Abstract
Elastase is a globular glycoprotein and belongs to the chymotrypsin family. It is involved in several inflammatory cascades on the basis of cleaving the important connective tissue protein elastin, and is strictly regulated to a balance by several endogenous inhibitors. When elastase and its inhibitors are out of balance, severe diseases will develop, especially those involved in the cardiopulmonary system. Much attention has been attracted in seeking innovative elastase inhibitors and various advancements have been taken on clinical trials of these inhibitors. Natural functional peptides from venomous animals have been shown to have anti-protease properties. Here, we identified a kazal-type serine protease inhibitor named ShSPI from the cDNA library of the venom glands of Scolopendra hainanum. ShSPI showed significant inhibitory effects on porcine pancreatic elastase and human neutrophils elastase with Ki values of 225.83 ± 20 nM and 12.61 ± 2 nM, respectively. Together, our results suggest that ShSPI may be an excellent candidate to develop a drug for cardiopulmonary diseases.
Keywords: centipede, kazal-type inhibitor, human neutrophils elastase, ShSPI
1. Introduction
Centipedes are predatory arthropods distributed on every continent except Antarctica. They prey mainly by secreting venom from the venom glands, which are connected to the first pair forcipules. Centipede venoms are comprised of proteins and peptides, which show a variety of biological activities [1]. More than 500 proteins and peptides in centipede venom have been found with diverse pharmacological properties, including the activity of platelet aggregation, anticoagulation, phospholipase A2 (PLA2), trypsin inhibition, ion channel inhibition, and antimicrobial [2,3,4,5,6,7]. Despite the clear clinical implications following envenomation by Scolopendra hainanum (http://arachnoboards.com/threads/scolopendra-hainanum.308202/), there is no related study on S. hainanum toxins, currently.
Elastase is a group of serine proteases that include the macrophage elastase, the fibroblast elastase, the neutrophil elastase, and the pancreatic elastase, which can not only cleave the important connective tissue protein elastin, but also facilitate the degradation of the extracellular matrix such as fibronectin; laminin; collagens III, IV, and VI; and proteoglycans. Human neutrophil elastase (HNE) is a serine protease (29 kDa) expressed by neutrophil upon activation, which can be secreted into the phagosome during phagocytosis or released during neutrophil necrosis [8,9]. In physiological condition, the activity of HNE is strictly regulated to a balance by several endogenous inhibitors, including elafin, serpins, α1-antitrypsin, and secretory leukocytes proteinase inhibitor. When out of control, HNE can cause severe diseases such as acute lung injury, acute respiratory distress syndrome, chronic obstructive pulmonary disease, and pulmonary fibrosis [9]. To stabilize these diseases and ameliorate symptoms, new and specific anti-proteases, especially elastase inhibitors, might be excellent candidates.
Numerous peptidic elastase inhibitors have been identified from the toxins of venomous animals [10,11], e.g., secapin from bee venom [12], BmKTT-2 from scorpion venom [13], AvCI from spider venom [14] and guamerin from leech secretions [15]. These elastase inhibitors exhibit potent inhibitory effects to elastase and provide a valuable source for new drug development. Although over 500 proteins or peptides with diverse pharmacological properties from the centipede venom have been discovered, there is no report about the elastase inhibitor from the centipede toxins.
In this study, we investigated a novel elastase inhibitor named ShSPI, which belongs to the atypical kazal-type proteases inhibitor and has the significant inhibitory effects on porcine pancreatic elastase (PPE) and HNE. Sivelestat is a specific HNE inhibitor, which has been reported to mitigate lung injury in several mouse models, including pulmonary fibrosis and acute lung injury [16,17]. Comparing to sivelestat, ShSPI demonstrates better inhibitory activity to elastases. Our results suggest that ShSPI may be an excellent candidate to develop the drug for elastase related diseases, such as cardiopulmonary diseases.
2. Results
2.1. Determination of the Primary Structure of ShSPI
A cDNA sequence encoding a precursor protein composed of 61 amino acid (aa) was found. A hypothetical signal peptide (22 aa), pro-peptide (-QRNRR-), and a mature peptide (34 aa) were identified (Figure 1A, marked by box) through online analysis (SignalP-5.0, http://www.cbs.dtu.dk/services/SignalP/). BLAST search indicated that the mature peptide named ShSPI (Figure 1A, marked by grey color) shares pair sequence similarity with other atypical kazal family (Figure 1C). The amino acid sequence of ShSPI is indicated in Figure 1B: CPQVCPAIYQPVFDEFGRMYSNSCEMQRARCLRG.
