Abstract
The discovery of the genetic roots of various human diseases has motivated the exploration of different exogenous nucleic acids as therapeutic agents to treat these genetic disorders (inherited or acquired). However, the physicochemical properties of nucleic acids render them liable to degradation and also restrict their cellular entrance and gene translation/inhibition at the correct cellular location. Therefore, gene condensation/protection and guided intracellular trafficking are necessary for exogenous nucleic acids to function inside cells. Diversified cationic formulation materials, including natural and synthetic lipids, polymers, and proteins/peptides, have been developed to facilitate the intracellular transportation of exogenous nucleic acids. The chemical properties of different formulation materials determine their special features for nucleic acid delivery, so understanding the property–function correlation of the formulation materials will inspire the development of next-generation gene delivery carriers. Therefore, in this review, we focus on the chemical properties of different types of formulation materials and discuss how these formulation materials function as protectors and cellular pathfinders for nucleic acids, bringing them to their destination by overcoming different cellular barriers.
Keywords: synthetic approach, nucleic acid delivery, intracellular barriers, endosomal escape, nuclear trafficking, synthetic carrier, artificial virus
1. Introduction
The direct association between genetic mutations and various human diseases (such as cancer, HIV, and Alzheimer’s disease) has driven the development of efficient strategies for therapeutic purposes. Exogenous nucleic acids, including DNA and RNA, have been explored as therapeutic agents to treat these genetic disorders. They can either supplement deficient functional proteins through gene augmentation or suppress malfunctioning proteins through gene inhibition. Recent advances in gene therapy have been demonstrated in cancer treatment through (1) chimeric antigen receptor (CAR)-T immunotherapy, which reprograms T-cells with chimeric antigen receptor (CAR)-encoded long plasmid DNA (pDNA); (2) DNA vaccines, which use pDNA-encoded antigens to induce immune responses and activate cytotoxic T cells; (3) CRISPR-Cas9 (Clustered Regularly Interspaced Short Palindromic Repeats) genome editing, which engineers immune cells or corrects cancer-causing mutations with the assistance of enzymes and guide RNA; and (4) RNA-interference, which inhibits the expression of carcinogenic genes or apoptotic-resistant genes with short small interfering RNA (siRNA) [1,2,3,4]. The challenges for gene therapy include the following: (1) Nucleic acids easily degrade through chemical or enzymatic digestion, and (2) the hydrophilic nature and negatively charged chemical properties of nucleic acids restrict their passage through cell membranes. Therefore, the condensation and protection of nucleic acids with appropriate vehicles are required for successful gene therapy.
Viruses, natural pathogens, have evolved to protect and deliver the viral genome into host cells for infection. This inherited property has driven the extensive exploration of viruses as delivery vectors for gene therapy. Adeno-associated virus (AAV) was the first FDA-approved virus-based gene delivery vector for the treatment of a rare inherited retinal disease [5]. However, the potential risks of viruses, including insertional mutagenesis, high immunogenicity, and limited gene capacity [5], drive the development of safe gene delivery vectors. Biocompatible materials, including natural and synthetic lipids, polymers, and proteins/peptides [6,7,8,9,10,11], have been extensively developed for this purpose. Cationic formulation materials efficiently condense the negatively charged nucleic acids in the formulation material matrix through electrostatic interaction, which allows gene protection from enzymatic digestion. On the other hand, these formulation materials also function as cellular pathfinders for nucleic acids and bring them to the correct cellular location [12,13]. For exogenous nucleic acids, there are multiple cellular barriers on the way to their destinations [14], including (1) the negatively charged cell membrane, which prevents the entrance of negatively charged hydrophilic nucleic acids; (2) the endosome/lysosome vesicles, which have the potential to degrade the trapped nucleic acids [15]; (3) stable nucleic acid carriers, which prevent the function of nucleic acids from binding with cellular machineries; (4) viscous cytoplasm, which hampers the movement of DNA towards the nucleus [16]; (5) the nuclear envelope, which stops the entry of DNA into the nucleus [17]. Overcoming these different barriers requires the appropriate and well-orchestrated interaction between nucleic acid delivery carriers and the cellular compartments.
Therefore, understanding the properties of formulation materials and their correlated nucleic acid delivery functions is critical for us to develop applicable vehicles for specific types of exogenous nucleic acids. The recent development of different types of formulation materials and their biomedical applications in gene therapy field have already been systematically reviewed [13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28,29]. However, a parallel comparison of different formulation materials together with an analysis of the correlation of their material property–nucleic acid delivery function has not been conducted yet. Therefore, in this review, we choose well-studied formulation materials as representatives to discuss how the inherited properties of different formulation materials influence the delivery of nucleic acids. We attempt to answer the following questions: (1) How do different types of formulation materials achieve nucleic acid condensation and protection? (2) How do different formulation materials facilitate the cellular internalization of nucleic acids? (3) What is the mechanism used by each type of formulation material to achieve endosomal escape? (4) What are the strategies leading to nucleic acid release from the carriers? (5) How do different formulation materials carry nucleic acids toward the nucleus? (6) What are the strategies used for the active entry of DNA into nucleus? Finally, we summarize the properties of different types of formulation materials and the prospects for the development of next-generation gene delivery vehicles.
2. Natural and Synthetic Formulation Materials-Induced Nucleic Acid Condensation and Protection
Nucleic acids, including long plasmid DNA (pDNA) and messenger RNA (mRNA), and short oligodeoxynucleotide (ODN), microRNA (miRNA), small interfering RNA (siRNA), and small guide RNA (sgRNA), share similar chemical components (e.g., sugar, base, and phosphate groups), which define their hydrophilic and negatively charged nature. Therefore, the condensation of nucleic acids with cationic formulation materials is advantageous to (1) condense macromolecular nucleic acids into nano-sized particles; and (2) protect nucleic acids from degradation. In the following section, we focus on the general properties of different formulation materials (including lipids, polymers, and peptides/proteins), their condensation propensities, and the physical properties of the resulting nucleic acid complexes. The chemical structure of the representative formulation materials is summarized in Figure 1. The complexes with different structures, formulations, and physical properties display different mechanisms of transfection through different cellular internalization pathways, different endosomal escaping mechanisms, and different nuclear entry principles, which will be discussed in Section 3, Section 4, Section 5, Section 6 and Section 7.
Figure 1.
Chemical structure of the representative formulation materials, including (A) lipids, (B) polymers and (C) peptides. Abbreviations: DOTAP: 1,2-dioleoyl-3trimethylammonium-propane; DOPE: dioleoylphosphatidyl ethanolamine; CHEMS: cholesteryl hemisuccinate; DC-cholesterol: 3β-[N-(dimethylaminoethane)carbamoyl] cholesterol; DOSPA: 2,3-dioleyloxy-N-[2(sperminecarboxamido)ethyl]-N,N-dimethyl-1-propanaminium trifluoroacetate; PEG: polyethylene glycol; PEI: polyethylenimine; CPP: cell penetrating peptide; SV40: simian virus 40; NLS: nuclear localization signal; HA2: hemagglutinin 2.
2.1. Lipid-Based Lipoplexes
Lipids are amphiphilic molecules, consisting of hydrophobic tails and hydrophilic heads. According to the charge(s) carried by their head groups, lipids are classified into (1) cationic lipids (DOTAP), (2) neutral lipids (cholesterol, DOPE), (3) anionic lipids (CHEMS), and (4) pH-sensitive lipids (DOSPA) (Figure 1) [30,31]. The mixing of negatively charged nucleic acids with positively charged liposomes leads to the spontaneous formation of lipoplexes [32]. Structural characterization shows a defined lamellar structure (Lac), inverted hexagonal structure, and honeycomb structure (HIc) as thethree main structures of lipoplexes (Figure 2) [33,34,35]. The formation of these structures is driven by the topologies and chemical properties of the lipids, as well as their lipid to nucleic acid ratio, which has been reviewed elsewhere [36,37,38]. Their lipid properties and lipid:DNA ratio also influence the stability and cytotoxicity of the lipoplexes, as well as their size and surface charge [39,40]. Specifically, cationic lipids, the main components of the lipoplexes, have the potential to induce cytotoxicity and particle instability [41,42,43]. Therefore, incorporation of polyethylene glycol (PEG)-lipid conjugate (Figure 1) [44] and the addition of neutral lipids in lipoplex formulations have been frequently employed to decrease cytotoxicity and enhance the stability of the lipoplexes [45,46]. Another strategy to address cytotoxicity issue is to develop pH-sensitive ionizable lipids, which carry no charges in a neutral environment and are cationic at acidic pH. The examples include ionizable DOSPA in lipofectamine (Figure 1) [47] and DLin-MC3-DMA ((6Z,9Z,28Z,31Z)-heptatriaconta-6,9,28,31-tetraen-19-yl-4-(dimethylamino) butanoate) in lipid nanoparticles. The later lipid nanoparticles have already been approved by the FDA with the purpose of siRNA delivery for the treatment of polyneuropathy caused by transthyretin (TTR) amyloidosis [48]. Therefore, the balance of permanently charged, neutral, and ionizable lipid populations is critical to develop biocompatible and stable lipoplexes.
Figure 2.
Condensation of nucleic acids with different formulation materials. These formulation materials include lipids, linear and branched polymers, and peptides/proteins with either natural or synthetic sources. The nucleic acids include pDNA (plasmid DNA), mRNA (messenger RNA), ODN (oligodeoxynucleotide), siRNA (small interfering RNA), and miRNA (microRNA). The complexing products of lipids/nucleic acids lead to lipoplexes with representative lamellar or hexagonal structures. The polymers and nucleic acids complex into polyplexes with polymer chains tangling together without any ordered internal structure. Peptides/proteins interact with nucleic acids to form either disordered polyplexes or ordered artificial viruses with filamentous or spherical morphologies, depending on the primary structure of the peptide/protein.
2.2. Polymer-Based Polyplexes
Different from small molecular lipids, polymers of high molecular weight efficiently condense nucleic acids into stable polyplexes with varied sizes and shapes (Figure 2) [28,49,50]. The most-studied polymers include cationic polymers, such as polyethyleneimine (PEI) (Figure 1) [51], which has been developed as one of the “gold standard” transfection reagents for gene delivery [10,52,53]. Similar to cationic lipoplexes, the positively charged polyplexes tend to induce cytotoxicity. Therefore, conjugation of the neutral moieties with PEI molecules, such as PEG- [54] and cyclodextrin (CD)- [55], has been performed to lower the surface charge and solve the cytotoxicity issue. Polymers of low molecular weight show less of a cytotoxicity problem, but these polymers also compromise the stability of the resulting polyplexes [56,57]. Therefore, to make polyplexes of higher stability and lower cytotoxicity, researchers usually conjugate hydrophobic moieties with polymers. For example, Chiper et al. chemically linked salicylamide with PEI (1.8 kDa) and the resulting PEI–salicylamide conjugate condensed DNA and RNA efficiently [58]. Zhao et al. conjugated stearic acid with PEI (2.0 kDa), which led to stable polyplexes with mRNA [59]. In addition, the polymer-to-nucleic acid charge ratio also influences the stability of the polyplexes. Wu et al. demonstrated that an N/P ratio higher than 6 was required for the formation of stable polyplexes [60]. The polymer topology determines the condensation mechanism [60]. Wu et al. discovered that linear PEI aligned along the DNA backbone to neutralize DNA, leading to DNA condensation, which easily dissociated through anionic dextran exchange [60], while branched PEI tangled with DNA, and the resulting polyplexes had difficulty releasing DNA through polyanionic exchange with dextran.
In addition, biocompatible and biodegradable polymers, such as chitosan (Figure 1) and PLGA (poly(lactic-co-glycolic acid), have been used for nucleic acid delivery. Chitosan is a nature-derived cationic polysaccharide, and condenses nucleic acids efficiently through electrostatic interaction. The ratio of the acetylated to deacetylated amino groups define the water solubility and charge density of chitosan. Highly deacetylated chitosan displayed great siRNA encapsulation and delivery efficiency [61]. In addition, the molecular weight of chitosan also influences the stability of the polyplexes. Polyplexes formed from chitosan of a high molecular weight had very high stability, which limited nucleic acid release inside cells, while chitosan of a low molecular weight (Mw ~16 kDa) allowed efficient nucleic acid release [62]. PLGA is an FDA-approved drug delivery formulation material. However, the neutral property of PLGA results in the encapsulation of nucleic acids in the PLGA matrix, mainly through water/oil/water double emulsion or nanoprecipitation [63]. This preparation process has two potential drawbacks, including that (1) The used organic solvent may degrade nucleic acids and (2) the encapsulation efficiency of nucleic acids is low. Therefore, the addition of cationic components, such as PEI, protamine, and DOTAP [63,64], significantly enhanced the encapsulation efficiency of nucleic acids, which also avoided the degradation of nucleic acids by organic solvents.
2.3. Peptide-Based Polyplexes
Peptides and proteins, a large category of degradable biopolymers, have been extensively explored for their role in nucleic acid delivery. These include cell-penetrating peptides (CPP) and nuclear localization signals (NLSs), which are rich in cationic amino acids (Figure 1). However, both groups of peptides are too short to form stable polyplexes with nucleic acids [65], so the chemical conjugation of CPP and NLS with other hydrophobic moieties has been applied. For example, the conjugation of a lipid alkyl chain with CPP/NLS [66] or a hydrophobic fusion sequence MPG (GALFLGFLGAAGSTMGAWSQPKKKRKV) (derived from HIV protein gp41) with a hydrophilic NLS peptide (KKKRKV derived from the SV40 virus) [67,68] enhanced the stability of the resulting polyplexes. Cross-linking of the short peptides through disulfide bonds is another strategy to develop stable polyplexes. For example, Zhang et al. modified the termini of the peptide with cysteine residues, which formed stable polyplexes through disulfide bonds [69]. These hydrophilic CPP/NLS peptides interact with nucleic acids mainly through electrostatic interaction, leading to polyplex-like nanoparticles without an ordered internal structure (Figure 2). However, some amphipathic peptide strands, such as MPG, condense nucleic acids through both electrostatic interactions (peptide-nucleic acid) and hydrogen-bonding/hydrophobic interactions (peptide-peptide), and the formation of peptide secondary structures contributes to the overall stability of the polyplexes [67].
Poly-L-lysine (PLL) is a frequently studied cationic polypeptide, which shows strong interaction and encapsulation capability with nucleic acids. Modification of PLL with hydrophobic polymer block enhanced the stability of polyplexes and prolonged nucleic acid protection against nucleases [70,71]. Protamine is an arginine-rich protein and has also been extensively exploited to condense nucleic acids [72]. Huang et al. used protamine to condense sperm DNA into compact polyplexes. Many studies also reported the combination of lipids or polymers with protamine to increase the stability of the resulted polyplexes [26,72].
