Abstract
Both psoriasis and atopic dermatitis (AD) are not only associated with an impaired stratum corneum barrier, but also with abnormal expression of the tight junction (TJ) proteins. Because host defense peptides, including LL-37, are overexpressed in lesional psoriatic skin but are downregulated in lesional AD skin, we hypothesized that LL-37 might regulate the TJ function in keratinocytes. We demonstrated that LL-37 selectively increased the expression of several claudins and occludin, and enhanced their membrane distribution. Furthermore, LL-37 elevated the transepithelial electrical resistance while reducing the paracellular permeability of keratinocyte layers, and this activity was weakened by the claudin inhibitor ochratoxin A. A characterization of the molecular mechanism underlying the regulation of the TJ barrier by LL-37 revealed that LL-37 induced the activation of the Rac1, atypical PKC, glycogen synthase kinase-3 and PI3K pathways, and the specific inhibition of these pathways reversed the LL-37-mediated regulation of TJ function. In addition, LL-37 enhanced the expression of differentiation markers under the control of ochratoxin A, suggesting an association between LL-37-induced TJ function and keratinocyte differentiation. These data provide novel evidence that, in addition to its antimicrobial and other immunoregulatory functions, LL-37 contributes to cutaneous immunity by strengthening the skin's barrier function.
Key Words: Antimicrobial peptide, Cathelicidin LL-37, Keratinocyte, Skin barrier, Tight junction
Introduction
Host defense peptides (HDPs), also known as antimicrobial peptides, are commonly cationic and form a variety of structural motifs that are generally 10-50 aa in length and contain up to 50% hydrophobic amino acids. According to the antimicrobial peptide database (http://aps.unmc.edu/AP/main.php), more than 2,000 HDPs have been discovered to date. Initially, HDPs were identified as endogenous antibiotics due to their ability to kill various pathogens. However, recent studies have demonstrated that these peptides are implicated in diverse biological processes, such as promoting chemotaxis, stimulating the production of cytokines and chemokines, modulating dendritic cell and macrophage differentiation, regulating neutrophil and epithelial cell apoptosis, suppressing pro-inflammatory responses, inducing angiogenesis and inducing wound healing [reviewed in [1]]. To date, several hundred HDPs have been identified in human skin, where they are expressed constitutively or are induced in dangerous situations such as skin injury or infection. Among the skin-derived HDPs, cathelicidin LL-37, human β-defensins (hBDs) and the S100 protein psoriasin (S100A7) have been shown to play key roles in cutaneous defense [1].
Cathelicidins consist of a highly conserved N-terminal cathelin domain and a mature, active, variable C-terminal peptide that is proteolytically released upon activation [2]. The single human member of the cathelicidin family is the 18-kDa human cationic antibacterial protein (hCAP18), and the mature peptide derived from hCAP18 is termed LL-37. In skin, LL-37 is synthesized by keratinocytes and by neutrophils that transport LL-37 when they infiltrate infected or wounded skin [1]. In healthy skin, LL-37 expression is barely detectable in keratinocytes; however, during infection or injury, LL-37 production by these cells is strongly increased [3]. In addition to this peptide's antimicrobial activity, we and others have previously demonstrated that LL-37 has a broad spectrum of immunomodulatory properties in epithelial cells and keratinocytes, including the stimulation of cytokine/chemokine secretion, the induction of migration and proliferation, the modulation of cell survival, and the promotion of wound healing [1]. The in vivo importance of LL-37 and other cathelicidins in the prevention of skin infections has been demonstrated in experimental studies. For instance, mice that do not express cathelin-related antimicrobial peptide, or CRAMP, an LL-37 ortholog, exhibit increased susceptibility to group A Streptococcus infections [4].
HDPs, including LL-37, hBDs and psoriasin, have been implicated in the pathologies of inflammatory and autoimmune skin diseases such as psoriasis and atopic dermatitis (AD) [1], and the presence of large numbers of these HDPs in lesional psoriatic skin helps explain why patients with psoriasis experience fewer cutaneous infections than expected [5]. It has been reported that, compared with lesional psoriatic skin, the lesional AD skin displays an impaired induction of HDPs such as hBDs and LL-37 [6], which explains the frequent bacterial infections in AD patients. However, it appears that the induction of HDPs is not generally impaired in lesional AD skin, as shown by a recent study showing enhanced expression of hBD-2, hBD-3, psoriasin and ribonuclease 7 in the lesional skin of AD patients compared with non-lesional skin and healthy controls, although the absolute levels of HDP secretion were lower than the levels detected in psoriasis patients [7]. Although both psoriatic and AD skin have been associated with stratum corneum barrier defects, a recent report showed that, in contrast to uninvolved psoriasis, uninvolved AD skin displays a reduced expression of tight junction (TJ) proteins, which causes the barrier dysfunction observed in AD patients [8].
TJs serve as a physical barrier to prevent solutes and water from passing through the paracellular space. TJs create this barrier by forming cell-cell junctions that connect neighboring cells, control the paracellular passage of molecules (barrier function), and separate the apical and the basolateral portions of the cell membrane (fence function) [9]. In addition, TJs play important roles in cell differentiation and proliferation, cell communication and cell polarity [10]. In the human epidermis, TJs are composed of transmembrane proteins such as claudins, occludin and junctional adhesion molecules, which are clustered and stabilized by cytosolic plaque proteins called zonula occludens [11]. Claudins play an essential role in the regulation of TJ function by tightening or disrupting the epithelial barrier [12, 13]. HDPs such as hBDs and LL-37 are reduced in lesional AD skin but overexpressed in lesional psoriatic skin [6], and the expression of TJ proteins is impaired in uninvolved AD skin but normal, decreased or increased in psoriatic skin [14, 15, 16]. Therefore, we hypothesized that, beyond their dual roles as antimicrobial agents and immunomodulators, HDPs may perform additional functions in the regulation of cutaneous barrier function.