2.2. Refolding of ShSPI
We chemically synthesized linear ShSPI and refolded its two disulfide bridges with the glutathione redox system (Figure 2A). C18 reverse phase-high performance liquid chromatography (RP-HPLC) was conducted to purify the refolded ShSPI, with the elution of indicated gradients of acetonitrile (containing 0.1% (v/v) trifluoroacetic acid) at a flow rate of 1.5 mL/min. Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS) was applied to determine the purity of peptides to be higher than 95% (Figure 2B). Consistent with the predicted molecular weight (MW) of ShSPI, the observed MW of refolded ShSPI was 3952.7 Da, indicating that the two disulfide bridges have been refolded successfully.
2.3. ShSPI Inhibits Elastase Potently and Selectively
Based on the sequence alignment analysis, we speculate that ShSPI may contain inhibitory activity on some proteases. The enzyme activity of ShSPI to a diversity of proteases was assayed. ShSPI (500 nM) exhibited significant inhibitory activity on porcine pancreatic elastase (PPE) and human neutrophil elastase (HNE), while it showed no inhibitory activity against factor Xa (FXa), factor XIIa (FXIIa), kallikrein, thrombin, trypsin, chymotrypsin, or cathepsin G (CG) (Figure 3A).
Sivelestat (also known as ONO-5046), which is a potent elastase inhibitor, has been used as a clinical drug [20]. It has been reported that sivelestat has little inhibitory activity to PPE and strong inhibitory activity to HNE with a Ki value of 200 ± 20 nM [21]. We compared the inhibitory activity to PPE and HNE of ShSPI and sivelestat. As illustrated in Figure 3B,C, both ShSPI and sivelestat significantly inhibited the activity of PPE and HNE in a dose-dependent manner. However, ShSPI showed better inhibitory effect on PPE and HNE than sivelestat. At the concentration of 500 nM, the inhibitory rate of ShSPI and sivelestat on PPE was about 18% and 65%, respectively. At the concentration of 50 nM, ShSPI and sivelestat exhibited an effect on HNE with an inhibitory rate of 16% and 44%, respectively.
2.4. Enzymatic Kinetics of ShSPI on Elastase
The enzymatic kinetics of ShSPI on elastase was further explored; varying doses of ShSPI (from 0 to 885 nM) and elastase colorimetric substrate (30, 60, and 90 μg/mL) were used. The Dixon plot analysis showed that linear curves converged on the x-axis, suggesting that ShSPI is a non-competitive inhibitor of elastase (Figure 4A,B) and the Ki values to PPE and HNE were 225.8 ± 20 nM and 12.6 ± 2 nM, respectively (Table 1).
Table 1.
Compound | ShSPI | ||
---|---|---|---|
Enzyme Injected | PPE | HNE | |
Enzyme kinetics | Ki (nM) | 225.83 ± 20 | 12.61 ± 2 |
Binding Kinetics | ka (M−1s−1) | 4.5 × 104 | 4.5 × 103 |
kd (s−1) | 4.7 × 10−3 | 1.9 × 10−4 | |
KA (M−1) | 9.7 × 106 | 2.4 × 107 | |
KD (M) | 1.0 × 10−7 | 4.2 × 10−8 |
2.5. Binding Kinetics of ShSPI on Elastase
To verify the direct interaction of ShSPI and elastase, surface plasmon resonance (SPR) biosensor technology was used to determine the binding affinity of ShSPI to HNE and PPE. The ability of ShSPI binding to elastase was reflected by the response values (RU) that were directly recorded by the Biacore 3000 instrument (GE Healthcare Life Sciences, Pittsburgh, PA, USA). As shown in Figure 4C,D, the RU increased with increasing elastase (HNE or PPE) concentration, which indicated that ShSPI binds to elastase in a concentration dependent manner.
The equilibrium dissociation constant (KD, M) of ShSPI to PPE was 1.0 × 10−7 and to HNE was 4.2 × 10−8 (as listed in Table 1). The binding of ShSPI with HNE was stronger than that with PPE, which is consistent with the protease inhibition assays.