2.4. Nature-Inspired Artificial Viruses
Inspired by viruses [73], virus-like particles (VLPs) of a confined nano-sized structure have been constructed for nucleic acid delivery by assembling the virus capsid proteins with cargo nucleic acids [74,75]. Previous studies reported different VLPs for mRNA [76] and pDNA delivery [77]. However, VLP production is usually required to transfect both the virus coat protein-expression plasmid and the cargo plasmid into the same host cell or bacteria [77,78,79,80]. The in situ expressed virus coat proteins assemble into VLPs, with the cargo pDNA being encapsulated inside the virus capsid. Therefore, there are some limitations to the VLP-based strategy, including that (1) It is tedious and time-consuming to clone the genes, (2) it is hard to control the encapsulation of the cargo gene into VLP inside host cells or bacteria, and (3) the production yield of the effective VLP is relatively low.
Motivated by viruses and VLPs, researchers have developed recombinant protein or synthetic peptide-based artificial viruses (Figure 2). Among these artificial viruses, our group has pioneered the construction of spherical parapoxvirus-like nanococoons by co-assembling a short synthetic peptide K3C6SPD (Figure 1) with pDNA [81]. K3C6SPD contains 16 amino acids, including three functional segments: (1) a positively charged N-terminal oligolysine, (2) a central β-sheet folding segment, and (3) a C-terminal hydrophilic fragment. K3C6SPD self-assembled into nanofibrils, while K3C6SPD co-assembled with pDNA into an artificial virus (called nanococoon), with the ordered peptide β-sheet nanofibrils wrapping the reporter gene inside. This artificial virus effectively protected DNA from enzymatic digestion and transported DNA into cells. Through structure characterization, we proposed the nanococoon formation mechanism: the electrostatic interaction between the peptide and DNA drove the preorganization of peptide strands along the DNA backbone, followed by peptide assembling into nanofibril and nanofibril-nanofibril association, thereby wrapping DNA into nanococoons. We subsequently investigated how the nanofibril–nanofibril association impacted on nanococoon properties and found that the hydrophobicity of amino acid side chains and the length of the β-sheet-forming segment significantly influenced the morphology and stability of the peptide–DNA co-assemblies [82].
Inspired by filamentous tobacco mosaic virus (TMV), several rod-shaped TMV-like artificial viruses have been constructed (Figure 2). For example, Vries et al. designed a simple chimeric coat protein (>400 amino acids) [75], which co-assembled with pDNA or mRNA into filamentous TMV mimics [75,83]. Inspired by the same TMV model virus, Stupp’s group used the α-helical peptide-spermidine hybrid formulation material to encapsulate linear or circular DNA, leading to the formation of the rod-like artificial virus [84]. Currently, the developed peptide/protein-based artificial viruses are mainly used to condense long nucleic acids (e.g., pDNA or mRNA). For short nucleic acids (such as siRNA), different strategies have been developed. For example, Lee et al. preassembled filamentous nanoribbons with a short peptide, which absorbed siRNA on the surface through electrostatic interaction [85].
These synthetic protein/peptide-based artificial viruses are different from natural viruses and VLPs in two aspects: (1) The “capsid” is formed by the recombinant protein or synthetic peptide, instead of by virus coat proteins, and (2) the encapsulation of nucleic acids is easily controlled and scaled up in test tubes. These artificial viruses also have advantages over polymer/lipid-based nucleic acid carriers, including the following: (1) The origin of the synthetic peptide/protein is more biologically relevant to the native protein; (2) the ordered peptide/protein secondary structures stabilize the whole structure, instead of the non-specific hydrophobic interactions within the disordered or bilayer-structured polyplexes and lipoplexes, respectively; (3) the virus-like assembly process ensures the encapsulation of nucleic acids in the core with good gene protection; and (4) the cooperative formation of artificial viruses allows tunable assembly and disassembly. In this category, several requirements should be met for both DNA and RNA condensation: (1) The peptide/protein has the capability to self-assemble into ordered nanostructures, (2) the peptide/protein should contain a positively charged segment, and (3) a hydrophilic end segment is usually required to maintain the stability of the resulting artificial virus.
3. Cellular Internalization of Nucleic Acids
Condensed nucleic acids usually enter into cells through endocytosis. The endocytic pathways are categorized into different groups (e.g., clathrin-mediated endocytosis, caveolae-mediated endocytosis, clathrin- and caveolin- independent endocytosis, and micropinocytosis) based on the type of cytoplasmic proteins involved or the composition of the lipid rafts involved (Figure 3) [86]. Therefore, the resulting vesicles are different in lipid composition and/or the surface-exposed proteins. Since the cellular trafficking process of endocytosed complexes is orchestrated by multiple cytoplasmic proteins exposed on the in situ generated vesicles, the different endocytic pathways may influence the fate of nucleic acids, leading to the following possibilities: (1) Different compositions of the surface proteins on the vesicles control the amount of cargo being recycled back to cell membrane, control the binding affinity of the endosome with the motor protein dynein, and also control the acidification time frame of the endosome from neutral to acidic pH; (2) different physical properties (size, shape) of the vesicles influence the trafficking rate toward the nucleus (see Section 6); (3) the endosome maturation process and microtubule-mediated trafficking rate together regulate the spatial/temporal endosomal escape of the genetic cargo. Therefore, the endocytic pathways of nucleic acid complexes are important for genetic cargo to exert their gene transfection functions. The endocytic pathways depends on the physical properties (size, shape, and surface charge) and chemical properties (formulation material chemical properties and surface ligands) of the complexes, as well as the cell types (Figure 3) [87,88]. The influence of the physical properties of complexes has already been reviewed elsewhere [89,90,91]. Here, we mainly discuss the impact of the chemical properties of different formulation materials on the cellular internalization pathways of the corresponding nucleic acid complexes.
Figure 3.
Cellular internalization pathways of nucleic acid carriers. (A) Summary of the determinants on the endocytic pathways. Cell types and the chemical and physical properties of formulation materials are all influential parameters of endocytic pathways. Endocytic pathways for nano-sized complexes can be classified into clathrin-mediated endocytosis, caveolae-mediated endocytosis, clathrin- and caveolin- independent endocytosis, and micropinocytosis. This can also be classified into lipid raft-dependent endocytosis and lipid raft-independent endocytosis. (B) In a lipoplex delivery system, nucleic acids can directly enter the cytosol by membrane fusion. (C) In a peptide/protein-based polyplex delivery system, a pH-independent fusogenic peptide can destabilize the cell membrane, resulting into direct entrance of nucleic acid into cytosol.
3.1. Cellular Uptake of Lipoplexes
Lipoplexes are composed of unique lipid molecules, which share similar chemical properties with lipids in cell membranes. Therefore, lipids with special properties may promote cellular internalization through direct membrane fusion (Figure 3B) [92]. The example lipid molecules include the inverted cone-shaped DOPE and the rigid aromatic ring-containing cholesterol, which easily fuse with cell membrane. Recent studies have reported the direct fusion of lipoplexes (DOTAP: DOPE: cholesterol 11:2:7) as the main cellular internalization pathway for siRNA delivery into HeLa cells [93]. Lu et al. also observed the direct fusion of the (lipid: DharmaFECT1) lipoplex for siRNA delivery [94]. However, direct fusion only accounts for the internalization of a small population of lipoplexes, while the majority enters into cells through endocytosis. Lipofectamine-based lipoplexes entered into cells through endocytosis, which resulted in much higher efficiency (~45%) than did adenovirus (~10%) [95]. The molecular shape-match between lipids in lipoplexes and the cell membrane determines the endocytic pathways. Specifically, the lipoplexes containing aromatic-ring-containing cholesterol and/or inverted cone-shaped lipids (DOPE) interact with lipid rafts composed of tightly packed sphingolipids and cholesterol; the lipoplexes containing cylinder-like lipids (DOTAP and DOPC (1,2-dioleoyl-sn-glycero-3-phosphocholine)) interact with fluid-phase domains that have an abundance of cylinder-like unsaturated lipids. Caracciolo et al. observed this correlation by comparing the lipid composition-dependent cellular internalization pathways in Fibroblasts NIH 3T3 cells [96]. Therefore, tailoring the surface of lipoplexes into a patchwork-like plasma membrane is a feasible method to tune the endocytic pathways.
3.2. Cellular Uptake of Polymer-Based Polyplexes
The chemical properties of polymers and cell membranes are dramatically different and no direct fusion has been observed for the internalization of polyplexes. They usually enter into cells through endocytosis. They firstly bind with negatively charged glycoproteins such as proteoglycans on the cell membrane; this is followed by the invagination of plasma membrane (Figure 3A). So far, no direct correlation between the properties of polymers on cellular internalization pathways has been established. The most popular strategy to direct endocytic pathways of polyplexes is through surface-modified ligands. For example, folic acid (FL) guides the FL-PEI/pDNA polyplexes to enter into cells through clathrin-independent endocytosis, while transferrin (TF) promotes the cellular internalization of TF-PEI/pDNA polyplexes through clathrin-mediated endocytosis [97]. The length of surface-exposed oligo-arginines also influences the endocytic pathways of polyplexes. Through investigation of 1-, 4- and 8-residue oligo-arginines decorated PEG-PCL (polycaprolactone) nanoparticles (denoted as R1PECL, R4PECL, and R8PECL) [98], we have discovered that non-modified and R1PECL particles entered into cells via clathrin-mediated endocytosis, R4PECL particles via lipid-raft dependent endocytosis, and R8PECL particles via both lipid raft-dependent endocytosis and macropinocytosis. We also demonstrated that the surface ligand density did not influence the endocytic pathways, but did influence the number of internalized polyplexes [98]. In addition, ligand modification has also been applied to enhance the cellular internalization of polyplexes through receptor-mediated endocytosis. For example, the epidermal growth factor receptor-modified polyplexes increased the cellular uptake of the cargo from 20% to 50% [99]; and decoration of CPPs on the polyplexes showed 10-fold cellular uptake improvement [100]. Therefore, for polyplexes, the choice of the surface ligands is very important for the internalization of delivered nucleic acids.
3.3. Cellular Uptake of Peptide-Based Polyplexes and Artificial Viruses
Some peptides, due to their biological potential for adopting α-helical structure, can destabilize cell membranes through membrane insertion. This group of peptides (such as MPG, CADY, and penetratin) has the chance to directly translocate nucleic acid cargoes into cells through membrane destabilization (Figure 3C) [101]. By systematic analysis of the physical and structural properties of these peptides, Divita et al. proposed a cellular uptake model for these polyplexes [102]. MPG/nucleic acid polyplexes bound with proteoglycans on the cell membrane through electrostatic interaction, which activated the intracellular signal. Then, the polyplexes interacted with phospholipids, followed by the peptide insertion into the cell membrane. This process was accompanied by a peptide conformational transition and membrane potential change, which led to the formation of a voltage-dependent pore-like structure, allowing the direct translocation of the polyplexes into the cytoplasm [67,103]. As for peptide-based polyplexes without α-helical peptides, they usually enter into cells through endocytosis. In our laboratory, we have developed a peptide-based virus mimic that contains a β-sheet nanofibril “capsid”. This artificial virus entered into cells via endocytosis [82]. By changing the peptide sequence, spherical peptide/nucleic acid polyplexes switched their morphology to long filamentous-like complexes, which mainly attached on the cell surface with low uptake efficiency (unpublished data). Therefore, the secondary structure and the self-assembled morphology of the peptides are important parameters to determine internalization pathways.
4. Endosomal Escape of Nucleic Acids
4.1. Environmental Changes during the Endosome Maturation Process
Vesicles formed in situ during endocytosis are invaginated in a plasma membrane that encloses nucleic acid complexes. These vesicles produced from different pathways follow a similar endosome-lysosome maturation process, though the time points to join this process may be different [104,105]. This maturation process is induced by several Rab GTPases [106] and the phosphatidylinositols (PIs) in the endosome vesicle bilayer [107]. This endosome maturation process is accompanied by a pH drop from neutral to slightly acidic (in early endosomes, pH6.5 to 6.0; in late endosomes, pH5.5 to 5.0; and in lysosomes, around pH5.0 to 4.5) [104]. Since endosomes and cell membranes have the same lipid components, the complex–endosome interaction during the endosomal escape process shares a similar mechanism with that of the complex–cell membrane interaction during the internalization process. The difference is the environmental pH for both processes (acidic for endosomal escape vs. neutral for cellular internalization). Most synthetic nucleic acid complexes enter into cells through endocytosis and end up in lysosomes for enzymatic digestion. Therefore, the endosomal escape of nucleic acids is critical to enhance their active population and the overall gene transfection/inhibition efficiency. Different endosomal escaping mechanisms, including pH-triggered membrane disruption, pore formation, and fusion with the endosomal membrane, are discussed and summarized (Figure 4) based on the chemical properties of different formulation materials.
Figure 4.
Summary of the formulation material property-dependent endosomal escaping mechanisms. (A) In a lipoplex delivery system, nucleic acids escape from the endosome via lipid mixing. One widely accepted model, the pore formation via flip-flop of the endosome membrane, is described in the bottom zoom-in picture. (B) In a polyplex delivery system, the endosomal escape of nucleic acids is through membrane destabilization by polyplexes or free polymers. (C) In a peptide/protein-based delivery system, the endosomal escape of nucleic acids happens via different mechanisms, including membrane destabilization and pore formation. (D) Endosomes containing lipoplexes, polyplexes or peptide/protein polyplexes with buffering capability swell through the protonation of secondary or tertiary amines, followed by the influx of the counter ions and water. The swollen endosome promotes efficient endosomal escape of genetic cargoes through lipid-mediated slow release or polymer-mediated fast squirting of nucleic acids into cytosol, respectively.
4.2. Lipid-Mediated Endosomal Escape
Since the endosome and cell membrane share the same lipid components, a similar membrane fusion hypothesis is applied to the lipid-mediated endosomal escape of lipoplexes (Figure 4A) [108]. As we discussed in Section 3, the special molecular properties of DOPE and cholesterol also allow the endosomal escape of the cargoes through direct fusion with endosome membranes. Therefore, fusogenic lipid DOPE has been extensively exploited in lipoplex formulation [109], and also in polyplex formulations (PEI/siRNA) to facilitate endosomal escape [110]. Similarly, lipoplex formulations containing cholesterol (DC-cholesterol/DOPE/DNA) showed successful endosomal escape, whereas the control one (DOTAP/DOPC/DNA) without cholesterol was trapped [111]. In addition, the structure of lipid tails influences their endosomal escaping capability. Various approaches (including shortening the lipid tail, altering the symmetry of the tail, switching the linear tail to a branched tail, or decreasing the saturation degree of the tail) have been developed to promote endosomal escape by either decreasing the transient temperature or enhancing the fluidity of the bilayers and lipid mixing capacity [41].
