 macrophages [87]
Alaska pollock protein hydrolysate Alaska pollock: Theragra chalcogramma
PYGADY (622 Da)
Trypsin Enhanced humoral, cellular, and non-specific immunity in immunosuppressed mice [88]
Alaska pollock frame protein hydrolysate Alaska Pollock: Theragra chalcogramma
NGMTY (584 MW), NGLAP (470 MW), and WY (305 MW)
Trypsin Enhanced mice spleen lymphocyte proliferation activity [89]
Fermented pacific whiting protein Fish: Merluccius merluccius
(<1 kDa)
Yeast Enhanced phagocytic activity of peritoneal macrophages, increased number of IgA+ cells, and increased IL-4, IL-6, IL-10, IFN-γ, and TNF-α levels in the small intestine lamina propria in mice [90]
Chum salmon oligopeptide preparation Fish: Oncorhynchus keta
(300–860 Da)
Complex protease Enhanced lymphocyte proliferation capacity increased number of plaque-forming cells, increased NK cell activity, increased percentage of CD4+ TH cells in spleen and secretion of TH1 (IL-2, IFNγ) and TH2 (IL-5, IL-6)-type cell cytokines in ICR mice [91]
Salmon fish protein hydrolysate Fish: Atlantic salmon fish
(Contained 60–70% di/tri peptides
of < 10 kDa)
Endogenous hydrolyzing agents Changes of IgM, IgG, and IgA and CD4/CD8 ratios were observed in malnourished Indian children [92]
Salmon byproduct protein Salmon fish byproduct from pectoral fin
(1000–2000 Da)
Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, pepsin, trypsin Inhibited TNF-α, IL-6, and IL-1β in LPS-induced RAW264.7 macrophages [93]
Salmon pectoral fin byproductprotein Salmon fish byproduct from pectoral fin
PAY (349.15 Da)
Pepsin Inhibited production of NO and prostaglandin E2; production of pro-inflammatory cytokines, TNF-α, IL-6, and IL-1β in LPS-stimulated RAW264.7 cells [94]
Shark-derived protein hydrolysate PeptiBalTM, (innoVactiv, Inc.)
(<10 kDa)
Trypsin, α-chymotrypsin Enhanced gut barrier function via up-regulation of IgA-producing cells and intestinal cytokine production, including IL-6 and TNF-α in mice; inhibited production of TGF-β and IL-10 caused by infection with enterotoxigenic E. coli H10407 [95]
Sweetfish-derived protein hydrolysate Sweetfish Pepsin, trypsin, α-chymotrypsin Inhibited production of NO, cytokines (TNF-α and IL-6), and PGE2 in LPS-induced RAW264.7 macrophages [96]
Common carp egg protein hydrolysate Fish: Cyprinus carpio egg
(5-90 KDa)
Alcalase®, pepsin, trypsin Enhanced proliferation of spleen lymphocytes, NK cell cytotoxicity, macrophage phagocytosis, level of mucosal immunity (S-IgA), and percentages of CD4+ and CD8+ cells in BALB/c mice [97]
Rohu egg protein hydrolysate Fish: Labeo rohita egg
(<10 kDa)
Alcalase®, pepsin, trypsin Significantly enhanced macrophage phagocytosis, NK cell cytotoxicity, mucosal immunity (S-IgA), splenic CD4+ & CD8+ T cells, and level of serum IgA in mice [98]

3.3.1. Chlorella Protein Hydrolysate

An enzymatic protein hydrolysate from the green microalga Chlorella vulgaris was prepared by hydrolysis of an ethanol-extracted cell biomass with pancreatin (Sigma-Aldrich, St. Louis, MO, USA). Both innate and specific immune responses (such as bone marrow cellularity and leukocyte counts in peripheral blood) were recovered when Chlorella protein hydrolysate was orally administrated in undernourished BALB/c mice, including significant increases in the lymphocyte pool, production of T-cell dependent antibody reactions, and reconstruction of delayed-type hypersensitivity reactions [77]. Starved mice treated with Chlorella protein hydrolysate showed a larger number of peritoneal exudate cells and higher activation of macrophages compared to non-supplemented mice. Additionally, stimulation of the mononuclear phagocytic system occurred as carbon clearance increased in the peripheral blood.

3.3.2. Ecklonia Protein Hydrolysate

An enzymatic protein hydrolysate from the brown seaweed Alariaceae Ecklonia cava was prepared by hydrolysis of cell biomass with Kojizyme (Novo Nordisk, Bagsvaerd, Denmark). Ecklonia cava hydrolysate was shown to activate or suppress immune cell functions of murine splenocytes in vitro. ICR mice injected with Ecklonia protein hydrolysate showed enhanced splenocyte proliferation and increased numbers of splenocytes, lymphocytes, monocytes, and granulocytes. The numbers of CD4+ T cells, CD8+ T cells, and CD45R/B220+ B cells also increased. Additionally, TNF-α and IFN-γ, which are type Th1 cytokines, were downregulated by Ecklonia protein hydrolysate, while the type TH2 cytokines IL-4 and IL-10 were upregulated. Thus, Ecklonia protein hydrolysate has immunomodulatory effects and activates anti-inflammatory responses [78].

3.3.3. Porphyra Protein Hydrolysate

An enzymatic protein hydrolysate from the algae Porphyra columbina was prepared by hydrolysis with Alcalase® (Danisco S.A., Arroyito, Cordoba, República Argentina), trypsin, and a combination of both proteases. The hydrolysate showed immunosuppressive effects in rat splenocytes by enhancing anti-inflammatory cytokine (IL-10) production, while the production of pro-inflammatory cytokines such as TNF-α and IFN-γ was decreased [79].

3.3.4. Porphyra columbina Protein Hydrolysate

An enzymatic protein hydrolysate from P. columbina was prepared by hydrolysis with flavourzyme (Sigma-Aldrich, St. Louis, MO, USA) and fungal protease concentrate. P. columbina protein hydrolysate was enriched in aspartic acid, alanine, and glutamic acid. It showed immunomodulatory effects on primary splenocytes, macrophages, and T lymphocytes in vitro. IL-10 secretion was increased in splenocytes (235%), macrophages (150%), and lymphocytes (472%) following treatment with P. columbina protein hydrolysate, while the production of TNF-α, IL-1β, and IL-6 by macrophages was inhibited (15–75%). The effect of P. columbina protein hydrolysate on IL-10 occurred through JNK, p38 MAPK, and NF-κB pathways in T cells [80].

3.3.5. Edible Red Algae Protein Hydrolysate

An enzymatic protein hydrolysate from the edible red algae Porphyra tenera was prepared by hydrolysis with four proteases (Alcalase®, Flavourzyme®, Neutrase®, and ProtamexTM) and seven carbohydrases [amyloglucosidase (AMG), Celluclast®, Dextrozyme®, Maltogenase, Promozyme, Termamyl®, and Viscozyme®]. These enzymatic hydrolysates showed antioxidant, anti-acetylcholinestrase (AChE), and anti-inflammation activities. Edible red algae protein hydrolysate showed no cytotoxicity in RAW264.7 macrophages, and inhibited LPS-induced NO production in RAW264.7 macrophages [81]. Therefore, edible red algae protein hydrolysate shows potential as a source of anti-inflammatory drugs.