2.6. The NMR Structure of ShSPI
The three-dimensional structure of the ShSPI peptide was determined using two-dimensional (2D) nuclear magnetic resonance (NMR) spectroscopy. The chemical shift analysis was used to identify the disulfide-bonded or free-state cystein, and cis- or trans-conformation of the proline. The chemical shifts of the cysteins Cβ are all between 35.85 and 40.98 ppm, indicating that the disulfide bonds were formed. The initial structure calculations only with NOE restraints demonstrated the Cys-1 and Cys-31, and Cys-5 and Cys-24 disulfide bond format. The Cγ values of prolines are 27.89 ppm (Pro2), 27.38 ppm (Pro6), and 27.36 ppm (Pro11), respectively, indicating all of the prolines are in trans-conformation [22], while the Cγ values for prolines with cis-conformation fall at 24.4 ± 0.7 ppm. The unambiguous and strong H(i)-Hδ(i+1: Pro)(dαδ) nuclear overhauser effect (NOE) signals in the NOESY spectra also confirmed the trans-conformation. The H(i)-Hδ(i+1: Pro)(dαδ) or Hα(i)-Hα(i+1: Pro)(dαα) NOEs of Pro (i+1) and its immediate preceding residue (i) were used to assign the configuration of Pro residues. The strong dαδ NOEs indicates the trans-configuration while strong dαα NOEs indicates the cis-configuration. The structural statistics for the final 15 structure ensembles (Figure 5A,B) are given in Table 2.
Table 2.
Experimental Restraints of ShSPI (C1–G34) | |
---|---|
NOE distance restraints | 448 |
Intra-residue | 78 |
Sequential | 167 |
Medium range (2 ≤ |i–j| ≤ 4) | 100 |
Long range (|i–j| ≥ 5) | 103 |
Hydrogen bonds constraints | 4 |
Energies (kcal/mol) | |
Bonds | 4.99 ± 0.39 |
Angles | 39.88 ± 1.53 |
Improper | 5.34 ± 0.35 |
Van del Waals (repel) | 17.13 ± 2.00 |
NOE | 30.16 ± 4.08 |
r.m.s . deviations from idealized 1 | |
Bonds (Å) | 0.003 ± 0.000 |
Angles (deg) | 0.521 ± 0.010 |
Improper (deg) | 0.347 ± 0.012 |
NOE | 0.048 ± 0.003 |
Ramachandran Plot | |
Most favored regions | 93.8% |
Additional allowed regions | 6.2% |
Mean pairwise RMSD (ShSPI P2-R33) (Å) | |
Backbone | 0.49 ± 0.10 |
Heavy Atoms | 1.16 ± 0.20 |
1 Quality of the structures was evaluated by MolProbity.
The structure of ShSPI consists of a cystine-stabilized α-helical (CSH) motif formed by residues Ser-23 to Arg-33, and a two-stranded antiparallel β-sheet (strand 1, Pro-11 to Asp-14; and strand 2, Gly-17 to Tyr-20). The N-terminal loop is stabilized by the formation of disulfide bonds. The NOE pattern demonstrates that Cys-1 (C1) forms a disulfide bond with Cys-31 (C4), while Cys-5 (C2) with Cys-24 (C3). This is further evidenced by the partial reduction and MS data (data not shown). Taken together, ShSPI contains the C1–C4 and C2–C3 disulfide bond connectivity (Figure 1B).
2.7. ShSPI is an Atypical Kazal Domain and the Minimal Functional Unit
As the serine protease inhibitors, the canonical kazal domain is composed of one α-helix and three-stranded anti-parallel β-sheet, six cysteins forming three disulfide bonds with the pattern of C1–C5, C2–C4, and C3–C6. Kazal domains with two disulfide bonds and the absence of the third and six cysteines were referred as atypical kazal domains [23]. The ShSPI belongs to this class. The structure superimposition with the canonical kazal domain OMSVP3 (pdb: 1IY5) is demonstrated in Figure 5C, which shows that the tertiary structure of ShSPI resembles the core structure of canonical kazal domain.
To gain insights into the difference between ShSPI and other atypical kazal inhibitors, we superimposed the three-dimensional structures of ShSPI with other reported atypical kazal domain structures, including anemonia elastase inhibitor (AEI, pdb: 1Y1B) (Figure 5D), domain 6 of LEKT1 (pdb: 1H0Z) (Figure 5E), and Greglin (pdb: 4GI3) (Figure 5F). Compared with ShSPI, other atypical kazal domains show either NH2- or COOH-terminal long or short extensions. The structural comparison demonstrates that the ShSPI motif with 34 residues is the core structure contained by all of the atypical kazal domains. Meanwhile, ShSPI contains very short sequence with only three residues between the first two cysteines, instead of 6–13 residues in the typical kazal domains (Figure 1C, bottom). Together with its activity, to the best of our knowledge, the ShSPI could be regarded as the minimal functional unit.
