Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2020 Jun 28.
Published in final edited form as: J Mol Biol. 2019 May 14;431(14):2567–2580. doi: 10.1016/j.jmb.2019.05.011

Silencing of aberrant secretory protein expression by disease-associated mutations

Elena B Tikhonova 1, Zemfira N Karamysheva 2, Gunnar von Heijne 3, Andrey L Karamyshev 1,*
PMCID: PMC6684239  NIHMSID: NIHMS1530339  PMID: 31100385

Abstract

Signal Recognition Particle (SRP) recognizes signal sequences of secretory proteins and targets them to the endoplasmic reticulum membrane for translocation. Many human diseases are connected with defects in signal sequences. The current dogma states that the molecular basis of the disease-associated mutations in the secretory proteins is connected with defects in their transport. Here, we demonstrate for several secretory proteins with disease-associated mutations that the molecular mechanism is different from the dogma. Positively charged or helix-breaking mutations in the signal sequence hydrophobic core prevent synthesis of the aberrant proteins and lead to degradation of their mRNAs. The degree of mRNA depletion depends on the location and severity of the mutation in the signal sequence and correlates with inhibition of SRP interaction. Thus, SRP protects secretory protein mRNAs from degradation. The data demonstrate that if disease-associated mutations obstruct SRP interaction they lead to silencing of the mutated protein expression.

Keywords: Protein synthesis and transport, signal sequence, signal recognition particle (SRP), protein quality control, translational control

Introduction

Secretory and membrane proteins represent more than a third of all proteins in a cell [1]. During their biogenesis these proteins are transported to different cellular compartments or secreted outside of the cells. Numerous human diseases are associated with protein transport defects [2–4]. Many secretory proteins are synthesized as precursors with N-terminal signal sequences. When a signal sequence of a secretory protein emerges from the ribosome exit tunnel, it is co-translationally recognized by the signal recognition particle (SRP) [5–9]. Formation of a SRP-ribosome-nascent chain complex leads to its targeting to SRP receptor in the endoplasmic reticulum (ER) membrane [10]. Finally, the nascent peptide with its signal sequence is transferred to the Sec61 translocon and a secretory protein is co-translationally translocated into the ER lumen, the signal sequence is cleaved off by the signal peptidase at the luminal side of the ER membrane, and matured proteins are transported further through Golgi outside the cell. These processes are relatively well studied and have been reviewed in detail [11–14].

Signal sequence recognition by SRP is the first and the most important step in targeting of the SRP-ribosome-nascent chain complex to the endoplasmic reticulum membrane for translocation. Although signal sequences do not have strong amino acid homology, majority of them have similar features and structural organization: a positively charged N-terminal n-region, a hydrophobic core (h-region), and a C-terminal c-region containing cleavage site for a signal peptidase [15, 16] (Fig. 1a). Signal sequence integrity is important for protein targeting and translocation through a membrane in prokaryotes and eukaryotes [17–21]. A number of naturally occurring mutations in signal sequences have been found, many of them associated with human disease [22–42]. Currently accepted mechanisms for these diseases are connected with defects in the transport or processing of the mutated proteins.

Fig. 1. Signal sequences and aberrations associated with human diseases.

Fig. 1.

(a) Scheme of a signal sequence. Many signal sequences have three regions: Nterminal region, usually contains positively charged amino-acid residues (n-region), stretch of hydrophobic amino acid residues (hydrophobic core, or h-region), signal sequence cleavage region (c-region). (b) Hydrophobicity plots of the wild-type (WT) and mutated signal sequences of the proteins associated with human diseases (Kyte Doolittle Scale). Amino acid residue numbers are shown in X-axis, and hydrophobicity scores are shown in Y-axis. Positions of the disease-associated mutations are marked by arrows. Black symbols indicate wild-type (WT) and red symbols indicate mutants.

Recently, we demonstrated the existence of a novel mechanism for quality control of secretory proteins, named Regulation of Aberrant Protein Production (RAPP) [43]. This is unique quality control pathway among others it senses interactions of nascent chains during synthesis and degrades mRNAs of proteins that have lost these important interactions [44]. We demonstrated that the pathway degrades mRNAs of model secretory proteins with dramatic deletions in signal sequences when SRP is not able to recognize the altered signal sequences [43]. Although the existence of the pathway is currently established, many details of the mechanism remain unknown. Only one natural substrate of the RAPP pathway is currently identified – granulin with mutations in signal sequence [45, 46]. Here, we reveal that the RAPP pathway is involved in quality control of many secretory proteins with disease-associated mutations. We demonstrate on the example of a number of secretory proteins with disease-associated mutations in their signal sequences that the molecular mechanism is different from the current dogma and connected with stability of the mutated protein mRNAs instead of protein transport defects. We show that many disease-associated mutations lead to degradation of the mutant protein mRNAs, implicating the RAPP pathway as a molecular mechanism of these diseases.

Results

Mutations in the signal sequences of secretory proteins are associated with human diseases

We conducted a literature search for proteins with disease-associated mutations in their signal sequences. Some of these proteins and disease-associated mutations are presented in the Table 1. These proteins and the diseases represent a quite diverse group – the proteins have different functions, molecular weight and signal sequence length. However, many disease-associated mutations have common features: they are located in the hydrophobic core of the signal sequences and led to significant changes in the sequence properties: substitution of a hydrophobic amino acid residue with positively-charged arginine or with helix-breaking proline. Many of these mutations reduce the hydrophobicity of the signal sequence h-regions (Fig. 1), suggesting inhibition of their recognition by SRP. Some mutations were located in the c-regions of the signal sequence and did not disrupt h-region hydrophobicity. The n-region seems to be the one with the fewest disease-related mutations. Only disease-associated form of the Norrie disease protein (NDP) had a deleted n-terminal part of the signal sequence (Δ11 NDP).

Table 1.