The pH-sensitive lipids that contain amino groups with pKa 5 to 6 facilitated endosomal escape through a sponge effect (Figure 4D) [31]. The pH-sensitive lipids are protonated upon an environmental change from a neutral to acidic pH, which is accompanied by an influx of counter ions and water. This process leads to an increase of osmotic pressure, which promotes endosomal escape of the lipoplexes through membrane destabilization. Jayaraman et al. discovered that the lipoplexes containing a pH-sensitive lipid enhanced the endosomal escape of the cargoes [112]. Lipofectamine, a “gold standard” representative of lipoplexes, contains the pH-sensitive lipid DOSPA. DOSPA carries primary, secondary, and tertiary amines, and the secondary amine shows the proton sponge effect, which enhances the endosomal escape efficiency of lipoplexes [47].
4.3. Polymer-Mediated Endosomal Escape
The polyplexes containing secondary amino groups (such as the ones in PEI and poly(amidoamine)) are generally believed to escape from the endosome through a combination of the sponge effect and umbrella effect (Figure 4B,D) [51]. PEI has two forms, including linear PEI (lPEI) and branched PEI (bPEI) (Figure 1). Linear PEI, which contains secondary amino groups, has contributed significantly to another “gold standard” in the field of nucleic acid delivery. It absorbs protons efficiently in the endosome during the endosome maturation process [113], which is accompanied by an increase in osmotic pressure inside the endosome due to the influx of the counter ions and water [47,114]. At the same time, charge repulsion between the protonated amines causes the expansion of PEI polyplexes; this is known as the umbrella effect [114,115]. The loose PEI polyplexes interact and destabilize the endosome membrane, promoting endosomal escape of polyplexes. Recent live cell imaging studies demonstrated that local membrane destabilization or local pore formation was the sponge effect-mediated endosomal escape of polyplexes. Live cell confocal microscope imaging showed that the polyplexes ejected nucleic acids into cytosol from particular regions of the endosome [116]. Therefore, the endosomal escaping capability of polyplexes depends on the overall effect of the increase in osmotic pressure induced by protonated polymers and the membrane destabilization caused by polymer-membrane interaction. Polyplexes enter into cells via diverse pathways, followed by different acidification rates. This might explain why polyplexes based on the same formulation material display different endosomal escaping capabilities and gene transfection efficiencies in different cell lines.
4.4. Peptide-Mediated Endosomal Escape
Short peptides promote the endosomal escape of nucleic acids through different mechanisms, including the sponge effect, the fusogenic effect, and pH-sensitive membrane disruption (Figure 4C,D). These peptides enhance the endosomal escape of the corresponding complexes when they function either as nucleic acid complexation formulation material or as the surface ligands of lipoplexes and polyplexes. Histidine (pKa of 6.0)-containing peptides show a proton-buffering capacity, which enhances endosomal escape through the sponge effect (Figure 4D) [117,118]. By conjugating histidine with chitosan through cleavable disulfide bonds, Kai et al. developed histidine-modified chitosan/pDNA polyplexes with enhanced endosomal escape [119]. Fusogenic peptides containing pH-sensitive amino acids (such as Glu (E) and His (H)) show a conformation switch from random-coil to the α-helix upon a pH drop in the endosome [120]. The α-helical peptides interact and destabilize the endosome membrane, achieving endosomal escape of nucleic acids [121]. One of the representative fusogenic peptides is HA2 (GLFGAIAGFIENGWEGMIDGWYG) (Figure 1), which is derived from the hemagglutinin of the influenza virus. Inspired by HA2, several mutations and fusogenic peptides have been developed, including INF7 (GLFEAIEGFIENGWEGMIWDYG), E5 (GLFEAIAEFIEGGWEGLIEG) and GALA (WEAALAEALAEALAEHLAEALAEALEALAA) [122,123,124]. GALA has been extensively applied to different nucleic acid delivery systems to facilitate endosomal escape, such as polymer systems [125] and lipid systems [126]. Some membrane-disruptive peptides, being deactivated through side-chain protection with pH-sensitive groups, can be reactivated under conditions of low pH. For example, carboxydimethylmaleic (CDM)-modified melittin showed minimal cell membrane disruption capability, while the cleavage of CDM in an acidic environment in the endosome restored the membrane-penetrating activity of melittin, enhancing its endosomal escape efficiency (Figure 4C) [127].
5. Nucleic Acid Release from the Carriers
After endosomal escape, the nucleic acids (such as mRNA and siRNA) that function in cytoplasm should be released from the carriers in order to augment or inhibit protein translation by binding with cytoplasmic machinery. However, the nucleic acids (such as pDNA) that function in the nucleus should be further protected before they reach or enter the nucleus [128]. Nucleic acid release is reversible by the condensation process (Figure 5), so the capability of nucleic acid released from different carriers is determined by the chemical and physical properties of different formulation materials.
Figure 5.
Balance of the stability of polyplexes and nucleic acid release by varying formulation material properties—specifically, elongation of the polymer chain length, enhancement of the hydrophobicity, and decrease of the charge density of the molecules will enhance the complex stability but lower the chances of nucleic acid release. Otherwise, the nucleic acids are easily released, but the stability of the complexes is compromised.
As we discussed in Section 4, lipids in lipoplexes interact with lipids in the endosome membrane. This causes membrane fusion or membrane disruption. This process allows endosomal escape as well as nucleic acid release from lipoplexes. Immediate spreading of siRNA from the endosome into the whole cytoplasm was observed in live cell imaging of lipoplex delivery systems [129,130]. Therefore, lipoplexes are particularly suitable to deliver nucleic acids, which function in cytoplasm.
Polyplexes are much more stable than lipoplexes, due to their long polymer chains. Moreover, polyplexes usually escape from the endosome through the interaction between the endosome membrane and part of the polymer chain, which allows the intact polyplexes to get into the cytoplasm. Early studies have indicated that nucleic acids are usually released from these polyplexes through anionic exchange with the genomic DNA [131] and RNA [132]. However, the efficiency of nucleic acid release from the carriers is uncontrollable if the release merely counts on the polyanionic exchange with endogenous biopolymers. Therefore, different strategies have been studied to regulate cellular nucleic acid release, which can be achieved by fine-tuning the charge density and chain length (Figure 5) [128].
Polymer charge density influences the binding intensity of polymer and nucleic acids. For example, partial covering of the positive charges (the secondary (23%) and primary (43%) amines) of branched PEI (25kDa) by acylation improved the dissociation ability of nucleic acids from the polyplexes [133,134]. Introduction of the negatively charged carboxylic acid groups on the side chain of linear PEI led to the enhancement of DNA release from polyplexes [135]. Polymer length or molecular weight also controls nucleic acid release. Polymers of low molecular weight show easier nucleic acid release [136], while longer polymers hamper nucleic acid release through stronger interactions with nucleic acids and/or the formation of a knot-like structure with nucleic acids [137]. Therefore, the intracellular glutathione (GSH)-triggered polymer chain length decrease has been frequently used to achieve nucleic acid release [138]. Degradable redox-responsive polymer cysteine-based poly(disulfide amide) (PDSA) realized a rapid GSH-triggered gene release [139]. Therefore, the responsive nucleic acids release from polyplexes adds value to nucleic acids delivery with polymeric formulation materials.
6. Nuclear Trafficking of DNA
6.1. Challenges of Free DNA in Cytoplasm
Viscous cytoplasm presents a major challenge for DNA to move toward the nucleus. The diffusion of DNA larger than 2 kbp in cytoplasm is highly restricted [140]. Previous studies have demonstrated that it is much harder for naked plasmids in cytoplasm to be expressed than those injected into the nucleus [141]. Therefore, intracellular trafficking towards the nucleus is critical for DNA to accumulate in the perinuclear area. Enzymatic digestion is another challenge for free DNA in cytoplasm. Previous studies have shown that a microinjection of naked DNA into cytoplasm led to no DNA transfection, while the injected PEI-polyplexes containing the same amount of DNA showed a high degree of transfection [12]. Free DNA released from the carriers is easily digested by cytoplasmic enzymes [142], so further protection during the nuclear trafficking process is required from the synthetic carriers. Through PCR (polymerase chain reaction) and electron microscopy analysis, it was discovered that of about 2000 to 100,000 plasmid copies delivered into cytoplasm by polyplexes and lipoplexes, only 1% to 10% of these plasmid copies were delivered into the nucleus [143]. Therefore, nuclear trafficking and nuclear entry are believed to be rate-limiting steps for efficient gene delivery and transfection. In the past 20 years, enormous efforts have been put into elucidating mechanisms for the nuclear trafficking and nuclear import of plasmid, which are important for us to develop efficient strategies for DNA delivery.
6.2. Vesicle and Ligand-Guided Active Nuclear Trafficking of DNA
Lipoplexes without ligand modification showed directed trafficking toward the nucleus along microtubules. With three-dimensional (3D) Single-Particle Tracking (SPT) techniques, Caracciolo et al. observed the directed motion of lipoplexes (DOTAP/DOPC/DC-Cholesterol/DOPE/pDNA)) inside cytoplasm [13]. This is consistent with the observations by Ondrej et al. and Sauer et al. that lipoplexes bound to, and moved along, microtubules [144,145]. By investigating the mechanical dynamics of DNA lipoplexes in live cells through bio-imaging approaches [146], Jones et al. discovered that the motion rate of lipoplexes within cytoplasm was cellular location-dependent, but cargo (DNA) size-independent (21 bp to 5.5 kbp). In these studies, endocytosed vesicles (such as endosome) enclosing lipoplexes accounted for the directed nuclear trafficking (Figure 6) [147].
Figure 6.
Nuclear trafficking pathways. For the complexes without dynein-binding ligand modification, the directed trafficking toward the nucleus occurs through vesicle mediation. Once the complexes are released from the endosome, they will either be stuck or diffuse within a limited space. For the complexes modified with dynein-binding peptides, the directed trafficking is mediated by vesicles and dynein-binding peptides. Accumulation around the nucleus will be achieved.
In later studies, Caracciolo et al. compared lipofectamine-based lipoplexes with high transfection capabilities (high-lipoplexes) to a control (DOTAP/DOPC/DNA) with low transfection efficiency (control) through a combination of live cell imaging, single-particle tracking microscopy, and quantitative transfection-efficiency assays [148]. They observed that the control moved mainly through active trafficking along microtubules, whereas the high-lipoplexes mainly trafficked towards the nucleus (64.3%) through random Brownian diffusion. The different motion of the high-lipoplexes and the control may be attributed to their different endosomal escaping capabilities and time frames of escape. The control being trapped inside the endosome/lysosome may explain why it shows low transfection efficiency.
For the intracellular trafficking of PEI polyplexes, influenza virus-like three-phase processes were observed, including 1) slow drift movement, followed by 2) confined diffusion with increased velocity, and finally 3) fast active movement along the microtubule [99]. Using the Multiple Particle Tracking (MPT) technique, Suh et al. observed the microtubule-directed active transportation of PEI polyplexes to the perinuclear area in COS-7 cells [149]. Through Raster Image Correlation Spectroscopy (RICS) and image-Means Square Displacement (iMSD) analysis, Jones et al. observed a similar population of PEI polyplexes with active and non-active motion.
The directed motion and random diffusion of both lipoplexes and polyplexes in cytoplasm was observed with the single particle trafficking technique. A reasonable explanation is that the directed motion observed for the bare lipoplexes and polyplexes may be attributed to vesicular transport and the random diffusion is for the particles that escaped from the endosome (Figure 6) [150,151]. Confocal images showed that more than 90% of lipoplexes and polyplexes had directed motion when they co-localized with the lysosome. Once they escaped from the lysosome, the directed motion switched to random diffusion in cytoplasm. Therefore, the timing of endosomal escape is critical for the perinuclear accumulation of polyplexes and lipoplexes, leading to different degrees of transgene expression.
Since active trafficking along microtubules is mainly mediated by intracellular vesicles, the different vesicles generated through different internalization pathways significantly influence the transportation rate. Specifically, the vesicles generated through the clathrin-mediated pathway showed directed motion with an average velocity of 0.7 μm/s [152]. A similar velocity value (0.65 μm/s) was observed for PEI polyplexes in HuH-7 cells [150]. The velocity of ~0.13 μm/s was observed for polymeric nanoparticles internalized through a clathrin- and caveolae-independent pathway. Micropinocytozed R8-modified lipoplexes showed a slower transportation rate of 0.21 ± 0.19 μm/s [151]. In addition, PEG-PLL polyplexes, internalized through a caveolae-dependent pathway, had a directed trafficking rate between 0.09 and 0.11 μm/s [153]. This vesicle type-dependent movement may be attributed to their surface-exposed proteins, which have a different binding affinity with the motor protein, dynein. However, the different cell lines used in these studies may affect the formation of vesicles and the adaptor proteins displayed on these vesicles, which significantly influences vesicle-mediated trafficking. In these studies, the final destination of different polyplexes/lipoplexes was not defined, so it will be meaningful to systematically study and correlate the type of polyplexes/lipoplexes with their cellular internalization pathway, intracellular trafficking rate, and final destination.
Microtubule-mediated active trafficking of cellular vesicles (such as endosomes), as well as viruses (such as adenovirus and herpes simplex virus) inspires the investigation of peptide ligand-mediated active nuclear trafficking [154,155,156]. For example, decoration of dynein light chain (LC8)-associated peptides on lipoplexes/polyplexes mimics the active trafficking of viruses (Figure 6). Specifically, CPP octa-arginine (R8) and African swine fever virus protein p54-derived dynein interaction peptide-modified lipoplexes achieved directed trafficking independent of endosome vesicles, while the control lipoplexes without a dynein-binding protein only showed directed trafficking in the presence of endosome vesicles [157].
7. Nuclear Entry of DNA
7.1. Passive and Active Nuclear Accumulation of DNA
For DNA delivery, the nuclear membrane is one of the subcellular barriers that significantly impacts the overall gene transfection efficiency. The nuclear pore complex (NPC) is a large protein complex that forms nuclear pores on the nuclear envelope, allowing the import and export of macromolecules. Molecules of a size smaller than 9 nm freely diffuse into/out of the nucleus, while molecules with a size range of 9 nm to 39 nm require a signal-mediated process for nuclear entry [17]. The nuclear entry of long pDNA through NPC is restricted and passive entry is believed to be the primary pathway [158]. In another words, the breakdown of the nuclear envelope during mitosis allows the entry of any DNA that is near the nucleus (Figure 7). This may explain why many growth-arrested cells (such as primary cells and neurons) are difficult to be transfected [159].