In this study, we showed that LL-37 markedly enhances the expression and membrane distribution of various TJ proteins, including claudins and occludin, and contributes to the regulation of TJ barrier function by increasing the transepithelial electrical resistance (TER) and reducing the paracellular flux in keratinocyte layers. The LL-37-mediated regulation of TJ barrier function involved various pathways, such as the atypical protein kinase C (aPKC), Rac1, glycogen synthase kinase (GSK)-3 and PI3K pathways. Furthermore, LL-37 induced the expression of several keratinocyte differentiation-specific proteins; this upregulated expression was reduced by the presence of ochratoxin A. These data demonstrate that LL-37 displays a novel role in cutaneous innate immunity by regulating TJ barrier function.
Materials and Methods
Reagents
LL-37 (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) was synthesized using the solid-phase method with a peptide synthesizer (Model PSSM-8; Shimadzu, Kyoto, Japan) by fluorenylmethoxycarbonyl chemistry, and the molecular mass was confirmed with a mass spectrometer (Model TSQ 700; Thermo Quest Finnigan, Manchester, UK). The filaggrin antibody was obtained from Abcam (Tokyo, Japan), the involucrin antibody was from Santa Cruz Biotechnology (Santa Cruz, Calif., USA), and the keratin 1, keratin 10 and transglutaminase 1 antibodies were purchased from Novus Biologicals (Littleton, Colo., USA). The anti-claudin-1, 3, 4 and 7 and occludin antibodies were purchased from Invitrogen (Carlsbad, Calif., USA), and the anti-claudin-9 and 14 antibodies were obtained from Abcam. The anti-phosphorylated GSK-3α/β (Tyr279/Tyr216), PKC ζ/λ and PI3K antibodies, as well as the GSK-3α/β, PKC ζ and PI3K antibodies, were purchased from Cell Signaling Technology (Beverly, Mass., USA). GF109203X was purchased from Enzo Life Sciences (Farmingdale, N.Y., USA), SB 415286 was obtained from Tocris Bioscience (Bristol, UK), and wortmannin and ochratoxin A were purchased from Sigma-Aldrich (St. Louis, Mo., USA). NSC23766 was obtained from Calbiochem (La Jolla, Calif., USA).
Keratinocyte Culture and Stimulation
Primary human epidermal keratinocytes isolated from neonatal foreskins were purchased from Kurabo Industries (Osaka, Japan) and were cultured in serum-free HuMedia-KG2 keratinocyte growth medium (Kurabo Industries), as previously described [17]. The cells were serially passaged at 60–70% confluence, and the experiments were conducted at passage three using subconfluent cells (60–80% confluence) in the proliferative phase, unless otherwise specified. For total RNA extraction and Western blot analysis, keratinocytes were cultured in 12-well tissue culture plates, washed with PBS and incubated with LL-37 in HuMedia without supplements for the indicated periods. For the TER and paracellular flux assays, 0.72 × 105 cells were plated onto transwells of 0.4-μm pore size (Millipore, Billerica, Mass., USA) and were switched to high-Ca2+ (1.35 mM) medium after reaching confluence.
Total RNA Extraction and Real-Time Quantitative PCR
Total RNA was extracted from keratinocytes using the RNeasy Plus Micro kit (Qiagen, Hilden, Germany), and first-strand cDNA was synthesized from 1 μg of total RNA using the ReverTra Ace qPCR RT kit (Toyobo, Osaka, Japan), according to the manufacturer's instructions. Real-time PCR was performed using the TaqMan Universal PCR Master Mix (Applied Biosystems, Branchburg, N.J., USA). Amplification and detection of mRNA were performed using the StepOnePlus Real-Time PCR System (Applied Biosystems) following the manufacturer's specifications. All the primer/probe sets used in this study were obtained from Applied Biosystems' Assays-on-Demand; the order numbers are listed in online supplementary table S1 (for all online suppl. material, see www.karger.com/doi/10.1159/000362789). All the real-time PCR reactions were performed in triplicate, and the changes in gene expression are reported as fold increases relative to untreated controls.
Western Blot Analysis
Keratinocytes cultured in high-Ca2+ medium were incubated with LL-37 for the indicated time periods. After stimulation, lysates were obtained by lysing the cells in RIPA buffer (Cell Signaling Technology). The total protein concentrations were determined using the Precision Red Advanced Protein Assay kit (Cytoskeleton, Denver, Colo., USA), and equal amounts of total protein were subjected to 12.5% SDS-PAGE. Non-specific binding sites were blocked with Immunoblock (Dainippon-Pharm, Osaka, Japan) for 1 h at room temperature. The blots were incubated overnight according to the manufacturer's instructions, with the appropriate antibodies diluted in a mixture of TBS containing 0.1% Tween 20 and Immunoblock (1:1). The antibodies and the conditions of their use are outlined in online supplementary table S2. The membrane was developed with the Luminata Forte Western HRP substrate (Millipore, Billerica, Mass., USA) and was imaged using Fujifilm LAS-4000 Plus (Fujifilm, Tokyo, Japan). To quantify the band intensities, a densitometry analysis was performed using the software program Image Gauge (LAS-4000 Plus, Fujifilm) to correct for protein loading discrepancies. In some of the experiments, the cells in high-Ca2+ medium were pretreated with ochratoxin A, NSC23766, GF109203X, SB 415286 or wortmannin, and Western blotting was performed as above.
Measurements of TER and Paracellular Flux
Keratinocytes grown on 0.6-cm2 transwell filters were transferred into high-Ca2+ medium, and LL-37 was added to both the apical and basal compartments. The TER across the keratinocyte layers was measured at 0-120 h after culture using cellZscope (nanoAnalytics, Münster, Germany). The TER values were corrected by subtracting the value of a blank (no cells) and were expressed in Ω·cm2. Keratinocytes were also grown on 0.3-cm2 transwell filters, and the paracellular flux assay was performed as previously described using 4-kDa FITC-dextran (Sigma-Aldrich) as a tracer [18]. Briefly, after the chambers were transferred into high-Ca2+ medium, the keratinocyte layers were stimulated with LL-37 for 0-120 h. The media in the apical and basal compartments were replaced with 250 μl of P buffer (10 mM HEPES, pH 7.4, 1 mM sodium pyruvate, 10 mM glucose, 3 mM CaCl2 and 145 mM NaCl) containing 10 mg/ml FITC-dextran and 700 μl of P buffer, respectively. After 2 h, the medium was collected from the basal compartment and the fluorescence was measured with a fluorimeter (Nihon Molecular Devices, Tokyo, Japan).