Mutations in Signal Sequences and Human Diseases

Gene
(protein)
Human disease Mutation Signal sequence + 2 amino acid residues * Reference
AGA
(aspartylglucosaminidase)
Aspartylglucosaminuria L15R MARKSNLPVLLVPFLLCQALVRCSS [22]
CTSK
(cathepsin K)
Pycnodysostosis L7P
L9P
MWGLKVLLLPVVSFALY
MWGLKVLLLPVVSFALY
[23, 24]
UGT1A1
(UDP-glucuronosyltransferase)
Crigler-Najjar disease L15R MAVESQGGRPLVLGLLLCVLGPVVSHA [25]
SERPINA7
(serpin peptidase inhibitor A7)
Thyroxine-binding globulin deficiency H19Y MSPFLYLVLLVLGLHATIHCAS [26]
NDP
(Norrie disease protein)
Norrie disease L13R
Δ11
MRKHVLAASFSMLSLLVIMGDTDSK
MLSLLVIMGDTDSK
[27]
PTH
(parathyroid hormone)
Hypoparathyroidism C18R
S23P
MIPAKDMAKVMIVMLAICFLTKSDGKS
MIPAKDMAKVMIVMLAICFLTKSDGKS
[28, 29]
TGFB1
(TGFβ1, transforming growth factor beta 1)
Renal function decline, osteoporosis, proliferative diabetic retinopathy P10L
R25P
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLS
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLS
[37–40]
CTLA4
(cytotoxic T-lymphocyte associated protein 4)
Autoimmune disease T17A MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKA [30]
LHB
(luteinizing hormone beta polypeptide)
Hypogonadotropic hypogonadism A18T MEMLQGLLLLLLLSMGGAWASR [31]
SERPINE1
(serpin peptidase inhibitor E1)
Fibrinolytic bleeding disorder A15T MQMSPALTCLVLGLALVFGEGSAVH [32]
PRSS1
(serine protease 1)
Chronic pancreatitis A16V MNPLLILTFVAAALAAPF [33,41]
COL10A1
(collagen type X alpha 1)
Schmid metaphyseal chondrodysplasia G18R
G18E
MLPQIPFLLLVSLNLVHGVF [34, 35]
LIPA
(lipase A)
Wolman disease G23R MKMRFLGLVVCLVLWPLHSEGSGGKL
[36]
*

Signal sequence cleavage sites are underlined, positions of mutations are in bold font.

Disease-associated mutations in the signal sequences cause the protein secretion and expression defects

We cloned cDNAs for the proteins shown in Table 1 into a vector for expression in cultured human cells and introduced disease-associated mutations by site-directed mutagenesis. First, we tested the expression of the mutated proteins and picked some of them with significant changes in the signal sequences (introducing Arg or Pro into the hydrophobic core) for these experiments. As shown in Fig. 2 for UDP-glucuronosyltransferase (UGT1A1), cathepsin K (CTSK), and aspartylglucosaminidase (AGA), wild-type proteins were efficiently expressed, CTSK and AGA were also secreted outside of the cells (UGT1A1 is a membrane associated protein and is not released into the media). Disease-associated mutations led to inhibition of these proteins secretion and they were not detected in the media. However, the mutated proteins were not detected in the cells either, as shown by Western blot and immunofluorescence, demonstrating that their overall expression was impaired (Fig. 2).

Fig. 2. Clinical mutations in the signal sequences of secretory proteins inhibit protein expression.

Fig. 2.

(a) Western blot analysis of the wild-type (WT) and mutated UGT1A1, CTSK and AGA, transiently expressed in HeLa Tet-On cells. Expression of the secreted proteins AGA and CTSK was evaluated in the cell lysates, secreted fractions (media) and total samples. Although UGT1A1 is translocated into ER, it is not released into the medium and remained bound through a membrane anchor to a membrane, thus UGT1A1 was analyzed in the cell lysates only. AGA is observed in several forms on the Western blots because it is cleaved during maturation. Actin and tubulin proteins from the cell lysate samples were used as loading controls. (b) Expression of the WT and mutated UGT1A1 and AGA proteins in HeLa Tet-On cells was analyzed by immunofluorescence (green). Blue is a DAPI staining.

Decrease of mutated protein expression cannot be explained by proteasomal degradation alone

Proteasomal degradation is a major way for removal of defective proteins in the cells. To test if decrease in the mutated protein expression was caused by proteasomal degradation we conducted experiments in the presence of MG-132, a proteasome inhibitor, that was added to the cultivated human cells expressing wild-type and mutated proteins (Fig. 3). The secretory proteins with mutations in the signal sequences were affected little or not at all. Thus, proteasomal degradation of the aberrant mutated secretory proteins is not the primary reason for their decreased expression.

Fig. 3. Inhibition of proteasome does not restore expression of the secretory proteins with disease-associated mutations in the signal sequence.

Fig. 3.

Effect of proteasome inhibitor, MG-132, on WT and mutant proteins expression was studied. HeLa Tet-On cells were transfected with the plasmids expressing WT and mutated CTSK, AGA and UGT1A1 proteins. Cells were grown for 20 h after plasmid DNA transfection and then treated with 10 μM MG-132 (+) or DMSO (−) for 8 h before samples collection. Expression of UGT1A1 (a) was examined in the cell lysates only (it is not released into the medium), while CTSK (b) and AGA (c) were tested in the cells and media (secreted proteins) by Western blot. Actin and tubulin proteins from the cell lysates were used as loading controls.

Disease-associated mutations in the signal sequences hydrophobic core cause decrease of their mRNA levels

Using real-time quantitative PCR (RT-qPCR) we found that mRNA levels of the mutated UGT1A1, CTSK, and AGA were significantly reduced relative to the wildtype, demonstrating that the protein expression defects were caused by the decrease of their mRNA levels (Fig. 4). We also tested the mRNA levels of other secretory proteins with disease-associated mutations (from the Table 1). The mutations cause a wide spectrum of effects on mRNA expression, from very strong defects (mutations in the h-region of the signal sequence) to practically no defects in expression (mostly mutations in the c-regions) (Fig. 4). Interestingly, that even charged amino-acid substitutions in the c-region did not lead to mRNA level decrease (Arg in lipase A (LIPA) and Arg or Glu in collagen 10A1 (COL10A1), Table 1 and Fig. 4).

Fig. 4. Mutations in signal sequences of secretory proteins inhibit their mRNA expression.

Fig. 4.

HeLa Tet-On cells were transfected with the plasmids expressing WT and mutated proteins with disease-associated mutations in the signal sequences. mRNA levels were measured by RT-qPCR and shown relatively to corresponding WT mRNA levels (marked by red dash line). The data are presented as mean values with standard errors (n = 3–7).