Figure 7.
Two different nuclear entry strategies: passive vs active pathways. For dividing cells, all the nucleic acid complexes near the nucleus have a chance to enter into the nucleus during mitosis. However, for non-dividing cells, active docking on the nuclear pore complex (NPC) through an importin pathway is required. In case A, complexes modified with a nuclear localized signal (NLS) peptide can bind with importin β through importin α or directly, and importin β will drive the docking on NPC. In case B, the plasmid with DTS (DNA-nuclear targeting sequence) can specifically bind with an endogenous NLS-containing protein (such as transcription factors) that will bind with importin β and lead to active docking on NPC. As for the following step of nuclear entry of DNA or nuclear entry of an intact complex, its mechanism remains to be addressed. Reproduced with permission from spring nature [165].
Lipoplexes and polyplexes did show a certain degree of transfection in non-dividing cells [160]. For these cases, it is generally believed that lipoplexes and polyplexes promote nuclear entry through fusion with the nuclear envelope [161] or permeation into the nuclear membrane [162], respectively. Szoka et al. investigated the nuclear entry of lipoplexes and polyplexes with the commercial model reagents lipofectamine and PEI. Through standardized quantitative PCR assay, they discovered that lipoplexes and polyplexes delivered similar amount of plasmids from extracellular media into the nucleus [143]. With confocal laser microscopy, Harashima et al. observed the fast nuclear localization of DNA by lipoplexes within 0.5 to 1 hr [161]. They quantified the intracellular distribution of DNA and observed that of the total cellular internalized DNA, 13.5% was accumulated inside the nucleus within one hour. The intact PEI/DNA polyplexes were observed in the nucleus [163]. Through intracellular trafficking of fluorophore-labeled PEI/DNA polyplexes, Mikos’s group discovered that most of the polyplexes were trapped inside the endosome right after endocytosis and accumulated in the nucleus after four hours [164]. They speculated that the positively charged PEI interacted with negatively charged lipids, and these bound lipids facilitated the nuclear entry of PEI/DNA polyplexes. The exact mechanism remains to be explored.
7.2. NLS-Mediated Active Nuclear Entry of DNA
Nuclear localization signals (NLSs) are a group of basic residue-rich short peptides which mediate active nuclear entry of protein and DNA. One of the well-studied NLSs is PKKKRKV (Figure 1), derived from virus SV40 large T-antigen. NLS-mediated nuclear entry is through the importin pathway (Figure 7) and includes the following steps: (1) NLS directly binds with importin β or through the adaptor protein importin α; (2) importin β guides the docking of the NLS-importin complex on NPC, leading to nuclear entry through an unknown mechanism [165,166]. In mammalian cells, there are 6 importin α and 20 importin β protein isoforms. The combination of these importins facilitates the translocation of different cytoplasmic cargoes into the nucleus.
Based on the mechanism of the importin pathway for nuclear entry, the introduction of NLS to the complex allows DNA to be recognized by importin. Therefore, the short NLSs derived from different proteins have been explored for nuclear entry through (1) non-covalent electrostatic interaction with DNA and (2) covalent conjugation with delivery formulation materials, such as polymers and lipids. For example, SV40 NLS-conjugated lipoplexes showed a threefold increase of nuclear accumulation [167] and enhanced the transgene expression ten- to eleven-fold [168]. The conjugation of NLS to PEI/cyclodextrin/DNA polyplexes led to enhancement of transgene expression in both dividing and non-dividing cells [169]. Through confocal imaging, Chu et al. observed that NLS-polyplexes entered into the nucleus in six hours, while the control polyplexes only accumulated in the perinuclear region in the cytoplasm [169]. This data demonstrates the role of NLS for nuclear delivery and is consistent with the enhancement of gene transfection [158].
The binding of NLS with importin requires the exposure of NLS on the surface, so the nuclear delivery efficiency of NLS/DNA complexes depends on the number of NLS exposed on the complex surface. If NLS is used as the DNA condensation agent, the complexation with DNA may bury an NLS with a low importin-binding capability. In previous studies, the addition of NLS did show improved gene transfection, but it is not clear whether the improvement of gene transfection resulted from the enhancement of nuclear entry, since nuclear entry has seldom been directly characterized. Therefore, in future studies, it will be necessary to define the increase of the amount of DNA entering into the nucleus after the addition of NLS. Such quantified studies can assess the capability of NLS to facilitate the nuclear entry of DNA.
Besides the short NLSs, endogenous proteins (such as transcription factors and histone proteins) contain an NLS functional segment. These proteins specifically recognize nucleic acids containing a special DNA nuclear targeting sequence (DTS) and facilitate active nuclear entry through an importin pathway (Figure 7) [170]. For example, a short DTS of 72 bp, derived from SV40 plasmid and bound with NLS-containing transcription factors, mediated quick nuclear entry of the plasmid. Besides DTS, the plasmid-containing necrosis factor-α NF-κB-binding nucleic acid sequence could actively enter into the nucleus [163]. The proteomics study identified several NLS-containing proteins, including histone H2B, a ubiquitous nucleoside diphosphate kinase (NM23-H2), and the homeobox transcription factor, Chx10 [171]. Therefore, conjugation of NLS on the delivery vehicles and/or addition of an NLS-binding nucleic acid segment into the plasmid are two strategies to promote active docking on the nuclear pore complex.
7.3. Other Strategy-Facilitated Nuclear Entry of DNA
Besides the importin pathway, the cell surface nucleolin, a ubiquitous eukaryotic protein, shuttled polyplexes from the cell membrane to the nucleus in an endocytosis-independent manner [172]. Davis et al. discovered that the PEG-PLL/DNA polyplexes directly bound with the cell surface receptor nucleolin and traveled together towards the nucleus. Their later studies demonstrated that these polyplexes entered into cells through lipid raft-mediated entry [173]. In addition, manipulation of the nuclear complex pore size through receptor interaction is able to facilitate nuclear entry of polyplexes. Fan et al. discovered that cytoplasmic glucocorticoid receptor-specific ligand-modified hyaluronic acid/PEI/dexamethasome/DNA polyplexes enhanced nuclear entry [174] through a ligand-receptor-mediated nuclear pore size increase (up to 300 nm) [175].
8. Summary and Prospects
Natural and synthetic formulation materials play significant roles in facilitating exogenous nucleic acids to function inside cells. Lipids, polymers, and peptides are the most extensively studied formulation materials. The charge attraction and hydrophobic interaction between these formulation materials and nucleic acids efficiently condenses the macromolecular nucleic acids into nano-sized particles, with nucleic acids being protected within the formulation material matrix. Three kinds of formulation materials have distinct condensation propensities for nucleic acids, resulting in lipoplexes, polyplexes, and peptide-based polyplexes/artificial viruses. These various properties induce different intracellular trafficking routes and cellular fates of nucleic acids. Understanding how the properties of different formulation materials contribute to this process can guide us to develop safe and efficient carriers for gene therapy in the future. Though a direct correlation has not been established from individual studies, we summarize the extensive studies of well-studied formulation materials in this review and draw some links between the properties of the formulation materials and their function for intracellular nucleic acid delivery (Table 1) in order to inspire next-generation gene delivery systems.
Table 1.
Summary of the representative studies discussed in this review.
| Formulation Material | Experimental Nucleic Acids | Experimental Cell Type | Size (nm) | Surface Charge (mV) | Ref. |
|---|---|---|---|---|---|
| Lipid | |||||
| DOTAP/DOPE/cholesterol | siRNA | BSC-40; 293FT; HeLa cells |
100–200 | N/A | [92] |
| DOTAP/DOPE/cholesterol; PEI |
siRNA | HeLa cells | 468 ± 19; 209 ± 17 |
N/A | [93] |
| DC-Cholesterol/DOPE | pDNA: luciferase | CHO cells | 60–70 | 58.4–64.7 | [94] |
| DC-cholesterol/DOPE;DOPC/DOTAP; DC-cholesterol/DOPE/DOTAP/DOPC |
pDNA: luciferase | NIH 3T3 cells | 180 ± 2; 234 ± 4; 205 ± 2 |
48.3 ± 1.2; 43.3 ± 1.5; 46.7 ± 1.2 |
[96] |
| Lipofectamine Plus | pDNA: luciferase | A549 cells | N/A | N/A | [95] |
| Polymer | |||||
| PEI (disulfide cross-linked) | pDNA: luciferase | HEK293 T; HeLa cells |
~200 | ~20 | [52] |
| POCG-PEG-PEI polymer | DNA; siRNA; miRNA |
MCF-7; C2C12 |
151; 172; 245 | ~30 | [54] |
| MPC/Ad-SS-PEG | pDNA: GFP | Hep G2 cells; HeLa cells; SKOV-3 cells; PC-3 cells |
100–200 | 0.5–5 | [55] |
| PEG-PEI (1.8 kDa) (PEI amines are modified with aromatic rings) |
pDNA: luciferase mRNA: luciferase siRNA: anti-luciferase |
HeLa cells; U87 cells |
180–240 | N/A | [58] |
| PEI-stearic acid copolymer | mRNA: ACRA mRNA: HIV-1 gag antigen | DC 2.4 cells | 117.77 ± 3.894 | N/A | [59] |
| Folic acid-PEI; transferrin-PEI |
pDNA: luciferase | HeLa cells | N/A | N/A | [97] |
| mPEG-PCL; R-PEG-PCL; RRRR-PEG-PCL; RRRRRRRR-PEG-PCL |
N/A | HeLa cells | 80–110 | 20–40 | [98] |
| EGF-PEG-PEI | DNA | HuH7 cells | 266 ± 26 | N/A | [99] |
| Peptide/protein | |||||
| RALA (WEARLARALARALARHLARALARALRACEA) | mRNA: GFP mRNA: ovalbumin |
DC2.4 cells | 89(N/P 5); 91(N/P 10) |
14.6(N/P 5); 26.3(N/P 10) |
[65] |
| MPG-8-cholesterol (MPG-8: β-AFLGWLGAWGTMGWSPKKKRK-Cya) |
siRNA: Cyc-B1 | HS68; HeLa; PC-3; MCF-7; SCK3-Her2 cells |
120 ± 50 | 16 ± 3 | [68] |
| (CRR)2KRRC and (CHH)2KHHC cross-linked peptide | pDNA: p53 | NIH3T3 cells; HeLa cells |
~164; ~172 |
~30; ~20 |
[69] |
| Virus-like particle (VLP) (Vesicular stomatitis virus and Archeoglobus fulgidus-based) |
mRNA: GFP | HEK293T cells; THP-1 cells; Human iPS cells |
N/A | N/A | [76] |
| VLP (neurotropic JC polyomavirus: JCPyV)) |
pDNA: suicide gene (HSV-TK) | U87-MG cells | N/A | N/A | [77] |
| VLP (JCPyV)) |
pDNA: suicide gene (HSV-TK) | Toledo and HT cells; SU-DHL-2 cells |
N/A | N/A | [78] |
| VLP (JCPyV)) |
pDNA: suicide gene (pSPB-tk) | A549 cell; H460 cell |
N/A | N/A | [79] |
| VLP (JCPyV)) |
pDNA: suicide gene, (HSV-TK) | COLO-320 HSR cell | N/A | N/A | [80] |
| Self-assembled peptide: K3C6SPD (KKKC6-WLVFFAQQ-GSPD) | pDNA: GFP | Hek293 cells | ~70 | 25 | [81,82] |
| K12-(GAGAGAGQ)10-407-amino-acid hydrophilic random coil | mRNA: GFP and luciferase; pDNA: YFP |
Hek293 cells; HeLa cells |
~150 (average length) | -5 | [75,83] |
| Spermine-Coiled-coil peptide-PEG (Coiled coil peptide: REGVAKALRAVANALHYNASALEEVADALQKVKM) |
N/A | N/A | N/A | N/A | [84] |
| Glucose-GSGSGSKKKKKKKKGGSGGSWKWEWKWEWKWEWG | siRNA: GFP | HeLa cells | ~70 | ~0 | [85] |
| CPP-based polyplexes shelled with polysaccharide (CPP: RRRRRRRR) |
pDNA: luciferase | HEK293 T; Cos7 cells |
Able to be modified | Able to be modified | [100] |
Abbreviations: DOTAP: 1,2-dioleoyl-3trimethylammonium-propane; DOPE: dioleoylphosphatidyl ethanolamine; DC-cholesterol: 3β-[N-(dimethylaminoethane)carbamoyl] cholesterol; DOPC: 1,2-Dioleoyl-sn-Glycero-3-Phosphocholine; POCG-PEI: poly(1,8-octanedio-citric acid)-co-polyethylene glycol grafted with polyethyleneimine; PEG: polyethylene glycol; PEI: polyethylenimine; MPC: β-cyclodextrin-cross-linked low molecular PEI conjugated with MC11 peptide (MQLPLATGGGC); Ad-SS-PEG: PEG and adamantyl group linked by a disulfide bond; mPEG-PCL: methoxypoly(ethylene glycol)–poly(caprolactone); EGF: epidermal growth factor; VLP: virus-like particle; JCPyV: neurotropic JC polyomavirus; GFP: green fluorescence protein; YFP: yellow fluorescence protein; HSV-TK: herpes simplex virus thymidine kinase type 1 gene; ARCA: anti-reverse cap analogue; Cyc-B1: cyclin B1; CHO cells: Chinese hamster ovary cell line; SKOV-3 cells: ovarian cancer cell line; PC3 cells: human prostate cancer cell line; U87 cells: human primary glioblastoma cell line; DC 2.4 cells: mouse dendritic cells; HuH7 cells: hepatocyte-derived carcinoma cell line; THP-1: human monocytic cell line; iPS cells: induced pluripotent stem cells; U-87 MG: uppsala 87 malignant glioma; DLBCL: diffuse large B-cell lymphoma; ABC-like DLBCL: activated B-cell-like diffuse large B-cell lymphoma; MCF-7: Michigan Cancer Foundation-7 (breast cancer cell); COS-7 cells: monkey kidney fibroblast-like cell; HEK293 cells: human embryonic kidney 293 cells; BSC-40: continuous line of African green monkey cells derived from BSC-1 cells (kidney cells); NIH 3T3 cells: mouse embryonic fibroblast cells; A549 cells: adenocarcinomic human alveolar basal epithelial cells. COLO-320 HSR: Human colon carcinoma cells.