In some experiments, chambers were transferred into high-Ca2+ medium, and keratinocyte layers were treated with various inhibitors before the addition of LL-37. TER and paracellular flux were then measured at 96 h. The doses of inhibitors used in this study were not toxic to the keratinocytes, as confirmed by lactate dehydrogenase activity assay (data not shown). All the experiments included DMSO vehicle controls, and the levels of DMSO in the cell cultures never exceeded 0.1% (data not shown).
Rac1 Activation Assay
In accordance with the manufacturer's protocol (Cytoskeleton), keratinocytes at about 50% confluence were stimulated with LL-37 for 0-96 h. Following stimulation, lysates were obtained by lysing the cells in RIPA buffer supplemented with a protease inhibitor cocktail, and the total protein concentrations were determined using the Precision Red Advanced Protein Assay kit (Cytoskeleton). Rac1 activation was determined using the Rac1 activation assay kit (Cytoskeleton) according to the manufacturer's recommendations.
Immunofluorescence Microscopy
Keratinocytes were cultured in high-Ca2+ medium on collagen I-coated chamber slides (BD Biosciences, Bedford, Mass., USA) and were stimulated with LL-37 for 96 h. Following fixation with methanol for 15 min at 4°C, the cells were blocked in Protein Block Serum-Free (DakoCytomation, Carpinteria, Calif., USA) containing 0.2% Tween-20 for 20 min at room temperature. The cells were then incubated overnight at 4°C with the appropriate primary antibodies diluted in 1% BSA (BSA-PBS) containing 0.1% Tween 20, followed by incubation with specific secondary antibodies coupled to Alexa 594 (Invitrogen) for 30 min at room temperature. Images were captured using confocal laser scanning microscopy (Carl Zeiss, Jena, Germany).
Statistical Analysis
The statistical analysis consisted of either an ANOVA followed by the appropriate post hoc test or Student's t test. The statistical analyses were performed with Prism GraphPad for Windows (Prism 5, GraphPad Software, San Diego, Calif., USA). A value of p < 0.05 was considered significant. The results are presented as the means ± SD.
Results
LL-37 Selectively Enhances the Expression and Membrane Distribution of Various TJ Proteins in Human Keratinocytes
To investigate the effects of LL-37 on the skin TJ barrier function, we first analyzed whether LL-37 could induce the expression of TJ proteins in normal human keratinocytes. As shown in figure 1a, following LL-37 stimulation for 24 h, the mRNA expression levels of claudin-1, 3-7, 9, 12, 14, 16, 17 and occludin significantly increased in a dose-dependent manner. However, LL-37 did not significantly affect the mRNA expression levels of other TJ proteins, such as JAM-1∼3 and zonula occludens 1∼3 (data not shown). Because LL-37 increased the gene expression levels of various TJ components, we examined whether this HDP could also elevate the protein levels of TJ proteins. As determined by a Western blot analysis, LL-37 selectively increased the total protein expression of claudin-1, 3, 4, 7, 9, 14 and occludin. The increases in protein expression occurred at 48 h, and most of them had become more remarkable at 72 and 96 h (fig. 1b). Interestingly, LL-37 had no effect on the protein expression of claudin-5, 6, 12, 16 or 17 (data not shown), suggesting that LL-37 selectively regulates TJ components in keratinocytes.
The membrane distribution of TJ proteins is essential for the formation of the TJ barrier; increases in the total amounts of TJ proteins do not necessarily prove the functionality of these proteins. Therefore, the effect of LL-37 on the membrane distribution of TJ proteins was examined. As seen in figure 2, among the TJ proteins for which total protein levels were increased by LL-37, claudin-1, 3, 4, 7 and occludin were widely distributed at the cell-cell borders upon LL-37 stimulation, suggesting that these TJ proteins function to form the TJ barrier. In contrast, no membrane distribution of claudin-9 or 14 was observed. The whole blots of claudin-9 and 14 are shown in online supplementary figure S1.
LL-37 Increases the TER and Decreases the Paracellular Diffusion of FITC-Dextran through Keratinocyte Layers
Because LL-37 induced changes in the membrane distribution of certain TJ proteins, we examined whether these changes were associated with the regulation of the TJ barrier function. First, we assessed the TER, a highly sensitive parameter of TJ ionic permeability [13], at different times. Compared with untreated keratinocyte layers, cells that were stimulated with 10 or 20 μg/ml of LL-37 did not exhibit significant increases in TER values until 72 h, after which time the TER values gradually increased, reaching maximal values at 96 h. The TER then decreased to approximately 70% of the maximal values at 120 h (fig. 3a).
TJs restrict not only the paracellular permeability of ions (measured by TER) but also the permeability of larger solutes (paracellular flux). Therefore, we measured the paracellular permeability of a membrane-impermeant tracer, 4-kDa FITC-dextran, a marker of paracellular transport [18]. LL-37-stimulated keratinocyte layers were incubated for 2 h with 4-kDa FITC-dextran, and the apical-to-basolateral diffusion was determined by measuring the fluorescence in the basolateral medium. Figure 3b shows that compared with the control layers, which exhibited high levels of FITC-dextran flux, the LL-37 -treated keratinocyte layers had significantly decreased FITC-dextran flux from the apical compartment to the basolateral compartment 24 h after stimulation. The permeability underwent a further, gradual decrease to a minimum level at 96 h before progressively increasing. These observations suggest that LL-37 regulates TJ barrier function.
LL-37-Induced Regulation of TJ Barrier Function in Keratinocyte Layers Is Inhibited by Ochratoxin A
To confirm that the LL-37-induced improvement in the TJ barrier function was caused by the increased expression of claudins, we blocked the LL-37-mediated regulation of TER and paracellular flux using ochratoxin A, a toxin that affects TJ barrier properties by removing specific claudin isoforms from the TJ network [18]. As shown in figure 4a, pretreatment of keratinocyte layers with 10 and 100 nM of ochratoxin A for 24 h significantly reduced the TER to the baseline values in LL-37-stimulated cells. Furthermore, ochratoxin A also altered the LL-37-induced decrease in the paracellular flux of 4-kDa FITC-dextran. The addition of ochratoxin A to the LL-37-stimulated layers increased the diffusion of 4-kDa FITC-dextran in a dose-dependent manner, causing a maximum increase in the paracellular flux of approximately threefold. The concentrations of ochratoxin A used in this study did not significantly affect the basal TER or paracellular flux in non-stimulated cells.