2.8. Point Mutations Confirm the Important Residues of ShSPI
The sequence analysis of the kazal-family shows that P3, the second conserved cysteine residue, and P15′ with the residue asparagine are highly conserved, while the remaining ten contact residues are hypervariable. The numbering is according to the nomenclature of Schechter and Berger and using HNE as reference enzyme [18,19]. We supposed that ShSPI conforms to this regular pattern. The ShSPI mutant C5A (P3) and N22A (P15′) of ShSPI are not soluble or show no activity (Ki > 1 mM) (Table 3), indicating that the point mutation disrupts the global fold and the mutant could not fold properly (data not shown). These results confirm the essential importance of residues in the P3 and P15′ positions.
Table 3.
Ki Value of ShSPI to HNE: 12.61 nM | |||||
---|---|---|---|---|---|
Position 2 | Mutants | Ki (nM) | Position 2 | Mutants | Ki (nM) |
P6 | P2A | 100.56 | P3 | C5A | insoluble |
P5 | Q3A | 113.74 | P2′ | Y9A | >1 mM |
P4 | V4A | 13.16 | P15′ | N22A | insoluble |
P2 | P6A | 105.05 | P18′ | E25A | >1 mM |
P3′ | Q10A | 13.55 | |||
P14′ | S21A | 16.84 |
To further confirm the important residues for the interaction between ShSPI and HNE, point mutation method was applied. Through the structural analysis, several ShSPI mutants were synthesized, including P2A, Q3A, V4A, P6A Y9A, Q10A, S21A, N22A, and E25A. The inhibitory effects of these mutants to HNE were tested. Mutants Y9A, N22A, and E25A did not show any inhibitory activity to HNE, demonstrating that these three residues are vital for the inhibitory activity of ShSPI. Other residues of ShSPI, such as Pro2, Gln3, and Pro6, are also important for the inhibitory to elastase. The single mutation significantly decreased their HNE activity. The Ki values of these mutants are listed in Table 3.
2.9. ShSPI Showed Plasma Stability
The structural information shows that ShSPI is the minimal functional unit and the folding is stabilized through the two intra-disulfide bonds and the tertiary structure. To investigate the stability of ShSPI in physiological condition, ShSPI was co-incubated with human plasma over 48 h. ShSPI was found to be remarkably stable in human plasma, with no significant degradation over 48 h. Compared with the basal inhibitory activity, the inhibitory percentage to HNE and PPE was still around 12% and 17%, respectively (Figure 5G). Stability of ShSPI in plasma could support the hypothesis that ShSPI could be stable and affect strongly in vivo.
3. Discussion
Venomous creatures are considered to be a very distinctive class of species among animals [22]. Venomous animals are equipped with venom glands and venoms, which provide them outstanding advantages for their existence [24,25,26]. Toxins from centipedes have been well studied. Some of them have been established as important tools for predation, and some of them are useful candidates for drug design [22,27]. To the best of our knowledge, as a novel member of centipedes distributed only in Hainan and Guangxi province, China, the bioactive peptides from venom of S. hainanum have not been reported [26,28]. For the first time, we identified a new serine protease inhibitor (SPI) from S. hainanum, named as ShSPI and characterized as an atypical kazal motif. Through the sequence and structural analysis, the ShSPI is considered as the minimal functional unit. The core motif includes the reactive loop with extended conformation and appropriate backbone geometry, the two disulfide bonds-stabilized α-helical (CSH) motif, and two-stranded anti-parallel β-sheet. It is missing two cysteine residues and the corresponding disulfide bond is not essential for inhibitor reactivity and stability [23].
SPIs are widely distributed in a variety of species [29,30]. They are able to inhibit the catalytic activity of proteolytic enzymes and guarantee the inhibiting proteolysis of proteinase, which are important in poisonous animals’ biological processes for survival [31,32]. Among kazal-type SPIs, most domains described so far contain six highly conserved cysteine residues, with the formation of three intra-domain disulfide bonds. In our study, ShSPI has only two disulfide bonds, thus belongs to atypical kazal family. However, the tertiary structure of ShSPI resembles the core structure of canonical kazal domain, which may provide the primary interaction site of ShSPI to proteinases. Classical SPIs with multiple kazal domains show broad-spectrum inhibition on serine proteinases such as trypsin, subtilisin, thrombin, chymotrypsin, and elastase potently. Despite the single kazal domain instead of multiple kazal domains in other SPIs, ShSPI has a stable structure which exhibits strong activity against elastase. In consistence with this, our results show that ShSPI specifically inhibits elastase with Ki values of 225.83 ± 20 nM to PPE and 12.61 ± 2 nM to HNE.