Lipids are small molecules that share similar chemical structures as molecules in the cellular/subcellular membrane. This unique chemical property allows lipids to facilitate delivery of nucleic acids through interacting/fusing with plasma, with the endosome and/or with the nuclear membrane. However, their small molecular structure compromises the stability of the resulting lipoplexes. The low stability of these lipoplexes and their interaction with plasma or endosome membrane allow nucleic acids to easily be released from lipoplexes during cellular entry or endosomal escape processes. This is advantageous for the delivery of nucleic acids that function in cytoplasm. However, the ease of nucleic acid release compromises the gene protection for the delivery of nucleic acids, which function in the nucleus. Polymers, due to their high molecular weight, form stable polyplexes. However, the macromolecular structure of polymers makes it difficult for them to interact with lipid membranes (including the plasma, endosome, and nuclear membranes), so protonation of amino groups is critical to induce endosomal escape through the sponge effect and membrane destabilization. Moreover, the high stability of polyplexes poses a challenge for intracellular cargo release from the carriers. Therefore, a responsive molecular property switch (such as pH-triggered or redox-triggered polymer chain length shortening or the polymer chain charge balance change) allows the smart control of nucleic acid release from polyplex delivery systems. For the nuclear delivery of DNA, nuclear trafficking and nuclear entry are big challenges for both lipoplexes and polyplexes. However, peptides are biopolymers, and their biological origin renders them different from synthetic polymers and lipids, including (1) the formation of artificial viruses with an ordered “capsid”-like structure, (2) facilitating endosomal escape, and (3) directing nuclear trafficking and nuclear entry.
Given the diversity of viruses (including both naked viruses and enveloped ones), a combination of different formulation materials is one promising approach to develop multifunctional artificial viruses (Figure 8). Many short functional peptides have already been identified from viruses and endogenous proteins, which gives us the opportunity to improve the functions of synthetic artificial viruses. To develop safe and efficient gene delivery carriers is vital for gene therapy. Currently, there is still a big gap between translational studies and the clinical applications of different nucleic acid delivery vectors. Understanding the correlation between the properties of different formulation materials and their nucleic acid delivery capabilities paves the way for next-generation gene delivery vehicles.
Figure 8.
Summary of the formulation material-based nucleic acid delivery to the nucleus. Seven steps are listed from nucleic acid condensation to nuclear entry. The ideal carriers are proposed, which include dynein-binding peptides for directed nuclear trafficking and NLS-modification for nuclear pore complex docking through an importin pathway, as well as the efficient “capsid” uncoating and active nuclear entry of DNA (with uncertain mechanisms).
Acknowledgments
The authors thank the Hong Kong Research Grant Council (GRF 16306917 and GRF 16309818) for their financial support.
Author Contributions
R.N. and R.F. wrote the manuscript; Y.C. gave suggestions and edited the manuscript.
Funding
This research was funded by the General Research Fund (grant number GRF 16306917 and GRF 16309818).
Conflicts of Interest
The authors declare no conflict of interest.
References
- 1.Mansoori B., Shotorbani S.S., Baradaran B. RNA Interference and its Role in Cancer Therapy. Adv. Pharm. Bull. 2014;4:313–321. doi: 10.5681/apb.2014.046. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Yang B., Jeang J., Yang A., Wu T.C., Hung C.-F. DNA vaccine for cancer immunotherapy. Hum. Vaccines Immunother. 2014;10:3153–3164. doi: 10.4161/21645515.2014.980686. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Wu H.-Y., Cao C.-Y. The application of CRISPR-Cas9 genome editing tool in cancer immunotherapy. Briefings Funct. Genom. 2019;18:129–132. doi: 10.1093/bfgp/ely011. [DOI] [PubMed] [Google Scholar]
- 4.Filley A.C., Henriquez M., Dey M. CART Immunotherapy: Development, Success, and Translation to Malignant Gliomas and Other Solid Tumors. Front. Oncol. 2018;8:1–19. doi: 10.3389/fonc.2018.00453. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Rodrigues G.A., Shalaev E., Karami T.K., Cunningham J., Slater N.K.H., Rivers H.M. Pharmaceutical Development of AAV-Based Gene Therapy Products for the Eye. Pharm. Res. 2019;36:29. doi: 10.1007/s11095-018-2554-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Zhu L., Mahato R.I. Lipid and polymeric carrier-mediated nucleic acid delivery. Expert Opin. Drug Deliv. 2010;7:1209–1226. doi: 10.1517/17425247.2010.513969. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Biswas S., Torchilin V.P. Dendrimers for siRNA delivery. Pharmaceuticals. 2013;6:161–183. doi: 10.3390/ph6020161. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Rezaee M., Oskuee R.K., Nassirli H., Malaekeh-Nikouei B. Progress in the development of lipopolyplexes as efficient non-viral gene delivery systems. J. Control. Release. 2016;236:1–14. doi: 10.1016/j.jconrel.2016.06.023. [DOI] [PubMed] [Google Scholar]
- 9.Ozpolat B., Sood A.K., Lopez-Berestein G. Liposomal siRNA nanocarriers for cancer therapy. Adv. Drug Deliv. Rev. 2014;66:110–116. doi: 10.1016/j.addr.2013.12.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Démoulins T., Milona P., Englezou P.C., Ebensen T., Schulze K., Suter R., Pichon C., Midoux P., Guzmán C.A., Ruggli N., et al. Polyethylenimine-based polyplex delivery of self-replicating RNA vaccines. Nanomed. Nanotechnol. Biol. Med. 2016;12:711–722. doi: 10.1016/j.nano.2015.11.001. [DOI] [PubMed] [Google Scholar]
- 11.Crombez L., Aldrian-Herrada G., Konate K., Nguyen Q.N., McMaster G.K., Brasseur R., Heitz F., Divita G. A New Potent Secondary Amphipathic Cell–penetrating Peptide for siRNA Delivery Into Mammalian Cells. Mol. Ther. 2009;17:95–103. doi: 10.1038/mt.2008.215. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Elouahabi A., Ruysschaert J.-M. Formation and Intracellular Trafficking of Lipoplexes and Polyplexes. Mol. Ther. 2005;11:336–347. doi: 10.1016/j.ymthe.2004.12.006. [DOI] [PubMed] [Google Scholar]
- 13.Coppola S., Estrada L.C., Digman M.A., Pozzi D., Cardarelli F., Gratton E., Caracciolo G. Intracellular trafficking of cationic liposome–DNA complexes in living cells. Soft Matter. 2012;8:7919–7927. doi: 10.1039/c2sm25532d. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Lechardeur D., Lukacs G. Intracellular Barriers to Non-Viral Gene Transfer. Curr. Gene Ther. 2002;2:183–194. doi: 10.2174/1566523024605609. [DOI] [PubMed] [Google Scholar]
- 15.Dominska M., Dykxhoorn D.M. Breaking down the barriers: siRNA delivery and endosome escape. J. Cell Sci. 2010;123:1183–1189. doi: 10.1242/jcs.066399. [DOI] [PubMed] [Google Scholar]
- 16.Vaughan E.E., Dean D.A. Intracellular Trafficking of Plasmids during Transfection Is Mediated by Microtubules. Mol. Ther. 2006;13:422–428. doi: 10.1016/j.ymthe.2005.10.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Panté N., Kann M. Nuclear Pore Complex Is Able to Transport Macromolecules with Diameters of about 39 nm. Mol. Biol. Cell. 2002;13:425–434. doi: 10.1091/mbc.01-06-0308. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Zhang S., Zhi D., Huang L. Lipid-based vectors for siRNA delivery. J. Drug Target. 2012;20:724–735. doi: 10.3109/1061186X.2012.719232. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Hall A., Lächelt U., Bartek J., Wagner E., Moghimi S.M. Polyplex Evolution: Understanding Biology, Optimizing Performance. Mol. Ther. 2017;25:1476–1490. doi: 10.1016/j.ymthe.2017.01.024. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Scholz C., Wagner E. Therapeutic plasmid DNA versus siRNA delivery: Common and different tasks for synthetic carriers. J. Control. Release. 2012;161:554–565. doi: 10.1016/j.jconrel.2011.11.014. [DOI] [PubMed] [Google Scholar]
- 21.Guan S., Rosenecker J. Nanotechnologies in delivery of mRNA therapeutics using nonviral vector-based delivery systems. Gene Ther. 2017;24:133–143. doi: 10.1038/gt.2017.5. [DOI] [PubMed] [Google Scholar]
- 22.Siepmann J., Faham A., Clas S.-D., Boyd B.J., Jannin V., Bernkop-Schnürch A., Zhao H., Lecommandoux S., Evans J.C., Allen C., et al. Lipids and polymers in pharmaceutical technology: Lifelong companions. Int. J. Pharm. 2019;558:128–142. doi: 10.1016/j.ijpharm.2018.12.080. [DOI] [PubMed] [Google Scholar]
- 23.Shi B., Zheng M., Tao W., Chung R., Jin D., Ghaffari D., Farokhzad O.C. Challenges in DNA Delivery and Recent Advances in Multifunctional Polymeric DNA Delivery Systems. Biomacromolecules. 2017;18:2231–2246. doi: 10.1021/acs.biomac.7b00803. [DOI] [PubMed] [Google Scholar]
- 24.Kim H.J., Kim A., Miyata K., Kataoka K. Recent progress in development of siRNA delivery vehicles for cancer therapy. Adv. Drug Deliv. Rev. 2016;104:61–77. doi: 10.1016/j.addr.2016.06.011. [DOI] [PubMed] [Google Scholar]
- 25.Lächelt U., Wagner E. Nucleic Acid Therapeutics Using Polyplexes: A Journey of 50 Years (and Beyond) Chem. Rev. 2015;115:11043–11078. doi: 10.1021/cr5006793. [DOI] [PubMed] [Google Scholar]
- 26.Palamà I.E., Cortese B., D’Amone S., Gigli G. mRNA delivery using non-viral PCL nanoparticles. Biomater. Sci. 2015;3:144–151. doi: 10.1039/C4BM00242C. [DOI] [PubMed] [Google Scholar]
- 27.Neuberg P., Kichler A. Recent Developments in Nucleic Acid Delivery with Polyethylenimines. Volume 88. Elsevier; Amsterdam, The Netherlands: 2014. [DOI] [PubMed] [Google Scholar]
- 28.Wagner E. Polymers for Nucleic Acid Transfer—An Overview. Volume 88. Elsevier; Amsterdam, The Netherlands: 2014. [DOI] [PubMed] [Google Scholar]
- 29.Li J., Liang H., Liu J., Wang Z. Poly (amidoamine) (PAMAM) dendrimer mediated delivery of drug and pDNA/siRNA for cancer therapy. Int. J. Pharm. 2018;546:215–225. doi: 10.1016/j.ijpharm.2018.05.045. [DOI] [PubMed] [Google Scholar]
- 30.Zylberberg C., Gaskill K., Pasley S., Matosevic S. Engineering liposomal nanoparticles for targeted gene therapy. Gene Ther. 2017;24:441–452. doi: 10.1038/gt.2017.41. [DOI] [PubMed] [Google Scholar]
- 31.Rietwyk S., Peer D. Next-Generation Lipids in RNA Interference Therapeutics. ACS Nano. 2017;11:7572–7586. doi: 10.1021/acsnano.7b04734. [DOI] [PubMed] [Google Scholar]
- 32.Meisel J.W., Gokel G.W. A Simplified Direct Lipid Mixing Lipoplex Preparation: Comparison of Liposomal-, Dimethylsulfoxide-, and Ethanol-Based Methods. Sci. Rep. 2016;6:27662. doi: 10.1038/srep27662. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Koltover I., Salditt T., Rädler J.O., Safinya C.R. An inverted hexagonal phase of cationic liposome-DNA complexes related to DNA release and delivery. Science. 1998;281:78–81. doi: 10.1126/science.281.5373.78. [DOI] [PubMed] [Google Scholar]
- 34.Rädler J.O., Ra J.O., Koltover I., Salditt T., Safinya C.R. DNA Intercalation in Multilamellar Membranes in Structure of DNA—Cationic Liposome Complexes: DNA Intercalation in Multilamellar Membranes in Distinct Interhelical Packing Regimes. Science. 2007;810:1–5. doi: 10.1126/science.275.5301.810. [DOI] [PubMed] [Google Scholar]
- 35.Ewert K.K., Evans H.M., Zidovska A., Bouxsein N.F., Ahmad A., Safinya C.R. A Columnar Phase of Dendritic Lipid-Based Cationic Liposome−DNA Complexes for Gene Delivery: Hexagonally Ordered Cylindrical Micelles Embedded in a DNA Honeycomb Lattice. J. Am. Chem. Soc. 2006;128:3998–4006. doi: 10.1021/ja055907h. [DOI] [PubMed] [Google Scholar]
- 36.Smisterová J., Wagenaar A., Stuart M.C.A., Polushkin E., Brinke G.T., Hulst R., Engberts J.B.F.N., Hoekstra D. Molecular Shape of the Cationic Lipid Controls the Structure of Cationic Lipid/Dioleylphosphatidylethanolamine-DNA Complexes and the Efficiency of Gene Delivery. J. Biol. Chem. 2001;276:47615–47622. doi: 10.1074/jbc.M106199200. [DOI] [PubMed] [Google Scholar]
- 37.Dan N. Lipid-Nucleic Acid Supramolecular Complexes: Lipoplex Structure and the Kinetics of Formation. AIMS Biophys. 2015;2:163–183. doi: 10.3934/biophy.2015.2.163. [DOI] [Google Scholar]