We confirmed that the weakening of the TJ barrier function by ochratoxin A was due to the ability of this toxin to inhibit claudin expression. As seen in figure 4b, ochratoxin A reduced the total protein expression of claudin-1, 3, 4, 9, 14 and occludin, but it had no effect on claudin-7. This result implies that the LL-37-mediated regulation of TJ barrier function was under the control of ochratoxin A.
LL-37 Regulates TJ Barrier Function through the Activation of aPKC ζ/λ
To examine the mechanism by which LL-37 regulates TJ barrier function, we first investigated the involvement of aPKCs, which are considered potential regulators of TJ assembly. Specifically, the aPKC ι/λ and aPKC ζ isoforms are associated with TJ proteins [19]. Using Western blots, we first assessed whether LL-37 induces the phosphorylation of aPKCs. As shown in figure 5a, LL-37 increased the amount of aPKC ζ/λ phosphorylation at 2 h. This increase was more remarkable from 4 h until 72 h and had faded slightly at 96 h.
Because the pan-PKC inhibitor GF109203X has been reported to hamper the TJ barrier function [19], we investigated the requirement for aPKC activation in LL-37-mediated TJ barrier function by pretreating keratinocyte layers with GF109203X. As shown in figure 5b, GF109203X disrupted the improved TJ barrier produced by the LL-37-stimulated keratinocyte layers by decreasing the TER and increasing the paracellular flux of 4-kDa FITC-dextran to the basal levels, and it had no effect on the TJ barrier function in non-stimulated cells. This result implies that LL-37 regulates TJ barrier function through the aPKC signaling pathway.
Activation of Rac1 Is Necessary for LL-37-Mediated Regulation of TJ Barrier Function in Keratinocyte Layers
Rac1 activation is required for TJ formation and the maturation of epidermal keratinocytes, and this activation is associated with the activation of aPKC ζ [19]. Therefore, we hypothesized that LL-37 regulates TJ barrier function through the activation of Rac1. Following the stimulation of keratinocytes with LL-37, changes in Rac1 activation levels were evaluated using a Rac1 activation pull-down assay. As shown in figure 6a, upon LL-37 stimulation, the activation of Rac1 (GTP-bound Rac1) was rapid and transient at 5 min, and it was no longer observed from 15 min until 96 h. The activation of Rac1 was necessary for the LL-37-mediated regulation of TJ barrier function because the pretreatment of keratinocyte layers with the Rac1-specific inhibitor NSC23766, which is known to block TER increases [20], attenuated the LL-37-induced increases in the TER values to the basal levels and enhanced the paracellular flux of 4-kDa FITC-dextran by approximately threefold in LL-37-stimulated cells (fig. 6b). This result indicates that Rac1 activation is required for the LL-37-induced improvement in TJ barrier function.
LL-37 Activates GSK-3α/β, Which Is Necessary for the Regulation of TJ Barrier Function
GSK-3, which comprises the GSK-3α and GSK-3β isoforms, has been implicated in the maintenance of epithelial barrier function by selectively regulating TJ protein expression [21, 22]. An increase in the phosphorylation of GSK-3α/β at Tyr279/Tyr216 has been correlated with GSK-3 activation by various stimuli [21]. Hence, we investigated the effects of LL-37 on GSK-3 phosphorylation and the involvement of this kinase in the LL-37-mediated regulation of TJ barrier function. A Western blot analysis using an antibody that recognizes the tyrosine-phosphorylated version of both the GSK-3α and GSK-3β isoforms revealed that LL-37 considerably enhanced the phosphorylation of GSK-3α/β at Tyr279/Tyr216 at 2 h, and this phosphorylation was sustained for 96 h. No differences were detected in the total amount of GSK-3α/β (fig. 7a). In contrast, LL-37 did not alter the phosphorylation of GSK-3α/β at Ser21/Ser9 (data not shown), a phosphorylation that is known to inactivate GSK-3 [21], suggesting that LL-37 induces GSK-3 activation in keratinocytes. This activation was required for the LL-37-mediated regulation of TJ barrier function: the treatment of keratinocyte layers with SB 415286, which inhibits GSK-3 by reducing the TER and increasing paracellular permeability [22], resulted in a dramatic decrease in the TER to the baseline level while markedly increasing the paracellular flux of 4 kDa-FITC-dextran (fig. 7b).
Activation of PI3K Is Required for LL-37-Induced Regulation of TJ Barrier Function
PI3K has been shown to be involved in the assembly and regulation of the epithelial barrier, and the PI3K pathway has been implicated in GSK-3 phosphorylation [19]. Therefore, we postulated that PI3K might be involved in the LL-37-induced regulation of TJ barrier function. In support of our hypothesis, Western blot results revealed an increase in PI3K (p85/p55) following a 4 h stimulation with LL-37; this PI3K activation was sustained for 96 h (fig. 8a). Next, we confirmed the requirement for PI3K activation in LL-37-regulated TJ barrier function by pretreating keratinocyte layers with a PI3K-specific inhibitor, wortmannin. As shown in figure 8b, wortmannin completely abolished the increases in TER values to the baseline level in LL-37-stimulated layers, and it dose-dependently increased the paracellular diffusion of 4-kDa FITC-dextran by up to threefold. This finding indicates that LL-37 improved the epidermal permeability barrier function via the PI3K signaling pathway.
LL-37 Increases the Expression of Keratinocyte Differentiation Markers
In addition to forming a selective paracellular barrier, TJs play a crucial role in keratinocyte differentiation: the formation of functional TJs in the epidermis is a prerequisite for normal differentiation, and the impairment of keratinocyte terminal differentiation can influence TJ protein expression [23]. Therefore, we hypothesized that LL-37 might also influence the expression of differentiation markers. Among the investigated differentiation markers, LL-37 considerably induced the protein expression of filaggrin, involucrin, keratin 1, keratin 10 and transglutaminase 1 (fig. 9a). Because there was no remarkable change in the high-molecular filaggrin, it seems that LL-37 is unlikely involved in the processing of filaggrin (online suppl. fig. S2). There were no significant effects of LL-37 on the expression of loricrin or transglutaminase 3 (data not shown). To evaluate the relationship between LL-37-mediated TJ regulation and keratinocyte differentiation, we examined the effects of ochratoxin A on the expression of keratinocyte differentiation makers. As shown in figure 9b, ochratoxin A suppressed the expression of filaggrin, involucrin, keratin 1, keratin 10 and transglutaminase 1, suggesting an association between the LL-37-mediated regulation of TJ barrier function and keratinocyte differentiation.