Other atypical kazal family inhibitors have shown narrower specificity compared to the classical kazal family. However, ShSPI is more specific. The structural similarity and difference within these inhibitors may give some explanation. All of the atypical kazal family inhibitors have the similar core structure, while ShSPI does not have the additional NH2- or COOH-terminal extensions and contains very short sequence with only three residues between the first two cysteines, instead of 6–13 residues in the typical kazal domains. It was reported that, when rigidity increases near the reactive site, the inhibitor is more likely to show narrower specificity. For example, compared with wild-type AEI, the AEI analog (just one aa between the first two cysteines) did not show inhibitory activity against PPE, while it retained almost the same potent inhibitory activity toward Streptomyces griseus protease B [33]. As a result, the characteristics of ShSPI can make it easier to reach the interaction site of elastase, and ShSPI could be a potential probe to study the interaction characteristics between SPIs and enzymes, which could provide us a clue to design the inhibitors with high specificity and selectivity.
Sivelestat, the selective neutrophil elastase inhibitor has been safely used in specific clinical scenarios, including refractory Kawasaki disease [34] and acute lung injury [16,35]. It also has been found that sivelestat can improve the survival in the clinical relevant animal models of sepsis, in which not only did damage occur in the lung, but also other organs including kidneys, liver, and heart were impaired [36,37,38,39]. From the results, we found that ShSPI exhibited better effects on the inhibitory of PPE and HNE than that of sivelestat at the same concentration. ShSPI might be an excellent candidate to develop the drug for the diseases sivelestat treated.
In conclusion, a potent elastase inhibitor, named ShSPI, was identified and characterized from the centipede S. hainanum for the first time. ShSPI has a stable three-dimensional structure and strongly binds to the catalytic site of elastase, which confirmed the inhibitory effect on elastase. Our findings have important implications for the design and development of new drugs for diseases related with the destruction of HNE.
4. Materials and Methods
4.1. RNA Extraction and cDNA Synthesis
The venom glands of S. hainanum were collected. Total RNA was isolated by using TRIzol reagent (15596018, Invitrogen, Waltham, MA, USA), and cDNA was reverse-transcribed using SuperScript II Reverse Transcriptase and oligo(dT)12−18 primer with the SMART™ PCR cDNA synthesis kit (Clontech, Palo Alto, CA, USA). The clones of cDNA (>350 bp) were selected and sequenced by Sangon Biotech (Shanghai, China).
4.2. Peptides Synthesis and Refolding
Linear ShSPI and its mutant peptides were synthesized by GL biochem (Shanghai, China). Single site mutation peptides were designed according to the method described [40].
Peptides were refolded in a solution (pH 7.2) containing 10 mM glutathione (V900456, Sigma, Saint Loui, MO, USA) and 100 mM oxidized glutathione (V900363, Sigma, Saint Loui, MO, USA). The refolding solution was placed at 28 °C for 24 h. Then, we separated the different fractions using Reverse Phase-High Performance Liquid Chromatography (RP-HPLC) techniques and C18 column (Waters, Milford, MA, USA, 5 μm particle size, 250 mm × 4.6 mm). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS, Autoflex speed TOF/TOF, Bruker Daltonik GmbH, Bruker Corporation, Germany) was performed to determine the purity of the peptides, and refolded ShSPI with purity higher than 95% was collected for further research.
4.3. Assignment of the Disulfide Bonds
Refolded ShSPI (1 mg) was dissolved in 100 μL of 6 M guanidine hydrochloride (pH 6.0, G4505, Sigma, Saint Loui, MO, USA), and incubated for 30 min at 37 °C. Afterwards, 100 μL of 0.1 M TCEP (75259, Sigma, Saint Loui, MO, USA) were added to the sample and maintained for 3 min at 37 °C, and then 800 μL of 0.1% TFA-H2O were added immediately. Fractions were purified by using C18 RP-HPLC (Waters Corporation, 34 Maple Street Milford, MA, USA) with a linear acetonitrile gradient (0–60% over 60 min). The intermediate peptides were gathered, lyophilized, and alkylated with 0.5 M iodoacetamide (pH 8.3, I1149, Sigma, Saint Loui, MO, USA) for 1 min at 25 °C. Alkylated peptides were isolated and desalted by C18 RP-HPLC, and Edman degradation was performed on a Shimadzu protein sequencer (PPSQ-31A, Shimadzu, Nakagyo-ku, Kyoto 604-8511, Japan).