- 38.Mouritsen O.G. Lipids, curvature, and nano-medicine*. Eur. J. Lipid Sci. Technol. 2011;113:1174–1187. doi: 10.1002/ejlt.201100050. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Dan N., Danino D. Structure and kinetics of lipid–nucleic acid complexes. Adv. Colloid Interface Sci. 2014;205:230–239. doi: 10.1016/j.cis.2014.01.013. [DOI] [PubMed] [Google Scholar]
- 40.Wang X., Yu B., Ren W., Mo X., Zhou C., He H., Jia H., Wang L., Jacob S.T., Lee R.J., et al. Enhanced hepatic delivery of siRNA and microRNA using oleic acid based lipid nanoparticle formulations. J. Control. Release. 2015;172:690–698. doi: 10.1016/j.jconrel.2013.09.027. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Zhi D., Zhang S., Wang B., Zhao Y., Yang B., Yu S. Transfection Efficiency of Cationic Lipids with Different Hydrophobic Domains in Gene Delivery. Bioconjugate Chem. 2010;21:563–577. doi: 10.1021/bc900393r. [DOI] [PubMed] [Google Scholar]
- 42.Movahedi F., Hu R.G., Becker D.L., Xu C. Stimuli-responsive liposomes for the delivery of nucleic acid therapeutics. Nanomed. Nanotechnol.Biol. Med. 2015;11:1575–1584. doi: 10.1016/j.nano.2015.03.006. [DOI] [PubMed] [Google Scholar]
- 43.Puras G., Mashal M., Zarate J., Agirre M., Ojeda E., Grijalvo S., Eritja R., Díaz-Tahoces A., Navarrete G.M., Avilés-Trigueros M., et al. A novel cationic niosome formulation for gene delivery to the retina. J. Control. Release. 2014;174:27–36. doi: 10.1016/j.jconrel.2013.11.004. [DOI] [PubMed] [Google Scholar]
- 44.Kolate A., Baradia D., Patil S., Vhora I., Kore G., Misra A. PEG—A versatile conjugating ligand for drugs and drug delivery systems. J. Control. Release. 2014;192:67–81. doi: 10.1016/j.jconrel.2014.06.046. [DOI] [PubMed] [Google Scholar]
- 45.Cheng X., Lee R.J. The role of helper lipids in lipid nanoparticles (LNPs) designed for oligonucleotide delivery. Adv. Drug Deliv. Rev. 2016;99:129–137. doi: 10.1016/j.addr.2016.01.022. [DOI] [PubMed] [Google Scholar]
- 46.Colosimo A., Serafino A., Sangiuolo F., Di Sario S., Bruscia E., Amicucci P., Novelli G., Dallapiccola B., Mossa G. Gene transfection efficiency of tracheal epithelial cells by DC-Chol–DOPE/DNA complexes. Biochim. Biophys. Acta. 1999;1419:186–194. doi: 10.1016/S0005-2736(99)00067-X. [DOI] [PubMed] [Google Scholar]
- 47.Yue Y., Jin F., Deng R., Cai J., Dai Z., Lin M.C., Kung H.-F., Mattebjerg M.A., Andresen T.L., Wu C. Revisit complexation between DNA and polyethylenimine—Effect of length of free polycationic chains on gene transfection. J. Control. Release. 2011;152:143–151. doi: 10.1016/j.jconrel.2011.03.020. [DOI] [PubMed] [Google Scholar]
- 48.Garber K. Alnylam launches era of RNAi drugs. Nat. Biotechnol. 2018;36:777–778. doi: 10.1038/nbt0918-777. [DOI] [PubMed] [Google Scholar]
- 49.Molecules U., Index S., Gelbart W.M., Bruinsma R.F., Pincus P.A., Parsegian V.A. DNA condensation. Curr. Opin. Struct. Biol. 1996;6:334–341. doi: 10.1016/s0959-440x(96)80052-2. [DOI] [PubMed] [Google Scholar]
- 50.Rinkenauer A.C., Schubert S., Traeger A. The influence of polymer architecture on in vitro pDNA transfection. J. Mater. Chem. B. 2015;3:7477–7493. doi: 10.1039/C5TB00782H. [DOI] [PubMed] [Google Scholar]
- 51.Boussif O., Lezoualc’h F., Zanta M.A., Mergny M.D., Scherman D., Demeneix B., Behr J.P. A versatile vector for gene and oligonucleotide transfer into cells in culture and in vivo: Polyethylenimine. Proc. Natl. Acad. Sci. USA. 1995;92:7297–7301. doi: 10.1073/pnas.92.16.7297. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.Liu J., Jiang X., Xu L., Wang X., Hennink W.E., Zhuo R. Novel Reduction-Responsive Cross-Linked Polyethylenimine Derivatives by Click Chemistry for Nonviral Gene Delivery. Bioconjugate Chem. 2010;21:1827–1835. doi: 10.1021/bc100191r. [DOI] [PubMed] [Google Scholar]
- 53.Taranejoo S., Liu J., Verma P., Hourigan K. A review of the developments of characteristics of PEI derivatives for gene delivery applications. J. Appl. Polym. Sci. 2015;132:2–9. doi: 10.1002/app.42096. [DOI] [Google Scholar]
- 54.Wang M., Guo Y., Yu M., Ma P.X., Mao C., Lei B. Photoluminescent and biodegradable polycitrate-polyethylene glycol-polyethyleneimine polymers as highly biocompatible and efficient vectors for bioimaging-guided siRNA and miRNA delivery. Acta Biomater. 2017;54:69–80. doi: 10.1016/j.actbio.2017.02.034. [DOI] [PubMed] [Google Scholar]
- 55.Ping Y., Hu Q., Tang G., Li J. FGFR-targeted gene delivery mediated by supramolecular assembly between β-cyclodextrin-crosslinked PEI and redox-sensitive PEG. Biomaterials. 2013;34:6482–6494. doi: 10.1016/j.biomaterials.2013.03.071. [DOI] [PubMed] [Google Scholar]
- 56.D’Andrea C., Pezzoli D., Malloggi C., Candeo A., Capelli G., Bassi A., Volonterio A., Taroni P., Candiani G. The study of polyplex formation and stability by time-resolved fluorescence spectroscopy of SYBR Green I-stained DNA. Photochem. Photobiol. Sci. 2014;13:1680–1689. doi: 10.1039/C4PP00242C. [DOI] [PubMed] [Google Scholar]
- 57.Mady M.M., Mohammed W.A., El-Guendy N.M., Elsayed A.A. Effect of Polymer Molecular Weight on the Dna/Pei Polyplexes Properties. J. Biophys. 2011;21:151–165. [Google Scholar]
- 58.Chiper M., Tounsi N., Kole R., Kichler A., Zuber G. Self-aggregating 1.8 kDa polyethylenimines with dissolution switch at endosomal acidic pH are delivery carriers for plasmid DNA, mRNA, siRNA and exon-skipping oligonucleotides. J. Control. Release. 2017;246:60–70. doi: 10.1016/j.jconrel.2016.12.005. [DOI] [PubMed] [Google Scholar]
- 59.Zhao M., Li M., Zhang Z., Gong T., Sun X. Induction of HIV-1 gag specific immune responses by cationic micelles mediated delivery of gag mRNA. Drug Deliv. 2016;23:2596–2607. doi: 10.3109/10717544.2015.1038856. [DOI] [PubMed] [Google Scholar]
- 60.Dai Z., Wu C. How Does DNA Complex with Polyethylenimine with Different Chain Lengths and Topologies in Their Aqueous Solution Mixtures? Macromolecules. 2012;45:4346–4353. doi: 10.1021/ma2027963. [DOI] [Google Scholar]
- 61.Alameh M., Lavertu M., Tran-Khanh N., Chang C.Y., Lesage F., Bail M., Darras V., Chevrier A., Buschmann M.D. SiRNA Delivery with Chitosan: Influence of Chitosan Molecular Weight, Degree of Deacetylation, and Amine to Phosphate Ratio on in Vitro Silencing Efficiency, Hemocompatibility, Biodistribution, and in Vivo Efficacy. Biomacromolecules. 2018;19:112–131. doi: 10.1021/acs.biomac.7b01297. [DOI] [PubMed] [Google Scholar]
- 62.Supaprutsakul S., Chotigeat W., Wanichpakorn S., Kedjarune-Leggat U. Transfection efficiency of depolymerized chitosan and epidermal growth factor conjugated to chitosan–DNA polyplexes. J. Mater. Sci. Mater. Electron. 2010;21:1553–1561. doi: 10.1007/s10856-010-3993-9. [DOI] [PubMed] [Google Scholar]
- 63.Sah E., Sah H. Recent Trends in Preparation of Poly(lactide- co -glycolide) Nanoparticles by Mixing Polymeric Organic Solution with Antisolvent. J. Nanomater. 2015;2015:1–22. doi: 10.1155/2015/794601. [DOI] [Google Scholar]
- 64.Tahara K., Sakai T., Yamamoto H., Takeuchi H., Kawashima Y. Establishing chitosan coated PLGA nanosphere platform loaded with wide variety of nucleic acid by complexation with cationic compound for gene delivery. Int. J. Pharm. 2008;354:210–216. doi: 10.1016/j.ijpharm.2007.11.002. [DOI] [PubMed] [Google Scholar]
- 65.Udhayakumar V.K., De Beuckelaer A., McCaffrey J., McCrudden C.M., Kirschman J.L., Vanover D., van Hoecke L., Roose K., Deswarte K., De Geest B.G., et al. Arginine-Rich Peptide-Based mRNA Nanocomplexes Efficiently Instigate Cytotoxic T Cell Immunity Dependent on the Amphipathic Organization of the Peptide. Adv. Heal. Mater. 2017;6:1601412. doi: 10.1002/adhm.201601412. [DOI] [PubMed] [Google Scholar]
- 66.Tönges L., Lingor P., Egle R., Dietz G.P., Fahr A., Bähr M. Stearylated octaarginine and artificial virus-like particles for transfection of siRNA into primary rat neurons. RNA. 2006;12:1431–1438. doi: 10.1261/rna.2252206. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Deshayes S., Gerbal-Chaloin S., Morris M.C., Aldrian-Herrada G., Charnet P., Divita G., Heitz F. On the mechanism of non-endosomial peptide-mediated cellular delivery of nucleic acids. Biochim. Biophys. Acta. 2004;1667:141–147. doi: 10.1016/j.bbamem.2004.09.010. [DOI] [PubMed] [Google Scholar]
- 68.Crombez L., Morris M.C., Dufort S., Aldrian-Herrada G., Nguyen Q., Mc Master G., Coll J.-L., Heitz F., Divita G. Targeting cyclin B1 through peptide-based delivery of siRNA prevents tumour growth. Nucleic Acids Res. 2009;37:4559–4569. doi: 10.1093/nar/gkp451. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69.Chen S., Lei Q., Li S.-Y., Qin S.-Y., Jia H.-Z., Cheng Y.-J., Zhang X.-Z. Fabrication of dual responsive co-delivery system based on three-armed peptides for tumor therapy. Biomaterials. 2016;92:25–35. doi: 10.1016/j.biomaterials.2016.03.031. [DOI] [PubMed] [Google Scholar]
- 70.Chen Q., Qi R., Chen X., Yang X., Wu S., Xiao H., Dong W. A Targeted and Stable Polymeric Nanoformulation Enhances Systemic Delivery of mRNA to Tumors. Mol. Ther. 2017;25:92–101. doi: 10.1016/j.ymthe.2016.10.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71.Crowley S.T., Poliskey J.A., Baumhover N.J., Rice K.G. Efficient Expression of Stabilized mRNAPEG-Peptide Polyplexes in Liver. Gene Ther. 2016;22:993–999. doi: 10.1038/gt.2015.68. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 72.Dileo J., Banerjee R., Whitmore M., Nayak J.V., Falo L.D., Huang L. Lipid–protamine–DNA-mediated antigen delivery to antigen-presenting cells results in enhanced anti-tumor immune responses. Mol. Ther. 2003;7:640–648. doi: 10.1016/S1525-0016(03)00064-9. [DOI] [PubMed] [Google Scholar]
- 73.Singh P., Gonzalez M.J., Manchester M. Viruses and their uses in nanotechnology. Drug Dev. Res. 2006;67:23–41. doi: 10.1002/ddr.20064. [DOI] [Google Scholar]
- 74.Jeevanandam J., Pal K., Danquah M.K. Virus-like nanoparticles as a novel delivery tool in gene therapy. Biochimie. 2019;157:38–47. doi: 10.1016/j.biochi.2018.11.001. [DOI] [PubMed] [Google Scholar]
- 75.Jekhmane S., De Haas R., Filho O.P.D.S., Van Asbeck A.H., Favretto M.E., Garcia A.H., Brock R., de Vries R. Virus-Like Particles of mRNA with Artificial Minimal Coat Proteins: Particle Formation, Stability, and Transfection Efficiency. Nucleic Acid Ther. 2017;27:159–167. doi: 10.1089/nat.2016.0660. [DOI] [PubMed] [Google Scholar]
- 76.Zhitnyuk Y., Gee P., Lung M.S., Sasakawa N., Xu H., Saito H., Hotta A. Efficient mRNA delivery system utilizing chimeric VSVG-L7Ae virus-like particles. Biochem. Biophys. Res. Commun. 2018;505:1097–1102. doi: 10.1016/j.bbrc.2018.09.113. [DOI] [PubMed] [Google Scholar]
- 77.Chao C.-N., Yang Y.-H., Wu M.-S., Chou M.-C., Fang C.-Y., Lin M.-C., Tai C.-K., Shen C.-H., Chen P.-L., Chang D., et al. Gene therapy for human glioblastoma using neurotropic JC virus-like particles as a gene delivery vector. Sci. Rep. 2018;8:2213. doi: 10.1038/s41598-018-19825-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78.Chao C.-N., Huang Y.-L., Lin M.-C., Fang C.-Y., Shen C.-H., Chen P.-L., Wang M., Chang D., Tseng C.-E. Inhibition of human diffuse large B-cell lymphoma growth by JC polyomavirus-like particles delivering a suicide gene. J. Transl. Med. 2015;13:3909. doi: 10.1186/s12967-015-0389-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79.Chao C.-N., Lin M.-C., Fang C.-Y., Chen P.-L., Chang D., Shen C.-H., Wang M. Gene Therapy for Human Lung Adenocarcinoma Using a Suicide Gene Driven by a Lung-Specific Promoter Delivered by JC Virus-Like Particles. PLoS ONE. 2016;11:0157865. doi: 10.1371/journal.pone.0157865. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80.Chen L.-S., Wang M., Ou W.-C., Fung C.-Y., Chen P.-L., Chang C.-F., Huang W.-S., Wang J.-Y., Lin P.Y., Chang D. Efficient gene transfer using the human JC virus-like particle that inhibits human colon adenocarcinoma growth in a nude mouse model. Gene Ther. 2010;17:1033–1041. doi: 10.1038/gt.2010.50. [DOI] [PubMed] [Google Scholar]
- 81.Ni R., Chau Y. Structural Mimics of Viruses Through Peptide/DNA Co-Assembly. J. Am. Chem. Soc. 2014;136:17902–17905. doi: 10.1021/ja507833x. [DOI] [PubMed] [Google Scholar]