Discussion
In this study, we have shown that, in addition to its antimicrobial and other immunomodulatory functions, LL-37 has the ability to upregulate the expression and membrane distribution of TJ components and to improve the TJ barrier function in human keratinocytes, as demonstrated by an increased TER and a reduced paracellular flux through keratinocyte layers. This improvement in TJ barrier function was controlled by, at a minimum, the activation of the aPKC, Rac1, GSK-3 and PI3K pathways.
Although the role of the stratum corneum in the skin permeability barrier has been widely reported, the TJ-associated barrier was largely ignored until the discovery that mice deficient in the TJ component claudin-1 exhibited postnatal lethality due to the absence of an epidermal diffusion barrier [24]. Recently, De Benedetto et al. [8] proposed that the defective expression of claudin-1 and claudin-23 may contribute to the barrier dysfunction in uninvolved AD skin compared with uninvolved psoriatic skin, in which TJ protein levels are normal, increased or downregulated [14, 15, 16]. LL-37 is overexpressed in lesional psoriasis but downregulated in lesional AD [6]. Therefore, we speculated that this differential expression may play a key role in regulating the TJ barrier function. LL-37 selectively increased the mRNA and protein levels of numerous TJ proteins, including claudin-1, 3, 4, 7 and occludin. The membrane distribution of these proteins was widely increased by LL-37 stimulation, suggesting their important role in LL-37-mediated TJ function. Ochratoxin A treatment weakened the above TJ proteins, except claudin-7, but it also suppressed the total protein expression of claudin-9 and claudin-14, which failed to localize to the membrane after LL-37 stimulation. It has been shown that the absence or presence of TJ proteins does not provide definitive evidence that these proteins are functional or dysfunctional [25]; therefore, further investigations are necessary to clarify the functionality of claudin-7, 9 and 14. LL-37 increased the expression of TJ proteins that are generally known to tighten the TJ barrier by enhancing TER and reducing paracellular permeability [12, 26], and LL-37 had no effect on claudin-2, 6 or 10 (data not shown), which tend to disrupt TJ barrier function [27]. LL-37-mediated TJ expression was observed at 48 h and was maintained for 96 h; these changes occurred in tandem with the paracellular flux of FITC-dextran. However, changes in the TER values were not observed until 72 h, after which time they increased to maximal values at 96 h. Both TER and paracellular flux are used as parameters to assess epidermal permeability. However, these parameters are not always coupled, as has been observed in several other contexts [28, 29, 30, 31, 32], and the mechanism of this uncoupling remains poorly understood. Liu et al. [32] have postulated that whereas TER is a static indicator of the epithelial barrier to small ions, paracellular flux is a time-dependent, dynamic measurement of the barrier to larger solutes.
Because TJ proteins have been shown to regulate epithelial differentiation [24], we investigated whether LL-37 also affects differentiation markers. As expected, LL-37 increased the expression of various markers, including the early markers keratin 1 and keratin 10, the intermediate markers involucrin and transglutaminase 1, and the late marker filaggrin. Ochratoxin weakened the LL-37-induced increases in the expression of differentiation markers, which suggests that there is an association between the LL-37-mediated regulation of TJ barrier function and keratinocyte differentiation. It has been shown that TJ proteins can influence differentiation. For instance, keratinocytes from claudin-1-deficient mice exhibited a downregulation of involucrin and altered filaggrin expression [33]. Turksen and Troy [34] demonstrated that the overexpression of claudin-6 resulted in the aberrant expression of various differentiation markers, including keratin 1, involucrin, filaggrin, loricrin and transglutaminase 3. However, TJ proteins have also been shown to be influenced by differentiation. For example, the downregulation of TJ proteins has been reported in patients with filaggrin mutations [23]. Interestingly, newborn sodium channel α-deficient mice showed impaired differentiation but exhibited normal TJs and TJ barrier function, which suggests that TJ proteins and keratinocyte differentiation may be independent of one another [23].
A large number of molecular components have been reported to be required for TJ formation [19]. Among these components, we focused on the aPKC, Rac1, GSK-3 and PI3K pathways to explore the molecular mechanisms by which LL-37 regulates TJ barrier function. We found that the above molecules were indispensable for the LL-37-mediated regulation of TJ barrier function (fig. 5, 6, 7, 8). Furthermore, our observation that specific inhibition of aPKC, Rac1, GSK-3 and PI3K resulted in a significant decrease of the LL-37-induced expression of claudin-1, 3, 4, 9, 14 and occludin, but not claudin-7, suggests the importance of these TJ proteins in the LL-37-regulated TJ function (online suppl. fig. S3).
Previous studies have demonstrated that both the aPKC ζ and aPKC ι/λ isoforms are expressed and activated in the epidermis [19, 35], interact directly with TJs and regulate the formation of the TJ barrier through the activation of TJ proteins [36, 37]. Furthermore, aPKC has been reported to restore TJ formation in keratinocytes in which TJ formation was defective, which further demonstrates the importance of this enzyme in TJ barrier formation and function [38]. Thus, our observation that LL-37 activates aPKC ζ/λ and that the inhibition of this enzyme disrupts LL-37-mediated TJ barrier function without significantly affecting TJ function in non-stimulated cells implies that LL-37 acts through an aPKC pathway to regulate epidermal permeability. Reports have shown that aPKC functions downstream of Rac1, and the inhibition of GTP-Rac1 (the active form of Rac1) and aPKC suppresses TJ formation [38]. Furthermore, the deterioration of TJ functionality in the skin is accompanied by the downregulation of both GTP-Rac1 and aPKC [39]. Therefore, Rac1 involvement was also investigated. As expected, LL-37 increased Rac1 activation, and the Rac1 inhibitor NSC23766 reversed the LL-37-mediated increase in TER and decrease in paracellular flux. Upon stimulation, Rac1 proteins are generally activated very rapidly and transiently [40, 41]. However, it is not clear whether the NSC23766 effect on the LL-37-mediated improvement in TJ function (measured at 96 h) observed in the present study was direct or indirect - a rapid and transient Rac1 activation is also known to regulate other pathways that control TJ function. For example, the prolonged activation of Rho, which enhances TJ barrier function [42], is dependent on the prior activation of Rac1 [40]. Furthermore, PI3K, which can be activated by Rac1 [43], regulates TJ barrier function [the current study and [19]]. Further studies on the effect of LL-37 on Rho activation are necessary to confirm our hypothesis.