3.3.6. Edible Microalgae Spirulina Protein Hydrolysate

An enzymatic protein hydrolysate from the filamentous blue-green algae Spirulina maxima was prepared by hydrolysis with trypsin, pepsin, and α-chymotrypsin (Sigma-Aldrich, St. Louis, MO, USA). Two peptides, LDAVNR (P1, 686 Da) and MMLDF (P2, 655 Da), from edible microalgae Spirulina protein hydrolysate significantly inhibited RBL-2H3 mast-cell degranulation by decreasing histamine release and increasing intracellular Ca2+. The inhibitory activity of P1 by blocking Ca2+- and microtubule-dependent signaling pathways, and the suppression of P2 were involved in phospholipase Cγ activation and reactive oxygen species production. Additionally, the inhibitory effect of P1 and P2 on the generation of IL-4 occurred via decreased nuclear factor-κB translocation [82].

3.3.7. Oyster Peptide-Based Enteral Nutrition Formula

An enzymatic peptide-based enteral nutrition formula from the oyster Crassostrea hongkongensis was prepared by hydrolysis with bromelain, pepsin, and trypsin. The immunological effects of an oyster peptide-based enteral nutrition formula using malabsorption mice and cyclophosphamide-induced immunosuppression mice were investigated, and spleen lymphocyte proliferation and NK cell activity was observed to be enhanced. This indicates that an oyster peptide-based enteral nutrition formula has an immune-stimulating effect on mice [83].

3.3.8. Oyster Protein Hydrolysate

An oligopeptide-enriched protein hydrolysate oyster C. gigas was prepared by hydrolysis with protease from Bacillus sp. SM98011. The growth of implantable sarcoma-S180 was inhibited in a dose-dependent manner in BALB/c mice injected with oyster protein hydrolysate. Additionally, the body weight of BALB/c mice was further reduced by oral administration of oyster protein hydrolysate, while the weight coefficients of the thymus and spleen, activity of NK cells, spleen proliferation of lymphocytes, and growth of macrophages in mice with S180 increased markedly after administration of oyster protein hydrolysate. These results showed that oyster protein hydrolysate has strong immunostimulation activity in mice, which may lead to antitumor activity [15].

3.3.9. Paphia Undulata Meat Protein Hydrolysate

An enzymatic protein hydrolysate from the Chinese clam Paphia undulata was prepared by hydrolysis with alkaline protease from Bacillus subtilis. The isolated fractions (P2 and P3) of P. undulata meat protein hydrolysate contained the peptides PHTC, VGYT, EF, LF, EGAL, WI, or WL, respectively. Amino acid analysis of P2 and P3 confirmed that the DPPH radical scanning activity was strong because of the high levels of hydrophobic amino acids, including leucine, phenylalanine, valine, and tryptophan. In addition, P. undulata meat protein hydrolysate enhances spleen lymphocyte proliferation activity [84].

3.3.10. Cyclina sinensis Protein Hydrolysate (Novel Pentadecapeptide)

An enzymatic protein hydrolysate from the bivalve mollusk Cyclina sinensis was prepared by hydrolysis with pepsin. Cyclina sinensis protein hydrolysate with a molecular weight of less than 3 kDa showed immunomodulatory activity with the highest relative proliferation rate in RAW264.7 macrophages. The amino acid sequence of this novel pentadecapeptide is RVAPEEHVEGRYLV (1750.81 Da) and its immunomodulatory activity was found to result in enhanced macrophage phagocytosis, increased productions of NO, TNF-α, IL-6, and IL-1β, and up-regulation of the levels of iNOS, NF-κB, and NLRP3 in RAW264.7 cells (Figure 16). Thus, this protein hydrolysate shows potential for immunomodulation because it can facilitate macrophage activity by activating the NF-κB signaling pathway [85].

Figure 16.

Figure 16

Structures of Cyclina sinensis protein hydrolysate (novel pentadecapeptide) from the bivalve mollusk Cyclina sinensis. Simulations of the three-dimensional structures were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [85].

3.3.11. Ruditapes Protein Hydrolysate

An enzymatic protein hydrolysate from short-necked clam, Ruditapes philippinarum, was prepared by hydrolysis with eight proteases (Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, α-chymotrypsin, papain, pepsin, and trypsin). These enzymatic hydrolysates showed NO-inhibitory activity. Among the purified peptides in the Ruditapes protein hydrolysate, the NO-inhibitory peptide consisted of 10 amino acid residues (QCQAVASAV, 876 Da) at the N-terminal region (Figure 17). Additionally, purified peptides inhibited NO production in LPS-stimulated RAW264.7 cells. Purified peptides in the Ruditapes protein hydrolysate showed strong anti-inflammatory activity [86].

Figure 17.

Figure 17

Structures of Ruditapes protein hydrolysate from short-necked clam, Ruditapes philippinarum. Simulations of the three-dimensional structures were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [86].

3.3.12. Shellfish Mytilus Protein Hydrolysate

An enzymatic protein hydrolysate from shellfish, Mytilus coruscus, was prepared by hydrolysis with eight proteases (Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, α-chymotrypsin papain, pepsin, and trypsin). Among the purified peptides in the Mytilus protein hydrolysate, the anti-inflammatory peptide consisted of 10 amino acid residues (GVSLLEEFFL, 1151.37 Da) at the N-terminal region (Figure 18). Additionally, purified peptides were found to inhibit NO production in LPS-stimulated RAW264.7 cells. Purified peptides in the shellfish Mytilus protein hydrolysate show anti-inflammatory activities [87].

Figure 18.

Figure 18

Structures of shellfish Mytilus protein hydrolysate from shellfish, Mytilus coruscus. Simulations of the three-dimensional structures were obtained from http://mobyle.rpbs.univ-paris-diderot.fr/cgi-bin/portal.py#forms::PEP-FOLD [87].

3.3.13. Alaska Pollock Protein Hydrolysate

An enzymatic protein hydrolysate from Alaska pollock (Theragra chalcogramma) was prepared by hydrolysis with trypsin (Sigma-Aldrich, St. Louis, MO, USA). The molecular weight of this hydrolysate is 622 Da and amino acid sequence is PTGADY. The hydrolysate was confirmed to have immunomodulatory activity, resulting in increased production of IL-2, IL-4, and IL-6 in immunosuppressed mice. Additionally, purified Alaska pollock protein hydrolysate significantly enhanced humoral, cellular, and non-specific immunity in immunosuppressed mice [88].

3.3.14. Alaska Pollock Frame Protein Hydrolysate

An enzymatic protein hydrolysate from Alaska pollock (T. chalcogramma) were prepared by hydrolysis with seven proteases (alkaline protease, bromelain, Flavourzyme®, mixed enzymes for animal proteolysis, neutral protease, papain, and trypsin). The amino acid sequences of Alaska pollock frame protein hydrolysates are NGMTY (584 Da), LGLAP (470 Da), and WY (305 Da). These protein hydrolysates show immunomodulatory activity with the highest relative lymphocyte proliferation activity. The main amino acid residues in the purified Alaska pollock frame protein hydrolysate were proline, aspartate, glutamic acid, and leucine, and the peptides enriched with the main amino acid residues affected immunomodulatory activity [89].