- 82.Ni R., Chau Y. Tuning the Inter-nanofibril Interaction To Regulate the Morphology and Function of Peptide/DNA Co-assembled Viral Mimics. Angew. Chem. Int. Ed. 2017;56:9356–9360. doi: 10.1002/anie.201703596. [DOI] [PubMed] [Google Scholar]
- 83.Hernandez-Garcia A., Kraft D.J., Janssen A.F.J., Bomans P.H.H., Sommerdijk N.A.J.M., Thies-Weesie D.M.E., Favretto M.E., Brock R., De Wolf F.A., Werten M.W.T., et al. Design and self-assembly of simple coat proteins for artificial viruses. Nat. Nanotechnol. 2014;9:698–702. doi: 10.1038/nnano.2014.169. [DOI] [PubMed] [Google Scholar]
- 84.Ruff Y., Moyer T., Newcomb C.J., Demeler B., Stupp S.I. Precision Templating with DNA of a Virus-like Particle with Peptide Nanostructures. J. Am. Chem. Soc. 2013;135:6211–6219. doi: 10.1021/ja4008003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 85.Lim Y.-B., Lee E., Yoon Y.-R., Lee M.S., Lee M. Filamentous Artificial Virus from a Self-Assembled Discrete Nanoribbon. Angew. Chem. 2008;120:4601–4604. doi: 10.1002/ange.200800266. [DOI] [PubMed] [Google Scholar]
- 86.El-Sayed A., Harashima H. Endocytosis of Gene Delivery Vectors: From Clathrin-dependent to Lipid Raft-mediated Endocytosis. Mol. Ther. 2013;21:1118–1130. doi: 10.1038/mt.2013.54. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 87.Sanders N.N., Vandenbroucke R., Wagner E., Ogris M., Vongersdorff K., Desmedt S., Von Gersdorff K., De Smedt S.C. The Internalization Route Resulting in Successful Gene Expression Depends on both Cell Line and Polyethylenimine Polyplex Type. Mol. Ther. 2006;14:745–753. doi: 10.1016/j.ymthe.2006.07.006. [DOI] [PubMed] [Google Scholar]
- 88.Suen W.L.L., Chau Y. Size-dependent internalisation of folate-decorated nanoparticles via the pathways of clathrin and caveolae-mediated endocytosis in ARPE-19 cells. J. Pharm. Pharmacol. 2014;66:564–573. doi: 10.1111/jphp.12134. [DOI] [PubMed] [Google Scholar]
- 89.Sun T., Zhang Y.S., Pang B., Hyun D.C., Yang M., Xia Y. Engineered Nanoparticles for Drug Delivery in Cancer Therapy. Angew. Chem. Int. Ed. 2014;53:12320–12364. doi: 10.1002/anie.201403036. [DOI] [PubMed] [Google Scholar]
- 90.Albanese A., Tang P.S., Chan W.C. The Effect of Nanoparticle Size, Shape, and Surface Chemistry on Biological Systems. Annu. Rev. Biomed. Eng. 2012;14:1–16. doi: 10.1146/annurev-bioeng-071811-150124. [DOI] [PubMed] [Google Scholar]
- 91.Zhang S., Gao H., Bao G. Physical Principles of Nanoparticle Cellular Endocytosis. ACS Nano. 2015;9:8655–8671. doi: 10.1021/acsnano.5b03184. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 92.Lu J.J., Langer R., Chen J. A Novel Mechanism Is Involved in Cationic Lipid-Mediated Functional siRNA Delivery Accessed articles. Mol. Pharm. 2009;6:763–771. doi: 10.1021/mp900023v. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 93.Lazebnik M., Keswani R.K., Pack D.W. Endocytic Transport of Polyplex and Lipoplex siRNA Vectors in HeLa Cells. Pharm. Res. 2016;33:2999–3011. doi: 10.1007/s11095-016-2022-1. [DOI] [PubMed] [Google Scholar]
- 94.Pozzi D., Marchini C., Cardarelli F., Amenitsch H., Garulli C., Bifone A., Caracciolo G. Transfection efficiency boost of cholesterol-containing lipoplexes. Biochim. Biophys. Acta. 2012;1818:2335–2343. doi: 10.1016/j.bbamem.2012.05.017. [DOI] [PubMed] [Google Scholar]
- 95.Hama S., Akita H., Ito R., Mizuguchi H., Hayakawa T., Harashima H. Quantitative Comparison of Intracellular Trafficking and Nuclear Transcription between Adenoviral and Lipoplex Systems. Mol. Ther. 2006;13:786–794. doi: 10.1016/j.ymthe.2005.10.007. [DOI] [PubMed] [Google Scholar]
- 96.Marchini C., Pozzi D., Montani M., Alfonsi C., Amici A., Amenitsch H., De Sanctis S.C., Caracciolo G. Tailoring Lipoplex Composition to the Lipid Composition of Plasma Membrane: A Trojan Horse for Cell Entry? Langmuir. 2010;26:13867–13873. doi: 10.1021/la1023899. [DOI] [PubMed] [Google Scholar]
- 97.Gabrielson N.P., Pack D.W. Efficient polyethylenimine-mediated gene delivery proceeds via a caveolar pathway in HeLa cells. J. Control. Release. 2009;136:54–61. doi: 10.1016/j.jconrel.2009.02.003. [DOI] [PubMed] [Google Scholar]
- 98.Zhou J., Chau Y. Different oligoarginine modifications alter endocytic pathways and subcellular trafficking of polymeric nanoparticles. Biomater. Sci. 2016;4:1462–1472. doi: 10.1039/C6BM00371K. [DOI] [PubMed] [Google Scholar]
- 99.De Bruin K., Ruthardt N., von Gersdorff K., Bausinger R., Wagner E., Ogris M., Bräuchle C. Cellular dynamics of EGF receptor-targeted synthetic viruses. Mol. Ther. 2007;15:1297–1305. doi: 10.1038/sj.mt.6300176. [DOI] [PubMed] [Google Scholar]
- 100.Li W., Liu Y., Du J., Ren K., Wang Y. Cell penetrating peptide-based polyplexes shelled with polysaccharide to improve stability and gene transfection. Nanoscale. 2015;7:8476–8484. doi: 10.1039/C4NR07037B. [DOI] [PubMed] [Google Scholar]
- 101.Simeoni F. Insight into the mechanism of the peptide-based gene delivery system MPG: Implications for delivery of siRNA into mammalian cells. Nucleic Acids Res. 2003;31:2717–2724. doi: 10.1093/nar/gkg385. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 102.Deshayes S., Konate K., Aldrian G., Crombez L., Heitz F., Divita G. Structural polymorphism of non-covalent peptide-based delivery systems: Highway to cellular uptake. Biochim. Biophys. Acta. 2010;1798:2304–2314. doi: 10.1016/j.bbamem.2010.06.005. [DOI] [PubMed] [Google Scholar]
- 103.Deshayes S., Heitz A., Morris M.C., Charnet P., Divita G., Heitz F. Insight into the Mechanism of Internalization of the Cell-Penetrating Carrier Peptide Pep-1 through Conformational Analysis. Biochemistry. 2004;43:1449–1457. doi: 10.1021/bi035682s. [DOI] [PubMed] [Google Scholar]
- 104.Bus T., Traeger A., Schubert U.S. The great escape: How cationic polyplexes overcome the endosomal barrier. J. Mater. Chem. B. 2018;6:6904–6918. doi: 10.1039/C8TB00967H. [DOI] [PubMed] [Google Scholar]
- 105.Durymanov M., Reineke J. Non-viral Delivery of Nucleic Acids: Insight Into Mechanisms of Overcoming Intracellular Barriers. Front. Pharmacol. 2018;9:1–15. doi: 10.3389/fphar.2018.00971. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 106.Hutagalung A.H., Novick P.J. Role of Rab GTPases in Membrane Traffic and Cell Physiology. Physiol. Rev. 2011;91:119–149. doi: 10.1152/physrev.00059.2009. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 107.Bohdanowicz M., Grinstein S. Role of Phospholipids in Endocytosis, Phagocytosis, and Macropinocytosis. Physiol. Rev. 2013;93:69–106. doi: 10.1152/physrev.00002.2012. [DOI] [PubMed] [Google Scholar]
- 108.Zelphati O., Szoka F.C. Mechanism of oligonucleotide release from cationic liposomes. Proc. Natl. Acad. Sci. USA. 1996;93:11493–11498. doi: 10.1073/pnas.93.21.11493. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 109.Du Z., Munye M.M., Tagalakis A.D., Manunta M.D.I., Hart S.L. The Role of the Helper Lipid on the DNA Transfection Efficiency of Lipopolyplex Formulations. Sci. Rep. 2014;4:7107. doi: 10.1038/srep07107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 110.Essex S., Navarro G., Sabhachandani P., Chordia A., Trivedi M., Movassaghian S., Torchilin V.P. Phospholipid-modified PEI-based nanocarriers for in vivo siRNA therapeutics against multidrug-resistant tumors. Gene Ther. 2015;22:257–266. doi: 10.1038/gt.2014.97. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 111.Cardarelli F., Pozzi D., Bifone A., Marchini C., Caracciolo G. Cholesterol-dependent macropinocytosis and endosomal escape control the transfection efficiency of lipoplexes in CHN living cells. Mol. Pharm. 2012;9:334–340. doi: 10.1021/mp200374e. [DOI] [PubMed] [Google Scholar]
- 112.Jayaraman M., Ansell S.M., Mui B.L., Tam Y.K., Chen J., Du X., Butler D., Eltepu L., Matsuda S., Narayanannair J.K., et al. Maximizing the Potency of siRNA Lipid Nanoparticles for Hepatic Gene Silencing In Vivo. Angew. Chem. 2012;124:8657–8661. doi: 10.1002/ange.201203263. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 113.Benjaminsen R.V., Mattebjerg M.A., Henriksen J.R., Moghimi S.M., Andresen T.L. The possible “proton sponge” effect of polyethylenimine (PEI) does not include change in lysosomal pH. Mol. Ther. 2013;21:149–157. doi: 10.1038/mt.2012.185. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 114.Behr J.P. The proton sponge. A trick to enter cells the viruses did not exploit. Chimia (Aarau) 1997;51:34–36. [Google Scholar]
- 115.Nguyen J., Szoka F.C. Nucleic acid delivery: The missing pieces of the puzzle? Accounts Chem. Res. 2012;45:1153–1162. doi: 10.1021/ar3000162. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 116.Brans T., Samal S.K., Dubruel P., Demeester J., De Smedt S.C., Remaut K., Braeckmans K., Vermeulen L.M. Endosomal Size and Membrane Leakiness Influence Proton Sponge-Based Rupture of Endosomal Vesicles. ACS Nano. 2018;12:2332–2345. doi: 10.1021/acsnano.7b07583. [DOI] [PubMed] [Google Scholar]
- 117.Aoki Y., Hosaka S., Kawa S., Kiyosawa K. Potential tumor-targeting peptide vector of histidylated oligolysine conjugated to a tumor-homing RGD motif. Cancer Gene Ther. 2001;8:783–787. doi: 10.1038/sj.cgt.7700362. [DOI] [PubMed] [Google Scholar]
- 118.Leng Q., Mixson A.J. Modified branched peptides with a histidine-rich tail enhance in vitro gene transfection. Nucleic Acids Res. 2005;33:e40. doi: 10.1093/nar/gni040. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 119.Chang K.-L., Higuchi Y., Kawakami S., Yamashita F., Hashida M. Efficient Gene Transfection by Histidine-Modified Chitosan through Enhancement of Endosomal Escape. Bioconjugate Chem. 2010;21:1087–1095. doi: 10.1021/bc1000609. [DOI] [PubMed] [Google Scholar]
- 120.Tai W., Gao X. Functional peptides for siRNA delivery. Adv. Drug Deliv. Rev. 2017;110–111:157–168. doi: 10.1016/j.addr.2016.08.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 121.Van Rossenberg S.M.W., Hickabottom M., Parker G.A., Freemont P., Crook T., Allday M.J. Targeted Lysosome Disruptive Elements for Improvement of Parenchymal Liver Cell-specific Gene Delivery. J. Biol. Chem. 2002;277:45803–45810. doi: 10.1074/jbc.M203510200. [DOI] [PubMed] [Google Scholar]
- 122.Kusumoto K., Akita H., Santiwarangkool S., Harashima H. Advantages of ethanol dilution method for preparing GALA-modified liposomal siRNA carriers on the in vivo gene knockdown efficiency in pulmonary endothelium. Int. J. Pharm. 2014;473:144–147. doi: 10.1016/j.ijpharm.2014.07.007. [DOI] [PubMed] [Google Scholar]
- 123.Freulon I., Roche A.-C., Monsigny M., Mayer R. Delivery of oligonucleotides into mammalian cells by anionic peptides: Comparison between monomeric and dimeric peptides. Biochem. J. 2001;354:671–679. doi: 10.1042/bj3540671. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 124.Li W., Nicol F., Szoka F.C. GALA: A designed synthetic pH-responsive amphipathic peptide with applications in drug and gene delivery. Adv. Drug Deliv. Rev. 2004;56:967–985. doi: 10.1016/j.addr.2003.10.041. [DOI] [PubMed] [Google Scholar]
- 125.Evans J.C., Malhotra M., Sweeney K., Darcy R., Nelson C.C., Hollier B.G., O’Driscoll C.M. Folate-targeted amphiphilic cyclodextrin nanoparticles incorporating a fusogenic peptide deliver therapeutic siRNA and inhibit the invasive capacity of 3D prostate cancer tumours. Int. J. Pharm. 2017;532:511–518. doi: 10.1016/j.ijpharm.2017.09.013. [DOI] [PubMed] [Google Scholar]
- 126.Ali H.M., Maksimenko A., Urbinati G., Chapuis H., Raouane M., Desmaële D., Yasuhiro H., Harashima H., Couvreur P., Massaad-Massade L. Effects of Silencing the RET/PTC1 Oncogene in Papillary Thyroid Carcinoma by siRNA-Squalene Nanoparticles With and Without Fusogenic Companion GALA-Cholesterol. Thyroid. 2013;24:327–338. doi: 10.1089/thy.2012.0544. [DOI] [PubMed] [Google Scholar]