Another molecular component implicated in the regulation of the TJ barrier is GSK-3, which comprises two isoforms, GSK-3α and GSK-3β [21]. GSK-3α and GSK-3β function in the regulation of the normal epithelial barrier function by selectively upregulating TJ proteins, such as claudins and occludin [21, 22]. Until recently, GSK-3 was considered a constitutively active enzyme, the activity of which was decreased upon cell stimulation. The inactivation of GSK-3 occurs through the phosphorylation of GSK-α at Ser21 and GSK-3β at Ser9 [21]. However, a number of reports have recently indicated that an increase in the level of tyrosine phosphorylation (Tyr279 in GSK-α and Tyr216 in GSK-3β) is correlated with GSK-3 activation in response to various stimuli, including lysophosphatidic acid, apoptotic stimuli, ischemia, a transient rise in intracellular Ca2+, and insulin [21]. Accordingly, we showed that LL-37 induced GSK-3 activation by increasing the tyrosine phosphorylation of both GSK-α and GSK-β (Tyr279/Tyr216), but had no influence on GSK-α/β phosphorylation at Ser21/Ser9 (data not shown). Furthermore, because the pharmacological inhibition of GSK-3 suppressed the LL-37-induced regulation of TJ function, we confirmed that LL-37 regulates the TJ barrier via GSK-3 activation.
GSK-3 functions downstream of the PI3K pathway, which has also been implicated in the regulation of TJ proteins and their barrier function. Specifically, Little and coworkers [44] reported that PI3K signaling was required for the reorganization of TJ proteins and resistance to paracellular flux in porcine ileal epithelial cells following treatment with prostaglandins, as shown by the inhibitory effects of the PI3K inhibitors wortmannin and LY294002 [19]. PI3K also plays a direct role in strengthening the TJ barrier in response to glucocorticoids; this response is suppressed by PI3K inhibitors, and the tightening of the TJ barrier by glucocorticoids enhances the recruitment of the PI3K p85 subunit to TJs [19]. Accordingly, we demonstrated that LL-37 induced PI3K activation, which was parallel to the LL-37-induced changes in TER and paracellular flux, and the specific inhibition of PI3K reduced the improvement in the LL-37-mediated TJ barrier function, but not in the basal TJ barrier function. Thus, LL-37 may regulate TJ function through the activation of the PI3K signaling pathway. In some cases, the activation of the PI3K pathway can also affect TJ sealing, either by reducing TJ protein expression or inhibiting GSK-3 [19]. Therefore, no generalizations can be made regarding the physiological role of PI3K in the TJ barrier because distinct stimuli may result in opposite effects. Additional studies are necessary to determine the precise role of the PI3K pathway in TJ regulation.
In summary, the data presented here demonstrate that LL-37 selectively enhances the expression and membrane distribution of TJ proteins. Furthermore, this skin-derived HDP is involved in strengthening the TJ barrier function via, at a minimum, the activation of the aPKC, Rac1, GSK-3 and PI3K signaling pathways. Thus, in addition to its antimicrobial and immunomodulatory activities, we have described a previously unknown role for LL-37 as a contributor to cutaneous immunity by regulating the skin barrier function.
Supplementary Material
Acknowledgements
This work was supported in part by a Grant-in-Aid for Scientific Research from the Ministry of Education, Culture, Sports, Science and Technology of Japan, and by the Atopy (Allergy) Research Center, Juntendo University, Tokyo, Japan.
We would like to thank all of the members of the Atopy (Allergy) Research Center and the Department of Immunology of the Juntendo University Graduate School of Medicine for their comments and encouragement, Michiyo Matsumoto for secretarial assistance and Mutsuko Hara for technical assistance with the confocal microscope.