3.3.15. Fermented Pacific Whiting Protein

The fish protein concentrate from pacific whiting Merluccius merluccins were prepared by fermentation followed by proteolysis. In mice injected with fermented pacific whiting protein, the number of immunoglobulin A (IgA) cells increased in the small intestine laminaria propria, but not in the bronchial tissues. Significant increases in IL-4, IL-6, and IL-10 were observed in the laminar propria of mice injected with fermented pacific whiting protein. Pro-inflammatory cytokines (IFN and TNF-α) also increased, while intestinal homeostasis was maintained and no tissue damage was observed [90].

3.3.16. Chum Salmon Oligopeptide Preparation

An enzymatic protein hydrolysate from the chum salmon Oncorhynchus keta was prepared by hydrolysis with complex protease. The molecular weight distribution of chum salmon oligopeptide preparations was 300–860 Da, and its main amino acid composition was glutamic acid, aspartic acid, lysine, leucine, arginine, and glycine. Chum salmon oligopeptide preparation greatly improved lymphocyte proliferation induced by mitogen concanavalin A, the number of plaque-forming cells, NK cell activity, the ratio of CD4+ TH cells in the spleen, and the secretion of TH1 (IL-2, IFN-γ) and TH2 (IL-5, IL-6) cytokines in female ICR mice. No differences were observed in weight gain, lymphoid organ indices, and phagocytosis capacity. Chum salmon oligopeptide preparation was confirmed to enhance the immune response of the host [91].

3.3.17. Salmon Fish Protein Hydrolysate

Protein hydrolysate from Atlantic salmon was prepared by hydrolysis with endogenous hydrolyzing agents. The hydrolysates contained 60–70% di/tri peptides (less than 10 kDa). Following ingestion of salmon fish protein hydrolysate to malnourished children with grade I and II (Gomez’s classification), the immunoglobulin, CD4/CD8 ratio, and hemoglobin levels measured as immunological parameters did not vary significantly. Thus, salmon fish protein hydrolysate may be useful as a safe nutrient supplement for malnourished children [92].

3.3.18. Salmon Byproduct Protein Hydrolysate

Enzymatic protein hydrolysate from salmon byproduct protein from the pectoral fin was prepared by hydrolysis with six proteases (Alcalase®, Flavourzyme®, Neutrase®, ProtamexTM, pepsin, and trypsin). Salmon byproduct protein hydrolysate showed potent DPPH and hydrogen peroxide scavenging activities in a dose-dependent manner. Among the protein hydrolysates, salmon byproduct protein hydrolysate 1, which showed the highest antioxidant action among purified salmon byproduct protein hydrolysates, had a molecular weight of 1000–2000 Da. Its antioxidant amino acids (such as tyrosine, phenylalanine, proline, alanine, histidine, and leucine) account for 28.62% of the total amino acid content. Salmon byproduct protein hydrolysate 1 shows no cytotoxicity in Chang liver or RAW264.7 macrophage cells and inhibits intracellular reactive oxygen species generation, lipid peroxidation, and glutathione levels in in Chang liver cells. Salmon byproduct protein hydrolysate 1 also shows anti-inflammatory activity by inhibiting NO production and proinflammatory cytokines (TNF-α, IL-6, and IL-1β) in RAW264.7 cells [93].

3.3.19. Salmon Pectoral Fin Byproduct Protein Hydrolysate

Enzymatic protein hydrolysates from salmon byproduct protein from the pectoral fin were prepared by hydrolysis with pepsin. All salmon pectoral fin byproduct protein hydrolysates showed anti-inflammatory activities. Among the protein hydrolysates, the tripeptide (PAY), which had a molecular weight of 349.15 Da, exhibited strong NO- and prostaglandin E2 (PGE2)-inhibition activity in LPS-stimulated RAW264.7 macrophages. Additionally, PAY significantly inhibited the protein expression of inducible NO synthase and cyclooxygenase-2 responsible for generating NO and PGE2. PAY treatment also inhibited the production of inflammatory cytokines (TNF-α, IL-1β, and IL-6) [94].

3.3.20. Shark-Derived Protein Hydrolysate

Enzymatic protein hydrolysates from shark-derived protein (PeptiBalTM, innoVactiv, Inc., Rimouski, Canada) were prepared by hydrolysis with trypsin and α-chymotrypsin. All shark-derived protein hydrolysates had molecular weights below 10 kDa. Following oral administration of shark-derived protein hydrolysate, intestinal barrier function was enhanced by increasing the production of IgA and intestinal cytokines (IL-6 and TNF-α). Increased TGF-β and IL-10 contributed to the uncontrolled inflammatory response caused by infection with enterotoxigenic E. coli H10407. This confirmed that shark-derived protein hydrolysate can be used as a pharmaceutical agent to reduce the risk of bacterial infections and inflammatory-related diseases [95].

3.3.21. Sweetfish-Derived Protein Hydrolysate

Enzymatic protein hydrolysates from sweetfish-derived proteins were prepared by hydrolysis with pepsin, trypsin, and α-chymotrypsin. Sweetfish-derived protein hydrolysate inhibited the production of NO, inflammatory cytokines (TNF-α and IL-6), and PGE2 in LPS-stimulated RAW264.7 cells. Moreover, sweetfish-derived protein hydrolysate inhibited the mRNA expression levels of inflammation-mediated proteins and inhibition of NF-κB activation. These results suggest that sweetfish-derived protein hydrolysates can be used as anti-inflammatory agents [96].

3.3.22. Common Carp Egg Protein Hydrolysate

Enzymatic protein hydrolysates from common carp (Cyprinus carpio) egg were prepared by hydrolysis with Alcalase®, pepsin, and trypsin. The molecular weights of the three sweetfish-derived protein hydrolysates were 5–90 kDa and contained high levels of essential amino acids and docosahexaenoic acid among ω-3 fatty acids. The three sweetfish-derived protein hydrolysates increased the proliferation of spleen lymphocytes, serum IgA, spleen NK cytotoxicity, and mucosal immunity (secretory IgA), as well as induced spleen CD4+ and CD8+ cells in female BALB/c mice. The results confirmed that sweetfish-derived protein hydrolysates can improve immune system function [97].

3.3.23. Rohu Egg Protein Hydrolysate

Enzymatic protein hydrolysates from rohu (Labeo rohita) egg were prepared by hydrolysis with Alcalase®, pepsin, and trypsin. The molecular weights of rohu egg protein hydrolysates were less than 10 kDa. Rohu egg protein hydrolysate increased splenic NK cell cytotoxicity, macrophage phagocytosis, serum IgA levels, mucosal immunity (secretory IgA) in the gut, and percentages of spleen CD4+ and CD8+ cells in BALB/c mice. The results confirmed that rohu egg protein hydrolysates can improve immune function [98].

4. Marine Immunomodulatory Peptide-Based Drug Therapeutics and Future Prospects

Immunomodulatory protein, peptides, or protein hydrolysates act on a variety of targets, containing monocytes, macrophages, NK cells, T and B lymphocytes, CD4+ and CD8+ T cells, and CD45R/B220+ B cells (Table 1, Table 2 and Table 3). The mechanisms of action of marine-derived immunomodulatory proteins, peptides, or protein hydrolysates mainly affects by macrophages activation; phagocytosis stimulation; increased number of leukocytes; increased production of NO, immunoglobulins, and cytokines; splenocyte proliferation; NK cell stimulation; and activation of the NF-κB- and MAPK-dependent pathways (Figure 19).