- 127.Foroozandeh P., Aziz A.A. Insight into Cellular Uptake and Intracellular Trafficking of Nanoparticles. Nanoscale Res. Lett. 2018;13:339. doi: 10.1186/s11671-018-2728-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 128.Leong K.W., Grigsby C.L. Balancing protection and release of DNA: Tools to address a bottleneck of non-viral gene delivery. J. R. Soc. Interface. 2010;7:S67–S82. doi: 10.1098/rsif.2009.0260. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 129.Hirsch M., Helm M. Live cell imaging of duplex siRNA intracellular trafficking. Nucleic Acids Res. 2015;43:4650–4660. doi: 10.1093/nar/gkv307. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 130.Wittrup A., Ai A., Liu X., Hamar P., Trifonova R., Charisse K., Manoharan M., Kirchhausen T., Lieberman J. Visualizing lipid-formulated siRNA release from endosomes and target gene knockdown. Nat. Biotechnol. 2015;33:870–876. doi: 10.1038/nbt.3298. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 131.Schaffer D.V., Fidelman N.A., Dan N., Lauffenburger D.A. Vector unpacking as a potential barrier for receptor-mediated polyplex gene delivery. Biotechnol. Bioeng. 2000;67:598–606. doi: 10.1002/(SICI)1097-0290(20000305)67:5<598::AID-BIT10>3.0.CO;2-G. [DOI] [PubMed] [Google Scholar]
- 132.Huth S., Hoffmann F., Von Gersdorff K., Laner A., Reinhardt D., Rosenecker J., Rudolph C. Interaction of polyamine gene vectors with RNA leads to the dissociation of plasmid DNA-carrier complexes. J. Gene Med. 2006;8:1416–1424. doi: 10.1002/jgm.975. [DOI] [PubMed] [Google Scholar]
- 133.Forrest M.L., Meister G.E., Koerber J.T., Pack D.W. Partial Acetylation of Polyethylenimine Enhances In Vitro Gene Delivery. Pharm. Res. 2004;21:365–371. doi: 10.1023/B:PHAM.0000016251.42392.1e. [DOI] [PubMed] [Google Scholar]
- 134.Gabrielson N.P., Pack D.W. Acetylation of Polyethylenimine Enhances Gene Delivery via Weakened Polymer/DNA Interactions. Biomacromolecules. 2006;7:2427–2435. doi: 10.1021/bm060300u. [DOI] [PubMed] [Google Scholar]
- 135.Liu X., Yang J.W., Lynn D.M. Addition of ‘Charge-Shifting’ Side Chains to Linear Poly(ethyleneimine) Enhances Cell Transfection Efficiency. Biomacromolecules. 2008;9:2063–2071. doi: 10.1021/bm800291v. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 136.Köping-Höggård M., Vårum K.M., Issa M., Danielsen S., Christensen B.E., Stokke B.T., Artursson P. Improved chitosan-mediated gene delivery based on easily dissociated chitosan polyplexes of highly defined chitosan oligomers. Gene Ther. 2004;11:1441–1452. doi: 10.1038/sj.gt.3302312. [DOI] [PubMed] [Google Scholar]
- 137.Kiang T., Wen J., Lim H.W., Leong K.W. The effect of the degree of chitosan deacetylation on the efficiency of gene transfection. Biomaterials. 2004;25:5293–5301. doi: 10.1016/j.biomaterials.2003.12.036. [DOI] [PubMed] [Google Scholar]
- 138.Du X.-J., Wang Z.-Y., Wang Y.-C. Redox-sensitive dendrimersomes assembled from amphiphilic Janus dendrimers for siRNA delivery. Biomater. Sci. 2018;6:2122–2129. doi: 10.1039/C8BM00491A. [DOI] [PubMed] [Google Scholar]
- 139.Xu X., Wu J., Liu S., Saw P.E., Tao W., Li Y., Krygsman L., Yegnasubramanian S., De Marzo A.M., Shi J., et al. Redox-Responsive Nanoparticle-Mediated Systemic RNAi for Effective Cancer Therapy. Small. 2008;14:1802565. doi: 10.1002/smll.201802565. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 140.Lukacs G.L., Haggie P., Lechardeur D., Freedman N., Verkman S., Verkman A.S. Cell Biology and Metabolism: Size-dependent DNA Mobility in Cytoplasm and Nucleus Size-dependent DNA Mobility in Cytoplasm and Nucleus. J. Biol. Chem. 2000;275:1625–1629. doi: 10.1074/jbc.275.3.1625. [DOI] [PubMed] [Google Scholar]
- 141.Bai H., Lester G.M.S., Petishnok L.C., Dean D.A. Cytoplasmic transport and nuclear import of plasmid DNA. Biosci. Rep. 2017;37:20160616. doi: 10.1042/BSR20160616. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 142.Lechardeur D., Sohn K.J., Haardt M., Joshi P.B., Monck M., Graham R.W., Beatty B., Squire J., O’Brodovich H., Lukacs G.L. Metabolic instability of plasmid DNA in the cytosol: A potential barrier to gene transfer. Gene Ther. 2002;6:482–497. doi: 10.1038/sj.gt.3300867. [DOI] [PubMed] [Google Scholar]
- 143.Cohen R.N., Van Der Aa M.A., Macaraeg N., Lee A.P., Szoka F.C., Jr. Quantification of Plasmid DNA Copies in the Nucleus after Lipoplex and Polyplex Transfection. J. Control. Release. 2009;135:166–174. doi: 10.1016/j.jconrel.2008.12.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 144.Ondrej V., Lukásová E., Falk M., Kozubek S. The role of actin and microtubule networks in plasmid DNA intracellular trafficking. Acta Biochim. Pol. 2007;54:657–663. [PubMed] [Google Scholar]
- 145.Sauer A., De Bruin K., Ruthardt N., Mykhaylyk O., Plank C., Bräuchle C. Dynamics of magnetic lipoplexes studied by single particle tracking in living cells. J. Control. Release. 2009;137:136–145. doi: 10.1016/j.jconrel.2009.04.003. [DOI] [PubMed] [Google Scholar]
- 146.Mieruszynski S., Digman M.A., Gratton E., Jones M.R. Characterization of exogenous DNA mobility in live cells through fluctuation correlation spectroscopy. Sci. Rep. 2015;5:13848. doi: 10.1038/srep13848. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 147.Loubéry S., Wilhelm C., Hurbain I., Neveu S., Louvard D., Coudrier E. Different Microtubule Motors Move Early and Late Endocytic Compartments. Traffic. 2008;9:492–509. doi: 10.1111/j.1600-0854.2008.00704.x. [DOI] [PubMed] [Google Scholar]
- 148.Cardarelli F., Digiacomo L., Marchini C., Amici A., Salomone F., Fiume G., Rossetta A., Gratton E., Pozzi D., Caracciolo G. The intracellular trafficking mechanism of Lipofectamine-based transfection reagents and its implication for gene delivery. Sci. Rep. 2016;6:25879. doi: 10.1038/srep25879. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 149.Suh J., Wirtz D., Hanes J. Efficient active transport of gene nanocarriers to the cell nucleus. Proc. Natl. Acad. Sci. USA. 2003;100:3878–3882. doi: 10.1073/pnas.0636277100. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 150.Bausinger R., Von Gersdorff K., Braeckmans K., Ogris M., Wagner E., Bräuchle C., Zumbusch A. The Transport of Nanosized Gene Carriers Unraveled by Live-Cell Imaging. Angew. Chem. 2006;118:1598–1602. doi: 10.1002/ange.200503021. [DOI] [PubMed] [Google Scholar]
- 151.Akita H., Enoto K., Masuda T., Mizuguchi H., Tani T., Harashima H. Particle Tracking of Intracellular Trafficking of Octaarginine-modified Liposomes: A Comparative Study With Adenovirus. Mol. Ther. 2010;18:955–964. doi: 10.1038/mt.2010.33. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 152.King S.J., Schroer T.A. Dynactin increases the processivity of the cytoplasmic dynein motor. Nat. Cell Biol. 2000;2:20–24. doi: 10.1038/71338. [DOI] [PubMed] [Google Scholar]
- 153.Kim A.J., Boylan N.J., Suk J.S., Lai S.K., Hanes J. Non-degradative intracellular trafficking of highly compacted polymeric DNA nanoparticles. J. Control. Release. 2012;158:102–107. doi: 10.1016/j.jconrel.2011.10.031. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 154.Scherer J., Vallee R.B. Adenovirus Recruits Dynein by an Evolutionary Novel Mechanism Involving Direct Binding to pH-Primed Hexon. Viruses. 2011;3:1417–1431. doi: 10.3390/v3081417. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 155.Mabit H., Nakano M.Y., Prank U., Saam B., Döhner K., Sodeik B., Greber U.F. Intact Microtubules Support Adenovirus and Herpes Simplex Virus Infections. J. Virol. 2002;76:9962–9971. doi: 10.1128/JVI.76.19.9962-9971.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 156.Douglas M.W., Diefenbach R., Homa F.L., Miranda-Saksena M., Rixon F.J., Vittone V., Byth K., Cunningham A. Herpes Simplex Virus Type 1 Capsid Protein VP26 Interacts with Dynein Light Chains RP3 and Tctex1 and Plays a Role in Retrograde Cellular Transport. J. Biol. Chem. 2004;279:28522–28530. doi: 10.1074/jbc.M311671200. [DOI] [PubMed] [Google Scholar]
- 157.Akita H., Enoto K., Tanaka H., Harashima H. Particle Tracking Analysis for the Intracellular Trafficking of Nanoparticles Modified with African Swine Fever Virus Protein p54-derived Peptide. Mol. Ther. 2013;21:309–317. doi: 10.1038/mt.2012.235. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 158.Ludtke J.J., Zhang G., Sebestyén M.G., A Wolff J. A nuclear localization signal can enhance both the nuclear transport and expression of 1 kb DNA. J. Cell Sci. 1999;112:2033–2041. doi: 10.1242/jcs.112.12.2033. [DOI] [PubMed] [Google Scholar]
- 159.Kirchenbuechler I., Kirchenbuechler D., Elbaum M. Correlation between cationic lipid-based transfection and cell division. Exp. Cell Res. 2016;345:1–5. doi: 10.1016/j.yexcr.2014.11.019. [DOI] [PubMed] [Google Scholar]
- 160.Durymanov M.O., Yarutkin A.V., Khramtsov Y.V., Rosenkranz A.A., Sobolev A.S. Live imaging of transgene expression in Cloudman S91 melanoma cells after polyplex-mediated gene delivery. J. Control. Release. 2015;215:73–81. doi: 10.1016/j.jconrel.2015.07.028. [DOI] [PubMed] [Google Scholar]
- 161.Kamiya H., Fujimura Y., Matsuoka I., Harashima H. Live cell imaging of duplex siRNA intracellular trafficking. Biochem. Biophys. Res. Commun. 2002;298:591–597. doi: 10.1016/S0006-291X(02)02485-3. [DOI] [PubMed] [Google Scholar]
- 162.Grandinetti G., Smith A.E., Reineke T.M. Membrane and Nuclear Permeabilization by Polymeric pDNA Vehicles: Efficient Method for Gene Delivery or Mechanism of Cytotoxicity? Mol. Pharm. 2012;9:523–538. doi: 10.1021/mp200368p. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 163.Breuzard G., Tertil M., Gonçalves C., Cheradame H., Géguan P., Pichon C., Midoux P. Nuclear delivery of NFκB-assisted DNA/polymer complexes: Plasmid DNA quantitation by confocal laser scanning microscopy and evidence of nuclear polyplexes by FRET imaging. Nucleic Acids Res. 2008;36:1–12. doi: 10.1093/nar/gkn287. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 164.Godbey W.T., Wu K.K., Mikos A.G. Tracking the intracellular path of poly(ethylenimine)/DNA complexes for gene delivery. Proc. Natl. Acad. Sci. USA. 2002;96:5177–5181. doi: 10.1073/pnas.96.9.5177. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 165.Lam A.P., Dean D.A. Progress and prospects: Nuclear import of nonviral vectors. Gene Ther. 2010;17:439–447. doi: 10.1038/gt.2010.31. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 166.McLane L.M., Corbett A.H. Nuclear localization signals and human disease. IUBMB Life. 2009;61:697–706. doi: 10.1002/iub.194. [DOI] [PubMed] [Google Scholar]
- 167.Reaa J.C., Giblyb R.F., Barronc A.E., Shea L.D. Self-assembling peptide–lipoplexes for substrate-mediated gene delivery. Acta Biomater. 2009;5:903–912. doi: 10.1016/j.actbio.2008.10.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 168.Zhang H., Mitin A., Vinogradov S.V. Efficient Nuclear Targeting by NLS-PEG-Acridine Conjugates in the Transfection of Blood-Brain Barrier Endothelial Cells with Lipoplexes and Polyplexes. Bioconjugate Chem. 2009;20:120–128. doi: 10.1021/bc8003414. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 169.Hu Q., Wang J., Shen J., Liu M., Jin X., Tang G., Chu P.K. Intracellular pathways and nuclear localization signal peptide-mediated gene transfection by cationic polymeric nanovectors. Biomaterials. 2012;33:1135–1145. doi: 10.1016/j.biomaterials.2011.10.023. [DOI] [PubMed] [Google Scholar]
- 170.Miller A.M., Dean D.A. Tissue-specific and transcription factor-mediated nuclear entry of DNA. Adv. Drug Deliv. Rev. 2009;61:603–613. doi: 10.1016/j.addr.2009.02.008. [DOI] [PubMed] [Google Scholar]
- 171.Munkonge F.M., Amin V., Hyde S.C., Green A.-M., Pringle I.A., Gill D.R., Smith J.W.S., Hooley R.P., Xenariou S., Ward M.A., et al. Identification and Functional Characterization of Cytoplasmic Determinants of Plasmid DNA Nuclear Import. J. Biol. Chem. 2009;284:26978–26987. doi: 10.1074/jbc.M109.034850. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 172.Chen X., Kube D.M., Cooper M.J., Davis P.B. Cell Surface Nucleolin Serves as Receptor for DNA Nanoparticles Composed of Pegylated Polylysine and DNA. Mol. Ther. 2008;16:333–342. doi: 10.1038/sj.mt.6300365. [DOI] [PubMed] [Google Scholar]
- 173.Wagstaff K.M., Jans D.A. Nucleocytoplasmic transport of DNA: Enhancing non-viral gene transfer. Biochem. J. 2007;406:185–202. doi: 10.1042/BJ20070505. [DOI] [PubMed] [Google Scholar]
- 174.Fan Y., Yao J., Du R., Hou L., Zhou J., Lu Y., Meng Q., Zhang Q. Ternary complexes with core-shell bilayer for double level targeted gene delivery: In vitro and in vivo evaluation. Pharm. Res. 2013;30:1215–1227. doi: 10.1007/s11095-012-0960-9. [DOI] [PubMed] [Google Scholar]
- 175.Yao J., Fan Y., Li Y., Huang L. Strategies on the nuclear-targeted delivery of genes. J. Drug Target. 2013;21:926–939. doi: 10.3109/1061186X.2013.830310. [DOI] [PMC free article] [PubMed] [Google Scholar]