These observations suggest that integrity of the signal sequence hydrophobic core is important for secretory protein mRNA stability, and that low mRNA expression levels of the proteins with disease-associated mutations in this region may contribute to the corresponding human diseases.

mRNA degradation is responsible for decrease in mRNA expression of the proteins with disease-associated mutations

Reduction in mRNA expression levels may be caused by decrease in mRNA synthesis (transcription) or increase in mRNA degradation. To examine if mRNA degradation of the mutants has increased we conducted experiments under conditions when transcription was inhibited by the antibiotic actinomycin D. Wild-type and mutated forms of the secretory proteins were transiently expressed in cultured human cells in the presence of the antibiotic. As it is shown in the Fig. 5a and b, mRNA turnover of the tested mutant proteins with alterations in the h-region was much faster than for the wild-type forms. However, the mRNA turnover of the LIPA mutant with mutation in the c-region, that did not change mRNA expression level (Fig. 4), was similar to the wild-type one (Fig. 5c). These data demonstrate that the preferential degradation of the mRNAs of the proteins with mutations in the h-region is implicated in the reduced mRNA expression.

Fig. 5. Decrease of the mRNA expression of the secretory proteins with mutations in the hydrophobic core of the signal sequences is caused by mRNA degradation.

Fig. 5.

Experiments were conducted with AGA (a) and CTSK (b) proteins with mutations in the hydrophobic core (h-region), and LIPA (c) with the mutation in the signal sequence c-region. HeLa Tet-On cells were transfected with plasmids expressing WT and mutated proteins and cultivated for 20 h to ensure that sufficient levels of the mutant mRNAs still remained at the beginning of the experiment (at point “0”). Then actinomycin D, an inhibitor of transcription, was added, and incubation was continued for indicated periods of time. mRNA levels were measured by RT-qPCR at each point and presented relatively to the mRNA level in the point zero for each construct. Error bars are standard errors (n = 3). Trendline was used to present dynamic of the mRNA level changes during actinomycin D treatment. Black symbols indicate wild-type (WT) and red symbols indicate mutants.

Disease-associated mutations in the signal sequence hydrophobic core inhibit interaction with SRP

SRP recognizes signal sequences when they are exposed from the polypeptide tunnel on the ribosome. The h-region is the most important part of the signal sequence for this interaction [17]. Many disease-associated mutations in the h-region lead to significant changes in the hydrophobicity profiles of the signal sequences (Fig. 1a). This observation suggests that these disease-associated mutations may interfere with SRP interaction. To test this hypothesis, we applied site-specific photo-crosslinking [17, 21, 47, 48] to examine SRP interactions with mutated signal sequences. This technique makes possible to incorporate a photo-crosslinking probe in a specific position in a polypeptide nascent chain during in vitro translation (Fig. 6a). In these experiments, the photo-crosslinking probe is incorporated into the nascent chain by a modified εANB-Lys-tRNAamb in response to an amber-stop codon in the mRNA. An amber-stop codon (UAG) was introduced in the positions corresponding to the middle of the signal sequences of the wild-type and the mutated secretory proteins. Translational intermediates of the wild-type and mutated forms of the secretory proteins were obtained by translating in vitro truncated mRNAs with an amber-stop codon in the presence of modified εANB-Lys-tRNAamb and [35S]methionine. The mRNAs were truncated to make translational intermediates of the desired length (86 amino acid residues in these experiments). When the ribosome reaches the end of the truncated mRNA, it does not dissociate but remains bound to the mRNA and the nascent chain, forming a ribosome-mRNA-nascent chain complex. After UV-irradiation, the photocrosslinking probe form covalent bonds with nearby molecules, and the photo-adducts are analyzed by gel electrophoresis and autography. All tested wild-type secretory proteins formed photo-adducts with a protein corresponding in size to SRP54, a subunit of SRP (Fig. 6b and c). The quantity of these photo-adducts were increased after addition of purified canine SRP, confirming that the photo-adducts are indeed to the subunit of SRP, as observed by us earlier [17, 43]. However, nascent chains with Arg or Pro in the hydrophobic core of the signal sequences of AGA, CTSK, and UGT1A1 did not form photo-adducts with SRP54 (Fig. 6b). Notably, charged amino acids in the c-region did not prevent SRP54 interaction (Fig. 6c). The efficiency of SRP interactions correlates well with the mRNA expression and stability (Figs. 4 and 5) suggesting that SRP protects mRNAs of secretory proteins from degradation.

Fig. 6. Mutations in the signal sequence hydrophobic core disrupt interaction with SRP while mutations in the c-region do not.

Fig. 6.

(a) Scheme of the site-specific photo-crosslinking. The technique is based on the tRNA mediated incorporation of a photo-crosslinking probe into the nascent chains during translation in vitro. Modified amber-suppressor εANB-Lys-tRNAamb was used in our experiments. This tRNA incorporates εANB-Lys into position of the nascent chain corresponding to an amber-stop codon in the mRNA. Ribosome-nascent chains are formed by translation of the truncated mRNA in vitro in the presence of εANB-Lys-tRNAamb. The length of the nascent chains depends on the length of the truncated mRNAs. When the nascent chains are exposed from the polypeptide tunnel at the ribosome they interact with their natural partners. Photo-crosslinking probes form covalent bonds to these interacting factors upon UV irradiation. Photo-adducts are detected by the shift in electrophoretic mobility of the nascent chains during electrophoresis and autoradiography. (b, c) Photo-crosslinking of secretory proteins with mutations in the hydrophobic core (b) and in the c-region of the signal sequences (c). Ribosome-nascent chain complexes containing N-terminal 86 residues of the WT and mutant proteins were produced in vitro in the presence or absence of extra added purified SRP as indicated. After UV irradiation, the samples were analyzed by electrophoresis and autoradiography. SRP54-photo-adducts are marked by asterisks. Positions of the molecular weight markers are shown.

Defective SRP leads to mRNA degradation of secretory proteins associated with human diseases

As shown in Fig. 4, the disease-associated mutations lead to the full spectrum of mRNA expression defects – from very strong effects (mRNA degradation) to no change in mRNA levels. The degree of mRNA degradation correlates with the reduced ability of the mutated signal sequence to interact with SRP. These observations suggest pathological activation of RAPP, a protein quality control pathway, as a mechanism for mRNA degradation of the mutated proteins. RAPP is the unique pathway that senses interactions of the nascent chains with SRP at the ribosome during translation and directs mRNAs for degradation if these interactions are disrupted [43, 44]. The effects of the mutations inhibiting nascent chain interactions with SRP and inducing mRNA degradation are consistent with this scenario.