Figure 19.

Figure 19

Mechanisms of the immunomodulatory effect from marine-derived protein, peptide, or protein hydrolysates.

The number of elderly people in the population is increasing. As people age, immune system function decreases and inflammation increases. This leads to a greater number of infections and higher death rates [99]. Innate immune responses are affected by various factors. During aging, cytokine production by monocytes and macrophages is altered, phagocytotic capacity is decreased, and TLR expression is reduced [100]. Marine-derived proteins, peptides, and protein hydrolysates were found to be capable of controlling immune functions [90]. Thus, marine-derived proteins, peptides, and protein hydrolysates palliated weakening of the immune system, thus improving the quality of life and reducing medical costs as well as contributing to immunity.

5. Conclusions

Bioactive proteins, peptides, or protein hydrolysates from marine biomaterials, particularly their immunomodulatory effects, have been widely studied. A recent increase in the incidence of various diseases has prompted attempts to use various immunomodulatory agents to control these diseases. Most studies have focused on evaluating immune effects of marine-derived biomaterials in cellular culture or animal studies, and subsequent studies in humans are rare. Therefore, additional clinical studies are needed to investigate the safety, biocompatibility, and immune effects of immunomodulatory products containing proteins, peptides, and hydrolyzed proteins developed from marine-derived biomaterials in the human body. The effects of immunomodulation by marine-derived proteins or peptides require detailed investigation.

Author Contributions

Writing—original draft preparation, H.K.K. and Y.P.; writing—review and editing, H.K.K., H.H.L., C.H.S. and Y.P.

Funding

This research was funded by a National Research Foundation of Korea (NRF) grant funded by the Korean Government (No. 2019R1A2B5B03070330, NRF-2017M3A9E4077206), a Global Research Laboratory (GRL) Grant (No. NRF-2014K1A1A2064460), and an Institute for Information and Communications Technology Promotion (IITP) grant funded by the Korean Government (MSIT) (No. 2017-0-01714, Development of Antimicrobial Peptide using Deep Learning).

Conflicts of Interest

The authors declare no conflicts of interest.