References
- 1.Niyonsaba F, Nagaoka I, Ogawa H, Okumura K. Multifunctional antimicrobial proteins and peptides: natural activators of immune systems. Curr Pharm Des. 2009;15:2393–2413. doi: 10.2174/138161209788682271. [DOI] [PubMed] [Google Scholar]
- 2.Zanetti M, Gennaro R, Romeo D. Cathelicidins: a novel protein family with a common proregion and a variable C-terminal antimicrobial domain. FEBS Lett. 1995;374:1–5. doi: 10.1016/0014-5793(95)01050-o. [DOI] [PubMed] [Google Scholar]
- 3.Schauber J, Dorschner RA, Coda AB, Buchau AS, Liu PT, Kiken D, Helfrich YR, Kang S, Elalieh HZ, Steinmeyer A, Zugel U, Bikle DD, Modlin RL, Gallo RL. Injury enhances TLR2 function and antimicrobial peptide expression through a vitamin D-dependent mechanism. J Clin Invest. 2007;117:803–811. doi: 10.1172/JCI30142. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Nizet V, Ohtake T, Lauth X, Trowbridge J, Rudisill J, Dorschner RA, Pestonjamasp V, Piraino J, Huttner K, Gallo RL. Innate antimicrobial peptide protects the skin from invasive bacterial infection. Nature. 2001;414:454–457. doi: 10.1038/35106587. [DOI] [PubMed] [Google Scholar]
- 5.Henseler T, Christophers E. Disease concomitance in psoriasis. J Am Acad Dermatol. 1995;32:982–986. doi: 10.1016/0190-9622(95)91336-x. [DOI] [PubMed] [Google Scholar]
- 6.Ong PY, Ohtake T, Brandt C, Strickland I, Boguniewicz M, Ganz T, Gallo RL, Leung DY. Endogenous antimicrobial peptides and skin infections in atopic dermatitis. N Engl J Med. 2002;347:1151–1160. doi: 10.1056/NEJMoa021481. [DOI] [PubMed] [Google Scholar]
- 7.Harder J, Dressel S, Wittersheim M, Cordes J, Meyer-Hoffert U, Mrowietz U, Folster-Holst R, Proksch E, Schroder JM, Schwarz T, Glaser R. Enhanced expression and secretion of antimicrobial peptides in atopic dermatitis and after superficial skin injury. J Invest Dermatol. 2010;130:1355–1364. doi: 10.1038/jid.2009.432. [DOI] [PubMed] [Google Scholar]
- 8.De Benedetto A, Rafaels NM, McGirt LY, Ivanov AI, Georas SN, Cheadle C, Berger AE, Zhang K, Vidyasagar S, Yoshida T, Boguniewicz M, Hata T, Schneider LC, Hanifin JM, Gallo RL, Novak N, Weidinger S, Beaty TH, Leung DY, Barnes KC, Beck LA. Tight junction defects in patients with atopic dermatitis. J Allergy Clin Immunol. 2011;127:773–786. doi: 10.1016/j.jaci.2010.10.018. e7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Kirschner N, Rosenthal R, Furuse M, Moll I, Fromm M, Brandner JM. Contribution of tight junction proteins to ion, macromolecule, and water barrier in keratinocytes. J Invest Dermatol. 2013;133:1161–1169. doi: 10.1038/jid.2012.507. [DOI] [PubMed] [Google Scholar]
- 10.Matter K, Aijaz S, Tsapara A, Balda MS. Mammalian tight junctions in the regulation of epithelial differentiation and proliferation. Curr Opin Cell Biol. 2005;17:453–458. doi: 10.1016/j.ceb.2005.08.003. [DOI] [PubMed] [Google Scholar]
- 11.Niessen CM. Tight junctions/adherens junctions: basic structure and function. J Invest Dermatol. 2007;127:2525–2532. doi: 10.1038/sj.jid.5700865. [DOI] [PubMed] [Google Scholar]
- 12.Anderson JM, van Itallie CM. Physiology and function of the tight junction. Cold Spring Harb Perspect Biol. 2009;1:a002584. doi: 10.1101/cshperspect.a002584. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Van Itallie CM, Anderson JM. Claudins and epithelial paracellular transport. Annu Rev Physiol. 2006;68:403–429. doi: 10.1146/annurev.physiol.68.040104.131404. [DOI] [PubMed] [Google Scholar]
- 14.Itoh K, Kawasaki S, Kawamoto S, Seishima M, Chiba H, Michibata H, Wakimoto K, Imai Y, Minesaki Y, Otsuji M, Okubo K. Identification of differentially expressed genes in psoriasis using expression profiling approaches. Exp Dermatol. 2005;14:667–674. doi: 10.1111/j.0906-6705.2005.00338.x. [DOI] [PubMed] [Google Scholar]
- 15.Peltonen S, Riehokainen J, Pummi K, Peltonen J. Tight junction components occludin, ZO-1, and claudin-1, −4 and −5 in active and healing psoriasis. Br J Dermatol. 2007;156:466–472. doi: 10.1111/j.1365-2133.2006.07642.x. [DOI] [PubMed] [Google Scholar]
- 16.Kirschner N, Poetzl C, von den Driesch P, Wladykowski E, Moll I, Behne MJ, Brandner JM. Alteration of tight junction proteins is an early event in psoriasis: putative involvement of proinflammatory cytokines. Am J Pathol. 2009;175:1095–1106. doi: 10.2353/ajpath.2009.080973. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Niyonsaba F, Ushio H, Nakano N, Ng W, Sayama K, Hashimoto K, Nagaoka I, Okumura K, Ogawa H. Antimicrobial peptides human beta-defensins stimulate epidermal keratinocyte migration, proliferation and production of proinflammatory cytokines and chemokines. J Invest Dermatol. 2007;127:594–604. doi: 10.1038/sj.jid.5700599. [DOI] [PubMed] [Google Scholar]
- 18.Yuki T, Haratake A, Koishikawa H, Morita K, Miyachi Y, Inoue S. Tight junction proteins in keratinocytes: localization and contribution to barrier function. Exp Dermatol. 2007;16:324–330. doi: 10.1111/j.1600-0625.2006.00539.x. [DOI] [PubMed] [Google Scholar]
- 19.Gonzalez-Mariscal L, Tapia R, Chamorro D. Crosstalk of tight junction components with signaling pathways. Biochim Biophys Acta. 2008;1778:729–756. doi: 10.1016/j.bbamem.2007.08.018. [DOI] [PubMed] [Google Scholar]
- 20.Baumer Y, Spindler V, Werthmann RC, Bunemann M, Waschke J. Role of Rac 1 and cAMP in endothelial barrier stabilization and thrombin-induced barrier breakdown. J Cell Physiol. 2009;220:716–726. doi: 10.1002/jcp.21819. [DOI] [PubMed] [Google Scholar]
- 21.Doble BW, Woodgett JR. Gsk-3: tricks of the trade for a multi-tasking kinase. J Cell Sci. 2003;116:1175–1186. doi: 10.1242/jcs.00384. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Severson EA, Kwon M, Hilgarth RS, Parkos CA, Nusrat A. Glycogen synthase kinase 3 (GSK-3) influences epithelial barrier function by regulating occludin, claudin-1 and E-cadherin expression. Biochem Biophys Res Commun. 2010;397:592–597. doi: 10.1016/j.bbrc.2010.05.164. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Kirschner N, Rosenthal R, Gunzel D, Moll I, Brandner JM. Tight junctions and differentiation - a chicken or the egg question? Exp Dermatol. 2012;21:171–175. doi: 10.1111/j.1600-0625.2011.01431.x. [DOI] [PubMed] [Google Scholar]