What about the other mutant proteins for which mRNA expression was not changed? Are these proteins subjects for the RAPP protein quality control? As we demonstrated earlier, the RAPP pathway may be activated by changes in the substrate for SRP due to mutations in the hydrophobic core of the signal sequence, and by the defects in the binding partner, SRP, and lead to mRNA degradation [43]. To test the hypothesis that the disease-associated proteins are controlled by the RAPP pathway we conducted experiments with knockdown of the SRP54 subunit of SRP by the use of siRNA. In the control cells, the secretory proteins were efficiently expressed and secreted into the media (Fig. 7b and c). SRP54 was efficiently depleted by specific siRNA as SRP54 mRNA and the protein were not detected by RT-qPCR, and by Western blot and immunofluorescence, respectively (Fig. 7a inset, Fig. 7b and c). The mRNAs of the wild-type forms of all tested secretory proteins were substantially depleted in the cells with SRP54 knockdown (Fig. 7a). The secreted proteins were not detected by Western blot in the media and the overall expression of the mutated proteins in the cells was dramatically impaired as demonstrated by Western blot and immunofluorescence (Fig. 7b and c). These data strongly indicate that all tested disease-associated secretory proteins are surveyed by the RAPP quality control during translation and are subjected to mRNA elimination in the absence of SRP. However, RAPP does not act on defective proteins with mutations that do not interfere with recognition of the signal sequence by SRP.

Fig. 7. SRP is required for protection of mRNAs of secretory proteins associated with human diseases from degradation.

Fig. 7.

Effects of SRP54 knockdown on expression of secretory proteins are shown. HeLa Tet-On cells were transfected with siRNA for SRP54 to knockdown SRP54 prior to the second transfection with the plasmids expressing secretory proteins. (a) mRNA levels of the secretory proteins in SRP54 knockdown cells as measured by RT-qPCR and shown as mean values relatively to those in control cells (n = 2–4). Corresponding mRNA level in control cells is marked by red dash line. SRP54 mRNA level in SRP54 knockdown and control cells is shown in inset (n = 14). Errors bars are standard errors. (b) Protein expression of secretory proteins in SRP54 knockdown cells. CTSK and AGA expression was analyzed in the cell lysates and media, and UGT1A1 was tested in the cell lysates only (it is associated with plasma membrane) by Western blot. Actin and tubulin proteins were used as loading controls. SRP54 depletion was confirmed by Western blot. (c) Expression of SRP54 (red), UGT1A1 (green) and AGA (green) in HeLa Tet-On cells was detected by immunofluorescence. Blue is a DAPI staining.

In conclusion, our data demonstrate that if disease-associated mutations in secretory proteins obstruct SRP interaction they lead to silencing of the mutated protein expression through mRNA degradation (Fig. 8).

Fig. 8. Signal sequence mutations and possible molecular mechanisms of the associated diseases.

Fig. 8.

(a) Scheme of the signal sequence and location of the disease associated mutations and their potential effects. (b) Scheme of possible scenarios of biogenesis of the wild-type (1) and mutated proteins with defects in the c-region (2) and in the hydrophobic core (h-region) (3) of the signal sequences. (1) Normally, secretory proteins start their synthesis at the cytoplasmic ribosomes. SRP recognizes signal sequences when they emerge from the ribosome tunnel during translation. This interaction leads to a normal targeting of the ribosome-nascent chain complex to the ER membrane and finally secretion outside of the cells. (2) When mutations are located in the signal sequence c-region, they usually do not inhibit SRP interaction, and the mutated proteins are targeted to the ER membrane and successfully translocated into the ER lumen. However, often mutations in that region prevent cleavage of the signal sequence by the signal peptidase. If it happens, the mutated protein remains bound to the ER membrane and is not able to be transported further. The molecular basis of these diseaseassociated mutations is most likely linked to defects in processing. (3) When a mutation in the signal sequence (mostly in h-region) prevents interaction with SRP, ribosomenascent chain complex is unable to be targeted to ER, and the mRNA of the mutated protein is degraded in the RAPP pathway. Thus, the molecular mechanism of the diseases in that scenario is connected with pathological activation of the RAPP pathway.

Discussion

SRP-dependent protein targeting initiates the major pathway for transport of secretory and membrane proteins. The process involves co-translational recognition of signal sequences by SRP. A number of secretory proteins with disease-associated mutations in the signal sequences was examined in this study (Table 1). Defects in the transport of mutant proteins through the secretory pathway is often assumed to underlie the diseases. Here we demonstrate, that the molecular mechanism behind the diseases is different from the current dogma for some of the secretory proteins with disease-associated mutations, and is connected with mRNA instability instead of protein transport defects. This process is initiated when SRP is not able to interact efficiently with mutated signal sequences at the ribosome. Effects on the SRP interaction play a key role for triggering mRNA degradation of the mutated proteins. Dramatic mutations introducing helix-breaking proline or interfering with hydrophobicity of the h-region (introduction of charged amino acids such as arginine) lead to significant mRNA degradation (Figs. 4 and 5). These mutations inhibit interaction with SRP as we demonstrated by the use of site-specific photo-crosslinking technique (Fig. 6b). However, charged amino acid residues outside of the hydrophobic core of the signal sequence did not have a visible effect on mRNA expression and stability (Figs. 4 and 5) and did not interfere with SRP interaction (Fig. 6c). Analysis of a number of secretory proteins with multiple disease-associated mutations in the signal sequences allowed us to reveal the full spectrum of their effects on the mRNA degradation – from very severe to no effect (Fig. 4). These data suggest the existence of diverse molecular mechanisms for diseases, or even mixture of several mechanisms, where mRNA degradation plays a certain role when targeting by SRP is disrupted by a mutation. We propose that the position of the disease associated mutations in the signal sequence may lead to different consequences and trigger mRNA degradation if they are located in the signal sequence h-region, or inhibit cleavage of the signal sequence (processing) if they are located in the c-region (Fig. 8).