References

  • 1.Villani A.C., Sarkizova S., Hacohen N. Systems immunology: Learning the rules of the immune system. Annu. Rev. Immunol. 2018;36:813–842. doi: 10.1146/annurev-immunol-042617-053035. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Routy J.P., Mehraj V., Cao W. HIV immunotherapy comes of age: Implications for prevention, treatment and cure. Expert Rev. Clin. Immunol. 2016;12:91–94. doi: 10.1586/1744666X.2016.1112269. [DOI] [PubMed] [Google Scholar]
  • 3.Naidoo J., Page D.B., Wolchok J.D. Immune modulation for cancer therapy. Br. J. Cancer. 2014;111:2214–2219. doi: 10.1038/bjc.2014.348. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Havla J., Kumpfel T., Hohlfeld R. Immunotherapies for multiple sclerosis: Review and update. Internist. 2015;56:432–445. doi: 10.1007/s00108-015-3668-1. [DOI] [PubMed] [Google Scholar]
  • 5.Gruppen M.P., Bouts A.H., Jansen-van der Weide M.C., Merkus M.P., Zurowska A., Maternik M., Massella L., Emma F., Niaudet P., Cornelissen E.A.M., et al. A randomized clinical trial indicates that levamisole increases the time to relapse in children with steroid-sensitive idiopathic nephrotic syndrome. Kidney Int. 2018;93:510–518. doi: 10.1016/j.kint.2017.08.011. [DOI] [PubMed] [Google Scholar]
  • 6.Ulrich C., Bichel J., Euvrard S., Guidi B., Proby C.M., van de Kerkhof P.C.M., Amerio P., Rønnevig J., Slade H.B., Stockfleth E. Topical immunomodulation under systemic immunosuppression: Results of a multicentre, randomized, placebo-controlled safety and efficacy study of imiquimod 5% cream for the treatment of actinic keratoses in kidney, heart, and liver transplant patients. Br. J. Dermatol. 2007;157:25–31. doi: 10.1111/j.1365-2133.2007.08269.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Trabattoni D., Clerici M., Centanni S., Mantero M., Garziano M., Blasi F. Immunomodulatory effects of pidotimod in adults with community-acquired pneumonia undergoing standard antibiotic therapy. Pulm. Pharmacol. Ther. 2017;44:24–29. doi: 10.1016/j.pupt.2017.03.005. [DOI] [PubMed] [Google Scholar]
  • 8.Ekins S., Lingerfelt M.A., Comer J.E., Freiberg A.N., Mirsalis J.C., O’Loughlin K., Harutyunyan A., McFarlane C., Green C.E., Madrid P.B. Efficacy of tilorone dihydrochloride against ebola virus infection. Antimicrob. Agents Chemother. 2018;62:e01711–e01717. doi: 10.1128/AAC.01711-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Ahlmann M., Hempel G. The effect of cyclophosphamide on the immune system: Implications for clinical cancer therapy. Cancer Chemother. Pharmacol. 2016;78:661–671. doi: 10.1007/s00280-016-3152-1. [DOI] [PubMed] [Google Scholar]
  • 10.Cornejo-García J.A., Perkins J.R., Jurado-Escobar R., García-Martín E., Agúndez J.A., Viguera E., Pérez-Sánchez N., Blanca-López N. Pharmacogenomics of prostaglandin and leukotriene receptors. Front. Pharmacol. 2016;7:e316. doi: 10.3389/fphar.2016.00316. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Flores C., Fouquet G., Moura I.C., Maciel T.T., Hermine O. Lessons to learn from low-dose cyclosporin-A: A new approach for unexpected clinical applications. Front. Immunol. 2019;10:e00588. doi: 10.3389/fimmu.2019.00588. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Jantan I., Ahmad W., Bukhari S.N. Plant-derived immunomodulators: An insight on their preclinical evaluation and clinical trials. Front. Plant Sci. 2015;6:e00655. doi: 10.3389/fpls.2015.00655. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Ozkan M.C., Tombuloglu M., Sahin F., Saydam G. Evaluation of immunomodulatory drugs in multiple myeloma: Single center experience. Am. J. Blood Res. 2015;5:95–100. [PMC free article] [PubMed] [Google Scholar]
  • 14.Gong Y., Frederiksen S.L., Gluud C. D-penicillamine for primary biliary cirrhosis. Cochrane Datab. Syst. Rev. 2004;18:CD004789. doi: 10.1002/14651858.CD004789.pub2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Wang Y.K., He H.L., Wang G.F., Wu H., Zhou B.C., Chen X.L., Zhang Y.Z. Oyster (Crassostrea gigas) Hydrolysates produced on a plant scale have antitumor activity and immunostimulating effects in BALB/c mice. Mar. Drugs. 2010;8:255–268. doi: 10.3390/md8020255. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Grienke U., Silke J., Tasdemir D. Bioactive compounds from marine mussels and their effects on human health. Food Chem. 2014;142:48–60. doi: 10.1016/j.foodchem.2013.07.027. [DOI] [PubMed] [Google Scholar]
  • 17.Ruiz-Ruiz F., Mancera-Andrade E.I., Iqbal H.M.N. Marine-derived bioactive peptides for biomedical sectors: A review. Protein Peptide Lett. 2017;24:109–117. doi: 10.2174/0929866523666160802155347. [DOI] [PubMed] [Google Scholar]
  • 18.Page D.B., Bourla A.B., Daniyan A., Naidoo J., Smith E., Smith M., Friedman C., Khalil D.N., Funt S., Shoushtari A.N., et al. Tumor immunology and cancer immunotherapy: Summary of the 2014 SITC primer. J. Immunother. Cancer. 2015;3:25. doi: 10.1186/s40425-015-0072-2. [DOI] [Google Scholar]
  • 19.Nijkamp F.P., Parnham M.J. T Cell Subsets and T Cell-Mediated Immunity in Principles of Immunopharmacology: 3rd Revised and Extended Edition. Springer; Basel, Switzerland: 2011. [Google Scholar]
  • 20.Kiewiet M.B.G., Faas M.M., de Vos P. Immunomodulatory protein hydrolysates and their application. Nutrients. 2018;10:E904. doi: 10.3390/nu10070904. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Okolie C.L., Rajendran S.R.C.K., Udenigwe C.C., Aryee A.N.A., Mason B. Prospects of brown seaweed polysaccharides (BSP) as prebiotics and potential immunomodulators. J. Food Biochem. 2017;41:e12392. doi: 10.1111/jfbc.12392. [DOI] [Google Scholar]
  • 22.Miccadei S., Masella R., Mileo A.M., Gessani S. ω3 Polyunsaturated fatty acids as immunomodulators in colorectal cancer: new potential role in adjuvant therapies. Front. Immunol. 2016;7:e00486. doi: 10.3389/fimmu.2016.00486. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Dolashka-Angelova P., Stefanova T., Livaniou E., Velkova L., Klimentzou P., Stevanovic S., Salvato B., Neychev H., Voelter W. Immunological potential of Helix vulgaris and Rapana venosa hemocyanins. Immunol. Investig. 2008;37:822–840. doi: 10.1080/08820130802403366. [DOI] [PubMed] [Google Scholar]
  • 24.Del Campo M., Arancibia S., Nova E., Salazar F., Gonzalez A., Moltedo B., de Ioannes P., Ferreira J., Manubens A., Becker M.I. Hemocyanins as immunostimulants. Rev. Med. Chile. 2011;139:236–246. [PubMed] [Google Scholar]
  • 25.Lammers R.J., Witjes W.P., Janzing-Pastors M.H., Caris C.T., Witjes J.A. Intracutaneous and intravesical immunotherapy with keyhole limpet hemocyanin compared with intravesical mitomycin in patients with non-muscle-invasive bladder cancer: Results from a prospective randomized phase III trial. J. Clin. Oncol. 2012;30:2273–2279. doi: 10.1200/JCO.2011.39.2936. [DOI] [PubMed] [Google Scholar]