4.4. Protease Assays
Human neutrophils elastase (HNE, E8140), porcine pancreatic elastase (PPE, E0127), cathepsin G (CG, C4428), human trypsin (T6424), α-chymotrypsin from human pancreas (C8946), and thrombin from human plasma (T4393) were all purchased from Sigma-Aldrich (USA). Factor Xa (FXa, HFXa 1011) and Factor XIIa (FXIIa, HFXIIa 1212a) were from Enzyme Research Laboratories (South Bend, IN, USA). Kallikrein from human plasma (420307) was from Merck Millipore (Billerica, MA, USA).
Substrate for HNE and PPE (MeOSuc-Ala-Ala-Pro-Val-pNA, 324696) was purchased from Merck Millipore (USA). Substrates for CG (Succinyl-Ala-Ala-Pro-Phe-pNA, 573462), trypsin (Nalpha-Benzoyl-L-arginine 4-nitroanilide hydrochloride, B3133), FXa (CH3OCO-D-CHA-Gly-Arg-pNA-AcOH, F3301), chymotrypsin (N-Succinyl-Gly-Gly-Phe-pNA, S1899), thrombin (β-Ala-Gly-Arg-pNA diacetate, T3068), and kallikrein (Z-Phe-Arg 7-amido-4-methylcoumarin hydrochloride, C9521) were purchased from Sigma-Aldrich (USA).
As mentioned in our previous study [29], experiments for protease inhibitory activity were assayed in buffer (0.05 M Tris-HCl, pH 7.8) at 37 °C. The proteases (FXa, 0.1 nM; FXIIa, 10 nM; kallikrein, 400 nM; thrombin, 10 nM; chymotrypsin, 400 nM; trypsin, 10 nM; CG, 0.02 U/mL; HNE, 0.001 U/mL; and PPE, 1 μg/mL) and varying doses of ShSPI or sivelestat (MB1318, Meilun Biotehmology, Dalian, China) were pre-incubated for 10 min at 37 °C. At the end of the incubation, the reaction was initiated by the addition of the exclusive substrate solution and monitored by recording the absorbance at 405 nm every 30 s for 30 min. Enzyme activity in each well was calculated based on the initial slope of the reaction curve, and percentage of the initial slope of the uninhibited reaction was expressed. The inhibition constant Ki value was determined according to the Dixon method [41].
4.5. Surface Plasmon Resonance (SPR) Biosensor Analysis
Sensor chips CM5 (BR100012), 10 mM acetate buffer (BR100350, pH 4.0), amine coupling kit (BR100050), and HBS-P buffer (BR100826, used as running buffer) were all obtained from GE Healthcare Bio-sciences AB (Uppsala, Sweden). Data were collected and analyzed by BIAcore System (Version 3000, GE Healthcare Life Sciences, Pittsburgh, PA, USA) and BIA evaluation software (Version 3.0, GE Healthcare Life Sciences, Pittsburgh, PA, USA).
Before testing, ShSPI (100 μg/mL in acetate buffer, pH 4.0) was immobilized to the surface of CM5 chip. Following a standard amine coupling chemistry, running buffer was used to reach equilibration. HNE or PPE (doubling dilution) was injected over the immobilized ShSPI at a flow rate of 10 μL/min, and the association rate (ka, M−1s−1) was determined. After 3 min, running buffer was applied to the surface, and the dissociation rate (kd, s−1) was determined over 15 min for PPE and 30 min for HNE, and another 500 μL of running buffer were injected at a flow rate of 20 μL/min to rebalance the chip. The equilibrium association constant (KA, M−1) and the equilibrium dissociation constant (KD, M) were determined by ka/kd and kd/ka, respectively [42].
4.6. NMR Experiments
The ShSPI nuclear magnetic resonance (NMR) samples contained ~1.5 mM protein in a buffer containing 25 mM HEPES, pH 6.8, 50 mM KCl, and 5 mM DTT in either 90% H2O/10% D2O or in 100% D2O. NMR data were collected at 298 K on a Bruker Avance 800 MHz spectrometer. Two-dimensional (2D) homonuclear total correlated spectroscopy (TOCSY) was recorded with mixing times of 60 and 80 ms. The data for t1 × t2 were 512 × 2048. 2D nuclear overhauser effect spectroscopy (NOESY) was collected for sequential residue assignments, with mixing time of 100, 200, and 300 ms. The data for t1 × t2 were 1024 × 4096. In addition, 2D 1H-13C heteronuclear single-quantum correlation spectroscopy (HSQC) was carried out with 2048 × 4096 complex points at natural abundance. 1H-13C TOCSY-HSQC spectra were recorded to help the sequential assignment [43], with the recording data of 1042 and 4096 complex points, respectively.