There are several pathways that monitor mRNA and protein quality at the different levels in response to a number of defects. mRNAs with premature stop codons are removed by nonsense-mediated decay (NMD), translationally stalled and truncated mRNAs are degraded by no-go decay (NGD), mRNAs lacking natural stop codons are detected by non-stop decay (NSD), truncated polypeptides are degraded by the ribosome quality control complex (RQC), misfolded proteins are removed by several systems including ER associated degradation (ERAD), unfolded protein response (UPR), and ubiquitin/proteasome (see for review [44]). Recently, we also reported existence of a novel mechanism for protein quality control, Regulation of Aberrant Protein Production (RAPP) [43], that surveys nascent chain interactions during translation and directs mutated protein mRNAs for degradation. This pathway is the first mechanism that senses mutated proteins and transfers information about aberrant proteins to the mRNA degradation machinery [43, 44]. Detailed analysis of the consequences of the disease-associated mutations led us to a conclusion that the mRNA degradation observed is associated with activation of the RAPP pathway. Indeed, there is a strong correlation between the loss of SRP interaction with altered signal sequences and the level of mRNA degradation. This is a major characteristic of RAPP [43, 44]. The alternative interpretation by the involvement of other types of mRNA and protein quality controls is unlikely because RAPP is the only known mechanism that examines the status of co-translational interactions of secretory proteins and degrades mRNAs of aberrant proteins with mutations in signal sequences. Thus, RAPP detects the defective proteins and eliminates their mRNAs. Moreover, our data clearly demonstrate that the RAPP pathway is involved in quality control of all tested secretory proteins, as it is demonstrated by the SRP54 depletion experiment (Fig. 7). These observations suggest that RAPP is a general mechanism of protein quality control involved in survey of secretory SRP-dependent proteins, and possibly membrane proteins that use SRP as a targeting factor. However, our results revealed that only mutations in the hydrophobic core of the signal sequence that interfere with SRP interaction, triggered the RAPP response. These data demonstrate that in addition to a targeting function, SRP has a certain function in protection of secretory protein mRNAs from the RNA degradation machinery. Our results also demonstrate that the molecular mechanisms of some cases of aspartylglucosaminuria, pycnodystosis, Crigler-Najjar syndrome, thyroxine-binding globulin deficiency, Norrie disease, and probably many other human diseases are associated with pathological RAPP pathway activation.

Among six protein subunits of SRP, SRP54 is the only protein directly involved in the signal sequence recognition. SRP54 has three domains: N-terminal (N), GTP-binding (G) and signal sequence binding (M) domain [9]. Recently several mutations were identified in SRP54 G domain of the patients with inherited neutropenia and Shwachman-Diamond-like syndrome indicating that these disease-causing mutations may interfere with its GTPase function [49, 50]. Our data suggest that defects in SRP54 may also lead to weakening of the signal sequence binding and potentially lead to human diseases. The mutations should be localized in the SRP54 M domain in that case. Although the disease-causing mutations were not identified in the SRP54 M domain yet, we predict that they will action through the pathological RAPP pathway activation.

Thus, our findings demonstrate that interactions of the polypeptide nascent chains with their natural partners (SRP in this study) during translation is an important step in the protein biogenesis. Disruptions of these interactions may pathologically activate the RAPP pathway leading to silencing of the defective protein expression and as a result to a number of human diseases.

Materials and Methods

Cloning, mutagenesis, DNA and RNA techniques

The clones containing ORFs of the genes LIPA (BC012287.1), COL10A1 (NM_000493.3), PRSS1 (NM_002769.4), SERPINE1 (NM_000602.4), LHB (NM_000894.2), TGFB1 (NM_000660.4), PTH (NM_000315.2), NDP (NM_000266.3), SERPINA7 (NM_000354.5), UGT1A1 (NM_000463.2), CTSK (NM_000396.3) were obtained from Life Technologies, CTLA4 (NM_005214.4) and AGA (BC012392.1) from Sino Biologicals. All cDNAs were cloned into pCS2 vector under control of the CMV promoter. Site-directed mutagenesis was performed by PCR using Phusion High-Fidelity DNA Polymerase (Thermo Scientific) or with Q5 Site-Directed Mutagenesis Kit (New England Biolabs). All clones and mutations were confirmed by DNA sequencing. Isolation of total RNA from cultured human cells was done using the NucleoSpin RNA kit (Clontech). cDNA samples for real-time quantitative PCR (RT-qPCR) reactions were prepared using High Capacity cDNA Reverse Transcription Kit (Applied Biosystems). RT-qPCRs were done on Quant Studio 12K Flex Real-Time PCR System with using Power SYBR Green PCR Master Mix (Applied Biosystems) according to manufacturer’s protocol. Comparative ΔΔCT method was used to quantify the qPCR results [51]. To prepare constructs for in vitro transcription DNA fragments were synthesized using Phusion High-Fidelity DNA Polymerase (Thermo Scientific). PCR products were cleaned using NucleoSpin Gel and PCR Clean-up kit (Clontech). These PCR products were used for in vitro transcription by SP6 RNA polymerase. Resulting mRNA products were purified using RNeasy Mini kit (Qiagen) and used for in vitro translation and crosslinking experiments. All primers used in this study were synthesized by Sigma Aldrich and the sequences are available upon request.

Cell culture and transfection techniques

HeLa Tet-On cell line (Clontech) was used in all experiments. Cells were grown in Dulbecco’s Modified Eagle’s Medium-high glucose (DMEM, Sigma-Aldrich), supplemented with 10 % Fetal Bovine Serum (FBS, Sigma Aldrich) and penicillin (100 units/ml) and streptomycin (100 μg/ml) mixture (Sigma-Aldrich) at 37 °C with 5 % CO2. siRNAs transfections were done using Lipofectamine RNAiMAX (Invitrogen) as described [43] after cells were cultivated for 16–18 hours with starting cell count of 0.5×105 cells/mL. The plasmid DNA transfections were done next day after siRNA transfections (where applicable) or after 20–24 h of cell growth with starting cell count of 2×105 cells/mL using Lipofectamine 2000 (Invitrogen) according to manufacturer’s protocol. When indicated, plasmid-transfected cells were treated with 10 μM of MG-132 or DMSO (control) for 8 h at 37 °C with 5 % CO2. In experiments with inhibition of transcription, cells were treated with 8 μM of actinomycin D (Sigma-Aldrich) for different periods of time as indicated. Artificial OmpA mRNA [52] was added to the samples of the actinomycin D experiment before total RNA purification to use it for normalization in RT-qPCR.

Western Blotting

Expression levels of secretory proteins were tested in cells, media and total samples. Cytoplasmic or membrane-associated proteins were analyzed in cells only. Proteins were separated on SDS-PAGE, transferred to PVDF membrane, and detected by standard Western blotting techniques. The antibodies used in this study: anti-SRP54 (mouse monoclonal, catalog number 610940) was from BD Bioscience, β-actin (mouse monoclonal, catalog number 66009–1-Ig), anti-AGA (rabbit polyclonal, catalog number 17299–1-AP), anti-CTSK (rabbit polyclonal, catalog number 11239–1-AP), anti-UGT1A1 (rabbit polyclonal, catalog number 23495–1-AP) were from Proteintech Group Inc., peroxidase-conjugated goat anti-mouse and (Jackson ImmunoResearch Laboratories), ECL anti-rabbit IgG, horseradish peroxidase linked whole antibody (from donkey, GE Healthcare, catalog number NA934V). Anti-tubulin rabbit polyclonal antibody was a gift from Dan Webster (TTUHSC).