  • 26.McFadden D.W., Riggs D.R., Jackson B.J., Vona-Davis L. Keyhole limpet hemocyanin, a novel immune stimulant with promising anticancer activity in Barrett’s esophageal adenocarcinoma. Am. J. Surg. 2003;186:552–555. doi: 10.1016/j.amjsurg.2003.08.002. [DOI] [PubMed] [Google Scholar]
  • 27.Mora Roman J.J., Del Campo M., Villar J., Paolini F., Curzio G., Venuti A., Jara L., Ferreira J., Murgas P., Lladser A., et al. Immunotherapeutic potential of mollusk hemocyanins in combination with human vaccine adjuvants in murine models of oral cancer. J. Immunol. Res. 2019;2019:7076942. doi: 10.1155/2019/7076942. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Arancibia S., Espinoza C., Salazar F., Del Campo M., Tampe R., Zhong T.Y., De Ioannes P., Moltedo B., Ferreira J., Lavelle E.C., et al. A novel immunomodulatory hemocyanin from the limpet Fissurella latimarginata promotes potent anti-tumor activity in melanoma. PLoS ONE. 2014;9:e87240. doi: 10.1371/journal.pone.0087240. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Sharon N. Lectins: Carbohydrate-specific reagents and biological recognition molecules. J. Biol. Chem. 2007;282:2753–2764. doi: 10.1074/JBC.X600004200. [DOI] [PubMed] [Google Scholar]
  • 30.Medzhitov R., Janeway C., Jr. Innate immune recognition: Mechanisms and pathways. Immunol. Rev. 2000;173:89–97. doi: 10.1034/j.1600-065X.2000.917309.x. [DOI] [PubMed] [Google Scholar]
  • 31.Brown G.D., Willment J.A., Whitehead L. C-type lectins in immunity and homeostasis. Nat. Rev. Immunol. 2018;18:374–389. doi: 10.1038/s41577-018-0004-8. [DOI] [PubMed] [Google Scholar]
  • 32.Ma Y.G., Cho M.Y., Zhao M., Park J.W., Matsushita M., Fujita T., Lee B.L. Human mannose-binding lectin and L-ficolin function as specific pattern recognition proteins in the lectin activation pathway of complement. J. Biol. Chem. 2004;279:25307–25312. doi: 10.1074/jbc.M400701200. [DOI] [PubMed] [Google Scholar]
  • 33.Chikalovets I.V., Kondrashina A.S., Chernikov O.V., Molchanova V.I., Luk’yanov P.A. Isolation and general characteristics of lectin from the mussel Mytilus trossulus. Chem. Nat. Compd. 2013;48:1058–1061. doi: 10.1007/s10600-013-0463-x. [DOI] [Google Scholar]
  • 34.Fredrick W.S., Ravichandran S. Hemolymph proteins in marine crustaceans. Asian Pac. J. Trop. Biomed. 2012;2:496–502. doi: 10.1016/S2221-1691(12)60084-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Marcinkiewicz J., Kontny E. Taurine and inflammatory diseases. Amino Acids. 2014;46:7–20. doi: 10.1007/s00726-012-1361-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Schuller-Levis G.B., Park E. Taurine and its chloramine: Modulators of immunity. Neurochem. Res. 2004;29:117–126. doi: 10.1023/B:NERE.0000010440.37629.17. [DOI] [PubMed] [Google Scholar]
  • 37.Song M.K., Salam N.K., Roufogalis B.D., Huang T.H. Lycium barbarum (Goji Berry) extracts and its taurine component inhibit PPAR-gamma-dependent gene transcription in human retinal pigment epithelial cells: Possible implications for diabetic retinopathy treatment. Biochem. Pharmacol. 2011;82:1209–1218. doi: 10.1016/j.bcp.2011.07.089. [DOI] [PubMed] [Google Scholar]
  • 38.Murray B.A., FitzGerald R.J. Angiotensin converting enzyme inhibitory peptides derived from food proteins: Biochemistry, bioactivity and production. Curr. Pharm. Des. 2007;13:773–791. doi: 10.2174/138161207780363068. [DOI] [PubMed] [Google Scholar]
  • 39.Singh B.P., Vij S., Hati S. Functional significance of bioactive peptides derived from soybean. Peptides. 2014;54:171–179. doi: 10.1016/j.peptides.2014.01.022. [DOI] [PubMed] [Google Scholar]
  • 40.Wang Y., Huang Q., Kong D., Xu P. Production and functionality of food-derived bioactive peptides: A review. Mini Rev. Med. Chem. 2018;18:1524–1535. doi: 10.2174/1389557518666180424110754. [DOI] [PubMed] [Google Scholar]
  • 41.Xu Q.Q., Wang G.L., Yuan H.W., Chai Y., Xiao Z.L. cDNA sequence and expression analysis of an antimicrobial peptide, theromacin, in the triangle-shell pearl mussel Hyriopsis cumingii. Comp. Biochem. Phys. B. 2010;157:119–126. doi: 10.1016/j.cbpb.2010.05.010. [DOI] [PubMed] [Google Scholar]
  • 42.Kang H.K., Seo C.H., Park Y. Marine peptides and their anti-infective activities. Mar. Drugs. 2015;13:618–654. doi: 10.3390/md13010618. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Noga E.J., Stone K.L., Wood A., Gordon W.L., Robinette D. Primary structure and cellular localization of callinectin, an antimicrobial peptide from the blue crab. Dev. Comp. Immunol. 2011;35:409–415. doi: 10.1016/j.dci.2010.11.015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Li C., Haug T., Moe M.K., Styrvold O.B., Stensvag K. Centrocins: Isolation and characterization of novel dimeric antimicrobial peptides from the green sea urchin, Strongylocentrotus droebachiensis. Dev. Comp. Immunol. 2010;34:959–968. doi: 10.1016/j.dci.2010.04.004. [DOI] [PubMed] [Google Scholar]
  • 45.Lee I.H., Cho Y., Lehrer R.I. Effects of pH and salinity on the antimicrobial properties of clavanins. Infect. Immun. 1997;65:2898–2903. doi: 10.1128/iai.65.7.2898-2903.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Silva O.N., de la Fuente-Nunez C., Haney E.F., Fensterseifer I.C., Ribeiro S.M., Porto W.F., Brown P., Faria-Junior C., Rezende T.M., Moreno S.E., et al. An anti-infective synthetic peptide with dual antimicrobial and immunomodulatory activities. Sci. Rep. 2016;6:35465. doi: 10.1038/srep35465. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Smith V.J., Fernandes J.M., Kemp G.D., Hauton C. Crustins: Enigmatic WAP domain-containing antibacterial proteins from crustaceans. Dev. Comp. Immunol. 2008;32:758–772. doi: 10.1016/j.dci.2007.12.002. [DOI] [PubMed] [Google Scholar]
  • 48.Donpudsa S., Rimphanitchayakit V., Tassanakajon A., Soderhall I., Soderhall K. Characterization of two crustin antimicrobial peptides from the freshwater crayfish Pacifastacus leniusculus. J. Invertebr. Pathol. 2010;104:234–238. doi: 10.1016/j.jip.2010.04.001. [DOI] [PubMed] [Google Scholar]
  • 49.Suleiman S., Smith V.J., Dyrynda E.A. Unusual tissue distribution of carcinin, an antibacterial crustin, in the crab, Carcinus maenas, reveals its multi-functionality. Dev. Comp. Immunol. 2017;76:274–284. doi: 10.1016/j.dci.2017.06.010. [DOI] [PubMed] [Google Scholar]
  • 50.Imjongjirak C., Amparyup P., Tassanakajon A., Sittipraneed S. Molecular cloning and characterization of crustin from mud crab Scylla paramamosain. Mol. Biol. Rep. 2009;36:841–850. doi: 10.1007/s11033-008-9253-0. [DOI] [PubMed] [Google Scholar]
  • 51.Vatanavicharn T., Supungul P., Puanglarp N., Yingvilasprasert W., Tassanakajon A. Genomic structure, expression pattern and functional characterization of crustin Pm5, a unique isoform of crustin from Penaeus monodon. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2009;153:244–252. doi: 10.1016/j.cbpb.2009.03.004. [DOI] [PubMed] [Google Scholar]