To demonstrate the hydrogen bonds within the peptide, hydrogen–deuterium (H/D) exchange experiments were also collected. D2O was used to dissolve the lyophilized peptide. A set of 1D spectra was collected. The time points included 20 min, 30 min, 1 h, 2 h, 4 h, 8 h, 24 h, and 48 h, respectively. When the H/D exchanged for 8 h, the TOCSY spectrum was also recorded. We used NMRPipe [44] and SPARKY (https://www.cgl.ucsf.edu/home/sparky) to process and analyzed the data.
The NOE were analyzed and assigned manually, and then converted into distance constraints. The program xplor-NIH [45] was used to calculate the structure. The quality of the NMR ensembles was evaluated by MolProbity [46].
4.7. Plasma Stability
Lyophilized human plasma (400100, Cayman, Ann Arbor, MI, USA) was resuspended in sterile water according to the instruction, then ShSPI was added to each equivalent volume with a final concentration of 500 nM, and samples were co-incubated at 37 °C for two days. Triplicate samples were collected at selected time points (0, 6, 12, 18, 24, 30, 36, 42, and 48 h) and protease activity was tested as described above.
4.8. Statistical Analysis
Experimental results were tested statistically by an unpaired two-tailed student’s t-test and expressed as mean ± SEM by GraphPad Prism (Version 5.0, GraphPad Software, San Diego, CA, USA). Data were considered statistically significant when p < 0.05.
Acknowledgments
The authors would like to thank Lin Zeng and Guolan Ma from Service Center of Public Technology, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, Yunnan, China.
Author Contributions
Conceptualization, M.R. and R.L.; Data curation, N.L.; Formal analysis, Q.Z. and R.L.; Funding acquisition, Z.D., J.L., and R.L.; Investigation, Z.D., M.J., M.X., T.Z., J.M., and R.L.; Methodology, M.R., J.L., and R.L.; Project administration, M.R., J.L., and R.L.; Resources, M.R. and R.L.; Software, N.L.; Supervision, M.R., J.L., and R.L.; Validation, M.R., J.L., and R.L.; Visualization, N.L. and R.L.; Writing—original draft, N.L.; and Writing—review and editing, Z.D., M.R., J.L., and R.L.
Funding
This research was funded by the National Science Foundation of China (NSFC) Grant (31630075, 31600721) and Yunnan Provincial Science and Technology Department Grant (2018ZF001 and 2019ZF003) to R.L., Yunnan Provincial Science and Technology Department Grant (2019FB127) to Z.D., and the NSFC Grant (21778059) and Ten Thousand Talent Program to J.L.
Conflicts of Interest
The authors declare no conflicts of interest.
Key Contribution
This study identified a kazal-type peptide ShSPI from the venom glands of S. hainanum firstly. ShSPI inhibits elastase potently and can be regarded as the minimal functional unit of the atypical kazal-type proteases inhibitor.
References
- 1.Liu Z.C., Zhang R., Zhao F., Chen Z.M., Liu H.W., Wang Y.J., Jiang P., Zhang Y., Wu Y., Ding J.P., et al. Venomic and Transcriptomic Analysis of Centipede Scolopendra subspinipes dehaani. J. Proteome Res. 2012;11:6197–6212. doi: 10.1021/pr300881d. [DOI] [PubMed] [Google Scholar]
- 2.Kong Y., Shao Y., Chen H., Ming X., Wang J.B., Li Z.Y., Wei J.F. A Novel Factor Xa-Inhibiting Peptide from Centipedes Venom. Int. J. Pept. Res. Ther. 2013;19:303–311. doi: 10.1007/s10989-013-9353-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Yang S., Liu Z., Xiao Y., Li Y., Rong M., Liang S., Zhang Z., Yu H., King G.F., Lai R. Chemical punch packed in venoms makes centipedes excellent predators. Mol. Cell. Proteomics. 2012;11:640–650. doi: 10.1074/mcp.M112.018853. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Gonzalez-Morales L., Diego-Garcia E., Segovia L., Gutierrez Mdel C., Possani L.D. Venom from the centipede Scolopendra viridis Say: Purification, gene cloning and phylogenetic analysis of a phospholipase A2. Toxicon. 2009;54:8–15. doi: 10.1016/j.toxicon.2009.03.003. [DOI] [PubMed] [Google Scholar]