Immunostaining and microscopy

HeLa Tet-On cells were grown on glass cover slips, transfected with siSRP54 RNA (where needed) and then with plasmid DNA carrying wild type or mutant cDNAs. The cells were grown for 40–46 h, then fixed in 4 % paraformaldehyde solution, washed in Dulbecco’s Phosphate Buffered Saline (DPBS, Sigma-Aldrich) and treated with permeabilization buffer containing 0.2 % Triton X−100, 3 % BSA, DPBS for 20 min at 4 °C. Permeabilized cells were incubated with the primary antibody in the same buffer for 1 h at room temperature and washed once in 0.2 % Triton X-100, then three times with DPBS for 5 min. Incubation with the secondary antibody was done in 0.2 % Triton X−100, 3 % BSA, DPBS at room temperature for 30 min in the dark. After wash, cells were mounted on the slide with ProLong Gold antifade reagent with DAPI (Life Technologies) overnight. Alexa Fluor 488 Goat anti-Rabbit IgG (Invitrogen, catalog number A11008) or Alexa Fluor 555 Goat anti-mouse IgG (Life Technologies, catalog number A21422) were used as a secondary antibody for AGA and UGT1A1 or SRP54 correspondingly. Zeiss Axiovert 200M Microscope (TTUHSC imaging center) was used to collect the images.

In vitro translation and site-specific photocrosslinking

Site-specific photocrosslinking technique used in the study was based on tRNA mediated incorporation of photo-reactive probes into the polypeptide nascent chains during in vitro translation [21, 47, 48]. Modified amber-suppressor εANB-Lys-tRNAamb was used for incorporation of the photo-probe into polypeptide position corresponding to amber-stop mutation in mRNA (Fig. 6a). Amber-mutations were introduced by sitedirected mutagenesis into positions corresponding to A19 in AGA; S13 in CTSK, P10 in UGT1A1; H18 in LIPA and N14 in COL10A1 (see amino acid sequences of the signal sequences in Table 1). Truncated mRNAs were prepared from PCR fragments by SP6 RNA polymerase and purified as described above. The mRNAs were truncated in the ORF and did not contain natural stop-codons, that allowed to prepare ribosome-nascent chain complexes (or translational intermediates) with desired length of the polypeptide nascent-chains. Translational intermediates (86 amino acid residues long in this study) were synthesized in 15 μL of reaction containing rabbit reticulocyte lysate (Green Hectares, LLC), 2.6 mM magnesium acetate, 70 mM potassium acetate, 0.8 U/μL RNasin (Promega), 0.8 μCi/μL [35S]methionine and 1 μg of mRNA and 15 pmol of εANB-Lys-tRNAamb (tRNA Probes, LLC). 40 nM purified canine SRP (tRNA Probes, LLC) was added where indicated. Samples were incubated for 40 min at 26 °C in the dark and then subjected to UV irradiation for 15 min on ice (Newport Oriel, 500 W mercury arc lamp). Ribosome-nascent chain complexes were pelleted by centrifugation, treated with RNase A (Sigma-Aldrich) and analyzed as described [43]. Typhoon FLA 9000 Biomolecular Imager was used for phosphorimaging of the gels. [Methyl-14C] methylated protein molecular weight markers (Perkin Elmer) were used to estimate molecular weight of the photo-adducts.

Hydrophobicity of the signal sequences

Hydrophobicity plots were calculated by the Kyte and Doolittle method [53] using the ExPASy server [54] (https://web.expasy.org/protscale/).

Highlights.

  • Mutations in secretory proteins are associated with many human diseases.

  • Disease-causing mutations affecting interaction with SRP trigger mRNA degradation.

  • SRP has a dual function in protein secretion and in protection of the mRNAs from degradation.

Acknowledgements

Authors thank Dan Webster (Texas Tech University Health Sciences Center) for a gift of anti-tubulin rabbit polyclonal antibody. The research was supported by the Start-up funds from Texas Tech University Health Sciences Center and by a grant from the National Institutes of Health (R03NS102645) to A.L.K. The content is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health.

Abbreviations

SRP

signal recognition particle

ER

endoplasmic reticulum

RAPP

Regulation of Aberrant Protein Production

WT

wild-type

εANB-Lys-tRNAamb

Nε-(5-azido-2 nitrobenzoyl)-Lys-tRNAamb

Footnotes

Publisher's Disclaimer: This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final citable form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain.