  • 52.Yang R., Murillo F.M., Cui H., Blosser R., Uematsu S., Takeda K., Akira S., Viscidi R.P., Roden R.B. Papillomavirus-like particles stimulate murine bone marrow-derived dendritic cells to produce alpha interferon and Th1 immune responses via MyD88. J. Virol. 2004;78:11152–11160. doi: 10.1128/JVI.78.20.11152-11160.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Zhu S.Y., Gao B. Evolutionary origin of beta-defensins. Dev. Comp. Immunol. 2013;39:79–84. doi: 10.1016/j.dci.2012.02.011. [DOI] [PubMed] [Google Scholar]
  • 54.Seo J.K., Crawford J.M., Stone K.L., Noga E.J. Purification of a novel arthropod defensin from the American oyster, Crassostrea virginica. Biochem. Biophys. Res. Commun. 2005;338:1998–2004. doi: 10.1016/j.bbrc.2005.11.013. [DOI] [PubMed] [Google Scholar]
  • 55.Hubert F., Noel T., Roch P. A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis) Eur. J. Biochem. 1996;240:302–306. doi: 10.1111/j.1432-1033.1996.0302h.x. [DOI] [PubMed] [Google Scholar]
  • 56.Mitta G., Hubert F., Noel T., Roch P. Myticin, a novel cysteine-rich antimicrobial peptide isolated from haemocytes and plasma of the mussel Mytilus galloprovincialis. Eur. J. Biochem. 1999;265:71–78. doi: 10.1046/j.1432-1327.1999.00654.x. [DOI] [PubMed] [Google Scholar]
  • 57.Balseiro P., Falco A., Romero A., Dios S., Martinez-Lopez A., Figueras A., Estepa A., Novoa B. Mytilus galloprovincialis myticin C: A chemotactic molecule with antiviral activity and immunoregulatory properties. PLoS ONE. 2011;6:e23140. doi: 10.1371/journal.pone.0023140. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Domeneghetti S., Franzoi M., Damiano N., Norante R., El Halfawy N.M., Mammi S., Marin O., Bellanda M., Venier P. Structural and antimicrobial Features of peptides related to Myticin C, a special defense molecule from the Mediterranean Mussel Mytilus galloprovincialis. J. Agric. Food Chem. 2015;63:9251–9259. doi: 10.1021/acs.jafc.5b03491. [DOI] [PubMed] [Google Scholar]
  • 59.Charlet M., Chernysh S., Philippe H., Hetru C., Hoffmann J.A., Bulet P. Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis. J. Biol. Chem. 1996;271:21808–21813. doi: 10.1074/jbc.271.36.21808. [DOI] [PubMed] [Google Scholar]
  • 60.Mitta G., Hubert F., Dyrynda E.A., Boudry P., Roch P. Mytilin B and MGD2, two antimicrobial peptides of marine mussels: Gene structure and expression analysis. Dev. Comp. Immunol. 2000;24:381–393. doi: 10.1016/S0145-305X(99)00084-1. [DOI] [PubMed] [Google Scholar]
  • 61.Mitta G., Vandenbulcke F., Roch P. Original involvement of antimicrobial peptides in mussel innate immunity. FEBS Lett. 2000;486:185–190. doi: 10.1016/S0014-5793(00)02192-X. [DOI] [PubMed] [Google Scholar]
  • 62.Ding Y., Liu X., Bu L., Li H., Zhang S. Antimicrobial-immunomodulatory activities of zebrafish phosvitin-derived peptide Pt5. Peptides. 2012;37:309–313. doi: 10.1016/j.peptides.2012.07.014. [DOI] [PubMed] [Google Scholar]
  • 63.Andersson M., Holmgren A., Spyrou G. NK-lysin, a disulfide-containing effector peptide of T-lymphocytes, is reduced and inactivated by human thioredoxin reductase. Implication for a protective mechanism against NK-lysin cytotoxicity. J. Biol. Chem. 1996;271:10116–10120. doi: 10.1074/jbc.271.17.10116. [DOI] [PubMed] [Google Scholar]
  • 64.Acosta J., Roa F., Gonzalez-Chavarria I., Astuya A., Maura R., Montesino R., Munoz C., Camacho F., Saavedra P., Valenzuela A., et al. In vitro immunomodulatory activities of peptides derived from Salmo salar NK-lysin and cathelicidin in fish cells. Fish Shellfish Immunol. 2019;88:587–594. doi: 10.1016/j.fsi.2019.03.034. [DOI] [PubMed] [Google Scholar]
  • 65.Huang W.S., Wang K.J., Yang M., Cai J.J., Li S.J., Wang G.Z. Purification and part characterization of a novel antibacterial protein Scygonadin, isolated from the seminal plasma of mud crab, Scylla serrata (Forskal, 1775) J. Exp. Mar. Biol. Ecol. 2006;339:37–42. doi: 10.1016/j.jembe.2006.06.029. [DOI] [Google Scholar]
  • 66.Yedery R.D., Reddy K.V. Purification and characterization of antibacterial proteins from granular hemocytes of Indian mud crab, Scylla serrata. Acta Biochim. Pol. 2009;56:71–82. doi: 10.18388/abp.2009_2518. [DOI] [PubMed] [Google Scholar]
  • 67.Oh D.C., Strangman W.K., Kauffman C.A., Jensen P.R., Fenical W. Thalassospiramides A and B, immunosuppressive peptides from the marine bacterium Thalassospira sp. Org. Lett. 2007;9:1525–1528. doi: 10.1021/ol070294u. [DOI] [PubMed] [Google Scholar]
  • 68.Um S., Pyee Y., Kim E.H., Lee S.K., Shin J., Oh D.C. Thalassospiramide G, a new gamma-amino-acid-bearing peptide from the marine bacterium Thalassospira sp. Mar. Drugs. 2013;11:611–622. doi: 10.3390/md11030611. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Lin W.C., Chang H.Y., Chen J.Y. Electrotransfer of the tilapia piscidin 3 and tilapia piscidin 4 genes into skeletal muscle enhances the antibacterial and immunomodulatory functions of Oreochromis niloticus. Fish Shellfish Immunol. 2016;50:200–209. doi: 10.1016/j.fsi.2016.01.034. [DOI] [PubMed] [Google Scholar]
  • 70.Chalamaiah M., Yu W.L., Wu J.P. Immunomodulatory and anticancer protein hydrolysates (peptides) from food proteins: A review. Food Chem. 2018;245:205–222. doi: 10.1016/j.foodchem.2017.10.087. [DOI] [PubMed] [Google Scholar]
  • 71.Kiewiet M.B.G., Gros M., van Neerven R.J.J., Faas M.M., de Vos P. Immunomodulating properties of protein hydrolysates for application in cow’s milk allergy. Pediat. Allerg. Imm. 2015;26:206–217. doi: 10.1111/pai.12354. [DOI] [PubMed] [Google Scholar]
  • 72.Ennaas N., Hammami R., Beaulieu L., Fliss I. Purification and characterization of four antibacterial peptides from protamex hydrolysate of Atlantic mackerel (Scomber scombrus) by-products. Biochem. Biophys. Res. Commun. 2015;462:195–200. doi: 10.1016/j.bbrc.2015.04.091. [DOI] [PubMed] [Google Scholar]
  • 73.Tang W., Zhang H., Wang L., Qian H., Qi X. Targeted separation of antibacterial peptide from protein hydrolysate of anchovy cooking wastewater by equilibrium dialysis. Food Chem. 2015;168:115–123. doi: 10.1016/j.foodchem.2014.07.027. [DOI] [PubMed] [Google Scholar]
  • 74.Song R., Wei R.-B., Luo H.Y., Wang D.F. Isolation and characterization of an antibacterial peptide fraction from the pepsin hydrolysate of half-fin anchovy (Setipinna taty) Molecules. 2012;17:2980–2991. doi: 10.3390/molecules17032980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Beaulieu L., Thibodeau J., Bonnet C., Bryl P., Carbonneau M.E. Detection of antibacterial activity in an enzymatic hydrolysate fraction obtained from processing of Atlantic rock crab (Cancer irroratus) by-products. Pharma Nutr. 2013;1:149–157. doi: 10.1016/j.phanu.2013.05.004. [DOI] [Google Scholar]
  • 76.Balakrishnan B., Prasad B., Rai A.K., Velappan S.P., Subbanna M.N., Narayan B. In vitro antioxidant and antibacterial properties of hydrolysed proteins of delimed tannery fleshings: Comparison of acid hydrolysis and fermentation methods. Biodegradation. 2011;22:287–295. doi: 10.1007/s10532-010-9398-0. [DOI] [PubMed] [Google Scholar]