- 24.Furuse M, Hata M, Furuse K, Yoshida Y, Haratake A, Sugitani Y, Noda T, Kubo A, Tsukita S. Claudin-based tight junctions are crucial for the mammalian epidermal barrier: a lesson from claudin-1-deficient mice. J Cell Biol. 2002;156:1099–1111. doi: 10.1083/jcb.200110122. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Kirschner N, Houdek P, Fromm M, Moll I, Brandner JM. Tight junctions form a barrier in human epidermis. Eur J Cell Biol. 2010;89:839–842. doi: 10.1016/j.ejcb.2010.07.010. [DOI] [PubMed] [Google Scholar]
- 26.Milatz S, Krug SM, Rosenthal R, Gunzel D, Muller D, Schulzke JD, Amasheh S, Fromm M. Claudin-3 acts as a sealing component of the tight junction for ions of either charge and uncharged solutes. Biochim Biophys Acta. 2010;1798:2048–2057. doi: 10.1016/j.bbamem.2010.07.014. [DOI] [PubMed] [Google Scholar]
- 27.Van Itallie CM, Fanning AS, Anderson JM. Reversal of charge selectivity in cation or anion-selective epithelial lines by expression of different claudins. Am J Physiol Renal Physiol. 2003;285:F1078–F1084. doi: 10.1152/ajprenal.00116.2003. [DOI] [PubMed] [Google Scholar]
- 28.Balda MS, Whitney JA, Flores C, Gonzalez S, Cereijido M, Matter K. Functional dissociation of paracellular permeability and transepithelial electrical resistance and disruption of the apical-basolateral intramembrane diffusion barrier by expression of a mutant tight junction membrane protein. J Cell Biol. 1996;134:1031–1049. doi: 10.1083/jcb.134.4.1031. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Van Itallie CM, Fanning AS, Bridges A, Anderson JM. Zo-1 stabilizes the tight junction solute barrier through coupling to the perijunctional cytoskeleton. Mol Biol Cell. 2009;20:3930–3940. doi: 10.1091/mbc.E09-04-0320. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Van Itallie CM, Fanning AS, Holmes J, Anderson JM. Occludin is required for cytokine-induced regulation of tight junction barriers. J Cell Sci. 2010;123:2844–2852. doi: 10.1242/jcs.065581. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Fanning AS, Van Itallie CM, Anderson JM. Zonula occludens-1 and −2 regulate apical cell structure and the zonula adherens cytoskeleton in polarized epithelia. Mol Biol Cell. 2012;23:577–590. doi: 10.1091/mbc.E11-09-0791. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Liu KC, Jacobs DT, Dunn BD, Fanning AS, Cheney RE. Myosin-X functions in polarized epithelial cells. Mol Biol Cell. 2012;23:1675–1687. doi: 10.1091/mbc.E11-04-0358. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Kirschner N, Haftek M, Niessen CM, Behne MJ, Furuse M, Moll I, Brandner JM. CD44 regulates tight-junction assembly and barrier function. J Invest Dermatol. 2011;131:932–943. doi: 10.1038/jid.2010.390. [DOI] [PubMed] [Google Scholar]
- 34.Turksen K, Troy TC. Permeability barrier dysfunction in transgenic mice overexpressing claudin 6. Development. 2002;129:1775–1784. doi: 10.1242/dev.129.7.1775. [DOI] [PubMed] [Google Scholar]
- 35.Helfrich I, Schmitz A, Zigrino P, Michels C, Haase I, le Bivic A, Leitges M, Niessen CM. Role of aPKC isoforms and their binding partners Par3 and Par6 in epidermal barrier formation. J Invest Dermatol. 2007;127:782–791. doi: 10.1038/sj.jid.5700621. [DOI] [PubMed] [Google Scholar]
- 36.Nunbhakdi-Craig V, Machleidt T, Ogris E, Bellotto D, White CL, 3rd, Sontag E. Protein phosphatase 2a associates with and regulates atypical PKC and the epithelial tight junction complex. J Cell Biol. 2002;158:967–978. doi: 10.1083/jcb.200206114. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Stuart RO, Nigam SK. Regulated assembly of tight junctions by protein kinase C. Proc Natl Acad Sci USA. 1995;92:6072–6076. doi: 10.1073/pnas.92.13.6072. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Mertens AE, Rygiel TP, Olivo C, van der Kammen R, Collard JG. The RAC activator Tiam1 controls tight junction biogenesis in keratinocytes through binding to and activation of the par polarity complex. J Cell Biol. 2005;170:1029–1037. doi: 10.1083/jcb.200502129. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Yuki T, Hachiya A, Kusaka A, Sriwiriyanont P, Visscher MO, Morita K, Muto M, Miyachi Y, Sugiyama Y, Inoue S. Characterization of tight junctions and their disruption by UVB in human epidermis and cultured keratinocytes. J Invest Dermatol. 2011;131:744–752. doi: 10.1038/jid.2010.385. [DOI] [PubMed] [Google Scholar]
- 40.Nijhara R, van Hennik PB, Gignac ML, Kruhlak MJ, Hordijk PL, Delon J, Shaw S. Rac1 mediates collapse of microvilli on chemokine-activated T lymphocytes. J Immunol. 2004;173:4985–4993. doi: 10.4049/jimmunol.173.8.4985. [DOI] [PubMed] [Google Scholar]
- 41.Weston C, Gordon C, Teressa G, Hod E, Ren XD, Prives J. Cooperative regulation by Rac and Rho of agrin-induced acetylcholine receptor clustering in muscle cells. J Biol Chem. 2003;278:6450–6455. doi: 10.1074/jbc.M210249200. [DOI] [PubMed] [Google Scholar]
- 42.Persidsky Y, Heilman D, Haorah J, Zelivyanskaya M, Persidsky R, Weber GA, Shimokawa H, Kaibuchi K, Ikezu T. Rho-mediated regulation of tight junctions during monocyte migration across the blood-brain barrier in HIV-1 encephalitis (HIVE) Blood. 2006;107:4770–4780. doi: 10.1182/blood-2005-11-4721. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE. Rac GTPase interacts specifically with phosphatidylinositol 3-kinase. Biochem J. 1996;315((pt 3)):775–779. doi: 10.1042/bj3150775. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Little D, Dean RA, Young KM, McKane SA, Martin LD, Jones SL, Blikslager AT. PI3K signaling is required for prostaglandin-induced mucosal recovery in ischemia-injured porcine ileum. Am J Physiol Gastrointest Liver Physiol. 2003;284:G46–G56. doi: 10.1152/ajpgi.00121.2002. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.