References

  • [1].Uhlen M, Fagerberg L, Hallstrom BM, Lindskog C, Oksvold P, Mardinoglu A, et al. Proteomics. Tissue-based map of the human proteome. Science. 2015;347:1260419. [DOI] [PubMed] [Google Scholar]
  • [2].Zimmermann R, Muller L, Wullich B. Protein transport into the endoplasmic reticulum: mechanisms and pathologies. Trends in molecular medicine. 2006;12:567–73. [DOI] [PubMed] [Google Scholar]
  • [3].Hebert DN, Molinari M. In and out of the ER: protein folding, quality control, degradation, and related human diseases. Physiol Rev. 2007;87:1377–408. [DOI] [PubMed] [Google Scholar]
  • [4].Lin WJ, Salton SR. The regulated secretory pathway and human disease: insights from gene variants and single nucleotide polymorphisms. Front Endocrinol (Lausanne). 2013;4:96. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [5].Walter P, Ibrahimi I, Blobel G. Translocation of proteins across the endoplasmic reticulum. I. Signal recognition protein (SRP) binds to in-vitro-assembled polysomes synthesizing secretory protein. J Cell Biol. 1981;91:545–50. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [6].Koch HG, Moser M, Muller M. Signal recognition particle-dependent protein targeting, universal to all kingdoms of life. Rev Physiol Biochem Pharmacol. 2003;146:55–94. [DOI] [PubMed] [Google Scholar]
  • [7].Krieg UC, Walter P, Johnson AE. Photocrosslinking of the signal sequence of nascent preprolactin to the 54-kilodalton polypeptide of the signal recognition particle. Proc Natl Acad Sci U S A. 1986;83:8604–8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [8].Akopian D, Shen K, Zhang X, Shan SO. Signal recognition particle: an essential protein-targeting machine. Annu Rev Biochem. 2013;82:693–721. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [9].Wild K, Halic M, Sinning I, Beckmann R. SRP meets the ribosome. Nat Struct Mol Biol. 2004;11:1049–53. [DOI] [PubMed] [Google Scholar]
  • [10].Walter P, Blobel G. Translocation of proteins across the endoplasmic reticulum III. Signal recognition protein (SRP) causes signal sequence-dependent and site-specific arrest of chain elongation that is released by microsomal membranes. J Cell Biol. 1981;91:557–61. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [11].Alder NN, Johnson AE. Cotranslational membrane protein biogenesis at the endoplasmic reticulum. J Biol Chem. 2004;279:22787–90. [DOI] [PubMed] [Google Scholar]
  • [12].Egea PF, Stroud RM, Walter P. Targeting proteins to membranes: structure of the signal recognition particle. Curr Opin Struct Biol. 2005;15:213–20. [DOI] [PubMed] [Google Scholar]
  • [13].Voorhees RM, Hegde RS. Toward a structural understanding of co-translational protein translocation. Curr Opin Cell Biol. 2016;41:91–9. [DOI] [PubMed] [Google Scholar]
  • [14].Dudek J, Pfeffer S, Lee PH, Jung M, Cavalie A, Helms V, et al. Protein transport into the human endoplasmic reticulum. J Mol Biol. 2015;427:1159–75. [DOI] [PubMed] [Google Scholar]
  • [15].von Heijne G Patterns of amino acids near signal-sequence cleavage sites. Eur J Biochem. 1983;133:17–21. [DOI] [PubMed] [Google Scholar]
  • [16].von Heijne G The signal peptide. J Membr Biol. 1990;115:195–201. [DOI] [PubMed] [Google Scholar]
  • [17].Nilsson I, Lara P, Hessa T, Johnson AE, von Heijne G, Karamyshev AL. The code for directing proteins for translocation across ER membrane: SRP cotranslationally recognizes specific features of a signal sequence. J Mol Biol. 2015;427:1191–201. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [18].Kalinin AE, Mikhaleva NI, Karamyshev AL, Karamysheva ZN, Nesmeyanova MA. Interaction of mutant alkaline phosphatase precursors with membrane phospholipids in vivo and in vitro. Biochemistry (Mosc). 1999;64:1021–9. [PubMed] [Google Scholar]
  • [19].Karamyshev AL, Karamysheva ZN, Kajava AV, Ksenzenko VN, Nesmeyanova MA. Processing of Escherichia coli alkaline phosphatase: role of the primary structure of the signal peptide cleavage region. J Mol Biol. 1998;277:859–70. [DOI] [PubMed] [Google Scholar]
  • [20].Nesmeyanova MA, Karamyshev AL, Karamysheva ZN, Kalinin AE, Ksenzenko VN, Kajava AV. Positively charged lysine at the N-terminus of the signal peptide of the Escherichia coli alkaline phosphatase provides the secretion efficiency and is involved in the interaction with anionic phospholipids. FEBS Lett. 1997;403:203–7. [DOI] [PubMed] [Google Scholar]
  • [21].Karamyshev AL, Johnson AE. Selective SecA association with signal sequences in ribosome-bound nascent chains: a potential role for SecA in ribosome targeting to the bacterial membrane. J Biol Chem. 2005;280:37930–40. [DOI] [PubMed] [Google Scholar]
  • [22].Saarela J, von Schantz C, Peltonen L, Jalanko A. A novel aspartylglucosaminuria mutation affects translocation of aspartylglucosaminidase. Hum Mutat. 2004;24:350–1. [DOI] [PubMed] [Google Scholar]
  • [23].Donnarumma M, Regis S, Tappino B, Rosano C, Assereto S, Corsolini F, et al. Molecular analysis and characterization of nine novel CTSK mutations in twelve patients affected by pycnodysostosis. Mutation in brief #961. Online. Hum Mutat 2007;28:524. [DOI] [PubMed] [Google Scholar]
  • [24].Fujita Y, Nakata K, Yasui N, Matsui Y, Kataoka E, Hiroshima K, et al. Novel mutations of the cathepsin K gene in patients with pycnodysostosis and their characterization. J Clin Endocrinol Metab. 2000;85:425–31. [DOI] [PubMed] [Google Scholar]
  • [25].Seppen J, Steenken E, Lindhout D, Bosma PJ, Elferink RP. A mutation which disrupts the hydrophobic core of the signal peptide of bilirubin UDP-glucuronosyltransferase, an endoplasmic reticulum membrane protein, causes CriglerNajjar type II. FEBS Lett. 1996;390:294–8. [DOI] [PubMed] [Google Scholar]
  • [26].Fingerhut A, Reutrakul S, Knuedeler SD, Moeller LC, Greenlee C, Refetoff S, et al. Partial deficiency of thyroxine-binding globulin-Allentown is due to a mutation in the signal peptide. J Clin Endocrinol Metab. 2004;89:2477–83. [DOI] [PubMed] [Google Scholar]
  • [27].Fuchs S, Xu SY, Caballero M, Salcedo M, La OA, Wedemann H, et al. A missense point mutation (Leu13Arg) of the Norrie disease gene in a large Cuban kindred with Norrie disease. Hum Mol Genet. 1994;3:655–6. [DOI] [PubMed] [Google Scholar]
  • [28].Sunthornthepvarakul T, Churesigaew S, Ngowngarmratana S. A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism. J Clin Endocrinol Metab. 1999;84:3792–6. [DOI] [PubMed] [Google Scholar]