  • 77.Morris H.J., Carrillo O., Almarales A., Bermudez R.C., Lebeque Y., Fontaine R., Llaurado G., Beltran Y. Immunostimulant activity of an enzymatic protein hydrolysate from green microalga Chlorella vulgaris on undernourished mice. Enzym. Microb. Technol. 2007;40:456–460. doi: 10.1016/j.enzmictec.2006.07.021. [DOI] [Google Scholar]
  • 78.Ahn G., Hwang I., Park E., Kim J., Jeon Y.J., Lee J., Park J.W., Jee Y. Immunomodulatory effects of an enzymatic extract from Ecklonia cava on murine splenocytes. Mar. Biotechnol. 2008;10:278–289. doi: 10.1007/s10126-007-9062-9. [DOI] [PubMed] [Google Scholar]
  • 79.Cian R.E., Martinez-Augustin O., Drago S.R. Bioactive properties of peptides obtained by enzymatic hydrolysis from protein byproducts of Porphyra columbina. Food Res. Int. 2012;49:364–372. doi: 10.1016/j.foodres.2012.07.003. [DOI] [Google Scholar]
  • 80.Cian R.E., Lopez-Posadas R., Drago S.R., de Medina F.S., Martinez-Augustin O. A Porphyra columbina hydrolysate upregulates IL-10 production in rat macrophages and lymphocytes through an NF-kappa B, and p38 and JNK dependent mechanism. Food Chem. 2012;134:1982–1990. doi: 10.1016/j.foodchem.2012.03.134. [DOI] [PubMed] [Google Scholar]
  • 81.Senevirathne M., Ahn C.B., Je J.Y. Enzymatic extracts from edible red algae, Porphyra tenera, and their antioxidant, anti-acetylcholinesterase, and anti-inflammatory activities. Food Sci. Biotechnol. 2010;19:1551–1557. doi: 10.1007/s10068-010-0220-x. [DOI] [Google Scholar]
  • 82.Vo T.S., Ngo D.H., Kang K.H., Park S.J., Kim S.K. The role of peptides derived from Spirulina maxima in downregulation of Fcepsilon RI-mediated allergic responses. Mol. Nutr. Food Res. 2014;58:2226–2234. doi: 10.1002/mnfr.201400329. [DOI] [PubMed] [Google Scholar]
  • 83.Cai B.N., Pan J.Y., Wu Y.T., Wan P., Sun H.L. Immune functional impacts of oyster peptide-based enteral nutrition formula (OPENF) on mice: A pilot study. Chin. J. Oceanol. Limn. 2013;31:813–820. doi: 10.1007/s00343-013-2311-z. [DOI] [Google Scholar]
  • 84.He X.Q., Cao W.H., Pan G.K., Yang L., Zhang C.H. Enzymatic hydrolysis optimization of Paphia undulata and lymphocyte proliferation activity of the isolated peptide fractions. J. Sci. Food Agric. 2015;95:1544–1553. doi: 10.1002/jsfa.6859. [DOI] [PubMed] [Google Scholar]
  • 85.Li W., Ye S., Zhang Z., Tang J., Jin H., Huang F., Yang Z., Tang Y., Chen Y., Ding G., et al. Purification and characterization of a novel pentadecapeptide from protein hydrolysates of Cyclina sinensis and its immunomodulatory effects on RAW264.7 cells. Mar. Drugs. 2019;17:E30. doi: 10.3390/md17010030. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 86.Lee S.J., Kim E.K., Kim Y.S., Hwang J.W., Lee K.H., Choi D.K., Kang H., Moon S.H., Jeon B.T., Park P.J. Purification and characterization of a nitric oxide inhibitory peptide from Ruditapes philippinarum. Food Chem. Toxicol. 2012;50:1660–1666. doi: 10.1016/j.fct.2012.02.021. [DOI] [PubMed] [Google Scholar]
  • 87.Kim E.K., Kim Y.S., Hwang J.W., Kang S.H., Choi D.K., Lee K.H., Lee J.S., Moon S.H., Jeon B.T., Park P.J. Purification of a novel nitric oxide inhibitory peptide derived from enzymatic hydrolysates of Mytilus coruscus. Fish Shellfish Immunol. 2013;34:1416–1420. doi: 10.1016/j.fsi.2013.02.023. [DOI] [PubMed] [Google Scholar]
  • 88.Hou H., Fan Y., Wang S.K., Si L.L., Li B.F. Immunomodulatory activity of Alaska pollock hydrolysates obtained by glutamic acid biosensor—Artificial neural network and the identification of its active central fragment. J. Funct. Foods. 2016;24:37–47. doi: 10.1016/j.jff.2016.03.033. [DOI] [Google Scholar]
  • 89.Hou H., Fan Y., Li B.F., Xue C.H., Yu G.L. Preparation of immunomodulatory hydrolysates from Alaska pollock frame. J. Sci. Food Agric. 2012;92:3029–3038. doi: 10.1002/jsfa.5719. [DOI] [PubMed] [Google Scholar]
  • 90.Duarte J., Vinderola G., Ritz B., Perdigon G., Matar C. Immunomodulating capacity of commercial fish protein hydrolysate for diet supplementation. Immunobiology. 2006;211:341–350. doi: 10.1016/j.imbio.2005.12.002. [DOI] [PubMed] [Google Scholar]
  • 91.Yang R.Y., Zhang Z.F., Pei X.R., Han X.L., Wang J.B., Wang L.L., Long Z., Shen X.Y., Li Y. Immunomodulatory effects of marine oligopeptide preparation from Chum Salmon (Oncorhynchus keta) in mice. Food Chem. 2009;113:464–470. doi: 10.1016/j.foodchem.2008.07.086. [DOI] [Google Scholar]
  • 92.Nesse K.O., Nagalakshmi A.P., Marimuthu P., Singh M. Efficacy of a fish protein hydrolysate in malnourished children. Ind. J. Clin. Biochem. 2011;26:360–365. doi: 10.1007/s12291-011-0145-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 93.Ahn C.B., Je J.Y., Cho Y.S. Antioxidant and anti-inflammatory peptide fraction from salmon byproduct protein hydrolysates by peptic hydrolysis. Food Res. Int. 2012;49:92–98. doi: 10.1016/j.foodres.2012.08.002. [DOI] [Google Scholar]
  • 94.Ahn C.B., Cho Y.S., Je J.Y. Purification and anti-inflammatory action of tripeptide from salmon pectoral fin byproduct protein hydrolysate. Food Chem. 2015;168:151–156. doi: 10.1016/j.foodchem.2014.05.112. [DOI] [PubMed] [Google Scholar]
  • 95.Mallet J.F., Duarte J., Vinderola G., Anguenot R., Beaulieu M., Matar C. The immunopotentiating effects of shark-derived protein hydrolysate. Nutrition. 2014;30:706–712. doi: 10.1016/j.nut.2013.10.025. [DOI] [PubMed] [Google Scholar]
  • 96.Sung N.Y., Jung P.M., Yoon M., Kim J.S., Choi J.I., Jeong H.G., Lee J.W., Kim J.H. Anti-inflammatory effect of sweetfish-derived protein and its enzymatic hydrolysate on LPS-induced RAW264.7 cells via inhibition of NF-kappa B transcription. Fish. Sci. 2012;78:381–390. doi: 10.1007/s12562-011-0461-5. [DOI] [Google Scholar]
  • 97.Chalamaiah M., Hemalatha R., Jyothirmayi T., Diwan P.V., Bhaskarachary K., Vajreswari A., Ramesh Kumar R., Dinesh Kumar B. Chemical composition and immunomodulatory effects of enzymatic protein hydrolysates from common carp (Cyprinus carpio) egg. Nutrition. 2015;31:388–398. doi: 10.1016/j.nut.2014.08.006. [DOI] [PubMed] [Google Scholar]
  • 98.Chalamaiah M., Hemalatha R., Jyothirmayi T., Diwan P.V., Kumar P.U., Nimgulkar C., Kumar B.D. Immunomodulatory effects of protein hydrolysates from rohu (Labeo rohita) egg (roe) in BALB/c mice. Food Res. Int. 2014;62:1054–1061. doi: 10.1016/j.foodres.2014.05.050. [DOI] [Google Scholar]
  • 99.Aw D., Silva A.B., Palmer D.B. Immunosenescence: Emerging challenges for an ageing population. Immunology. 2007;120:435–446. doi: 10.1111/j.1365-2567.2007.02555.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 100.Plowden J., Renshaw-Hoelscher M., Engleman C., Katz J., Sambhara S. Innate immunity in aging: Impact on macrophage function. Aging Cell. 2004;3:161–167. doi: 10.1111/j.1474-9728.2004.00102.x. [DOI] [PubMed] [Google Scholar]

Articles from Marine Drugs are provided here courtesy of Multidisciplinary Digital Publishing Institute (MDPI)

RESOURCES