  • [29].Arnold A, Horst SA, Gardella TJ, Baba H, Levine MA, Kronenberg HM. Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism. The Journal of clinical investigation. 1990;86:1084–7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [30].Anjos S, Nguyen A, Ounissi-Benkalha H, Tessier MC, Polychronakos C. A common autoimmunity predisposing signal peptide variant of the cytotoxic T-lymphocyte antigen 4 results in inefficient glycosylation of the susceptibility allele. J Biol Chem. 2002;277:46478–86. [DOI] [PubMed] [Google Scholar]
  • [31].Jiang M, Lamminen T, Pakarinen P, Hellman J, Manna P, Herrera RJ, et al. A novel Ala(−3)Thr mutation in the signal peptide of human luteinizing hormone beta-subunit: potentiation of the inositol phosphate signalling pathway and attenuation of the adenylate cyclase pathway by recombinant variant hormone. Mol Hum Reprod. 2002;8:201–12. [DOI] [PubMed] [Google Scholar]
  • [32].Zhang ZY, Wang ZY, Dong NZ, Bai X, Zhang W, Ruan CG. A case of deficiency of plasma plasminogen activator inhibitor-1 related to Ala15Thr mutation in its signal peptide. Blood Coagul Fibrinolysis. 2005;16:79–84. [DOI] [PubMed] [Google Scholar]
  • [33].Witt H, Luck W, Becker M. A signal peptide cleavage site mutation in the cationic trypsinogen gene is strongly associated with chronic pancreatitis. Gastroenterology. 1999;117:7–10. [DOI] [PubMed] [Google Scholar]
  • [34].Ikegawa S, Nakamura K, Nagano A, Haga N, Nakamura Y. Mutations in the N-terminal globular domain of the type X collagen gene (COL10A1) in patients with Schmid metaphyseal chondrodysplasia. Hum Mutat. 1997;9:131–5. [DOI] [PubMed] [Google Scholar]
  • [35].Chan D, Ho MS, Cheah KS. Aberrant signal peptide cleavage of collagen X in Schmid metaphyseal chondrodysplasia. Implications for the molecular basis of the disease. J Biol Chem. 2001;276:7992–7. [DOI] [PubMed] [Google Scholar]
  • [36].Zschenker O, Jung N, Rethmeier J, Trautwein S, Hertel S, Zeigler M, et al. Characterization of lysosomal acid lipase mutations in the signal peptide and mature polypeptide region causing Wolman disease. J Lipid Res. 2001;42:1033–40. [PubMed] [Google Scholar]
  • [37].Chow KM, Szeto CC, Poon P, Lau WY, Lai FM, Li PK. Transforming growth factorbeta1 gene polymorphism in renal transplant recipients. Ren Fail. 2005;27:671–5. [DOI] [PubMed] [Google Scholar]
  • [38].Lacha J, Hubacek JA, Potmesil P, Viklicky O, Malek I, Vitko S. TGF-beta I gene polymorphism in heart transplant recipients--effect on renal function. Ann Transplant. 2001;6:39–43. [PubMed] [Google Scholar]
  • [39].Yamada Y, Miyauchi A, Goto J, Takagi Y, Okuizumi H, Kanematsu M, et al. Association of a polymorphism of the transforming growth factor-beta1 gene with genetic susceptibility to osteoporosis in postmenopausal Japanese women. J Bone Miner Res. 1998;13:1569–76. [DOI] [PubMed] [Google Scholar]
  • [40].Beranek M, Kankova K, Benes P, Izakovicova-Holla L, Znojil V, Hajek D, et al. Polymorphism R25P in the gene encoding transforming growth factor-beta (TGF-beta1) is a newly identified risk factor for proliferative diabetic retinopathy. Am J Med Genet. 2002;109:278–83. [DOI] [PubMed] [Google Scholar]
  • [41].Chen JM, Raguenes O, Ferec C, Deprez PH, Verellen-Dumoulin C, Andriulli A. The A16V signal peptide cleavage site mutation in the cationic trypsinogen gene and chronic pancreatitis. Gastroenterology. 1999;117:1508–9. [DOI] [PubMed] [Google Scholar]
  • [42].Jarjanazi H, Savas S, Pabalan N, Dennis JW, Ozcelik H. Biological implications of SNPs in signal peptide domains of human proteins. Proteins. 2008;70:394–403. [DOI] [PubMed] [Google Scholar]
  • [43].Karamyshev AL, Patrick AE, Karamysheva ZN, Griesemer DS, Hudson H, Tjon-Kon-Sang S, et al. Inefficient SRP interaction with a nascent chain triggers a mRNA quality control pathway. Cell. 2014;156:146–57. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [44].Karamyshev AL, Karamysheva ZN. Lost in Translation: Ribosome-Associated mRNA and Protein Quality Controls. Front Genet. 2018;9:431. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [45].Pinarbasi ES, Karamyshev AL, Tikhonova EB, Wu IH, Hudson H, Thomas PJ. Pathogenic Signal Sequence Mutations in Progranulin Disrupt SRP Interactions Required for mRNA Stability. Cell Rep. 2018;23:2844–51. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [46].Karamysheva ZN, Tikhonova EB, Karamyshev AL. Granulin in Frontotemporal Lobar Degeneration: Molecular Mechanisms of the Disease. Front Neurosci. 2019;13:395. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [47].Etchells SA, Meyer AS, Yam AY, Roobol A, Miao Y, Shao Y, et al. The cotranslational contacts between ribosome-bound nascent polypeptides and the subunits of the hetero-oligomeric chaperonin TRiC probed by photocross-linking. J Biol Chem. 2005;280:28118–26. [DOI] [PubMed] [Google Scholar]
  • [48].Karamyshev AL, Kelleher DJ, Gilmore R, Johnson AE, von Heijne G, Nilsson I. Mapping the interaction of the STT3 subunit of the oligosaccharyl transferase complex with nascent polypeptide chains. J Biol Chem. 2005;280:40489–93. [DOI] [PubMed] [Google Scholar]
  • [49].Carapito R, Konantz M, Paillard C, Miao Z, Pichot A, Leduc MS, et al. Mutations in signal recognition particle SRP54 cause syndromic neutropenia with Shwachman Diamond-like features. The Journal of clinical investigation. 2017;127:4090–103. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [50].Bellanne-Chantelot C, Schmaltz-Panneau B, Marty C, Fenneteau O, Callebaut I, Clauin S, et al. Mutations in the SRP54 gene cause severe congenital neutropenia as well as Shwachman-Diamond-like syndrome. Blood. 2018;132:1318–31. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [51].Schmittgen TD, Livak KJ. Analyzing real-time PCR data by the comparative C(T) method. Nat Protoc. 2008;3:1101–8. [DOI] [PubMed] [Google Scholar]
  • [52].Karamysheva ZN, Tikhonova EB, Grozdanov PN, Huffman JC, Baca KR, Karamyshev A, et al. Polysome Profiling in Leishmania, Human Cells and Mouse Testis. J Vis Exp. 2018. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [53].Kyte J, Doolittle RF. A simple method for displaying the hydropathic character of a protein. J Mol Biol. 1982;157:105–32. [DOI] [PubMed] [Google Scholar]
  • [54].Wilkins MR, Gasteiger E, Bairoch A, Sanchez JC, Williams KL, Appel RD, et al. Protein identification and analysis tools in the ExPASy server. Methods Mol Biol. 1999;112:531–52. [DOI] [PubMed] [Google Scholar]

RESOURCES