- 5.Luo L., Li B., Wang S., Wu F., Wang X., Liang P., Ombati R., Chen J., Lu X., Cui J., et al. Centipedes subdue giant prey by blocking KCNQ channels. Proc. Natl. Acad. Sci. USA. 2018;115:1646–1651. doi: 10.1073/pnas.1714760115. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Yang S., Yang F., Wei N., Hong J., Li B., Luo L., Rong M., Yarov-Yarovoy V., Zheng J., Wang K., et al. A pain-inducing centipede toxin targets the heat activation machinery of nociceptor TRPV1. Nat. Commun. 2015;6:8297. doi: 10.1038/ncomms9297. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Rong M., Yang S., Wen B., Mo G., Kang D., Liu J., Lin Z., Jiang W., Li B., Du C., et al. Peptidomics combined with cDNA library unravel the diversity of centipede venom. J. Proteomics. 2015;114:28–37. doi: 10.1016/j.jprot.2014.10.014. [DOI] [PubMed] [Google Scholar]
- 8.Kawabata K., Hagio T., Matsumoto S., Nakao S., Orita S., Aze Y., Ohno H. Delayed neutrophil elastase inhibition prevents subsequent progression of acute lung injury induced by endotoxin inhalation in hamsters. Am. J. Resp. Crit. Care Med. 2000;161:2013–2018. doi: 10.1164/ajrccm.161.6.9904047. [DOI] [PubMed] [Google Scholar]
- 9.Rosenbloom J., Macarak E., Piera-Velazquez S., Jimenez S.A. Human Fibrotic Diseases: Current Challenges in Fibrosis Research. Methods Mol. Biol. 2017;1627:1–23. doi: 10.1007/978-1-4939-7113-8_1. [DOI] [PubMed] [Google Scholar]
- 10.Liu H., Chen J., Wang X., Yan S., Xu Y., San M., Tang W., Yang F., Cao Z., Li W., et al. Functional characterization of a new non-Kunitz serine protease inhibitor from the scorpion Lychas mucronatus. Int. J. Biol. Macromol. 2015;72:158–162. doi: 10.1016/j.ijbiomac.2014.08.010. [DOI] [PubMed] [Google Scholar]
- 11.Wan H., Lee K.S., Kim B.Y., Zou F.M., Yoon H.J., Je Y.H., Li J., Jin B.R. A spider-derived Kunitz-type serine protease inhibitor that acts as a plasmin inhibitor and an elastase inhibitor. PLoS ONE. 2013;8:e53343. doi: 10.1371/journal.pone.0053343. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Lee K.S., Kim B.Y., Yoon H.J., Choi Y.S., Jin B.R. Secapin, a bee venom peptide, exhibits anti-fibrinolytic, anti-elastolytic, and anti-microbial activities. Dev. Comp. Immunol. 2016;63:27–35. doi: 10.1016/j.dci.2016.05.011. [DOI] [PubMed] [Google Scholar]
- 13.Ding L., Wang X., Liu H., San M., Xu Y., Li J., Li S., Cao Z., Li W., Wu Y., et al. A new Kunitz-type plasmin inhibitor from scorpion venom. Toxicon. 2015;106:7–13. doi: 10.1016/j.toxicon.2015.09.004. [DOI] [PubMed] [Google Scholar]
- 14.Wan H., Lee K.S., Kim B.Y., Yuan M., Zhan S., You H., Li J., Jin B.R. A spider (Araneus ventricosus) chymotrypsin inhibitor that acts as an elastase inhibitor and a microbial serine protease inhibitor. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2013;165:36–41. doi: 10.1016/j.cbpb.2013.03.004. [DOI] [PubMed] [Google Scholar]
- 15.Jung H.I., Kim S.I., Ha K.S., Joe C.O., Kang K.W. Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia. J. Biol. Chem. 1995;270:13879–13884. doi: 10.1074/jbc.270.23.13879. [DOI] [PubMed] [Google Scholar]
- 16.Takemasa A., Ishii Y., Fukuda T. A neutrophil elastase inhibitor prevents bleomycin-induced pulmonary fibrosis in mice. Eur. Respir. J. 2012;40:1475–1482. doi: 10.1183/09031936.00127011. [DOI] [PubMed] [Google Scholar]
- 17.Ishii T., Doi K., Okamoto K., Imamura M., Dohi M., Yamamoto K., Fujita T., Noiri E. Neutrophil elastase contributes to acute lung injury induced by bilateral nephrectomy. Am. J. Pathol. 2010;177:1665–1673. doi: 10.2353/ajpath.2010.090793. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Schechter I., Berger A. On the size of the active site in proteases. I. Papain. Biochem. Biophys. Res. Commun. 1967;27:157–162. doi: 10.1016/S0006-291X(67)80055-X. [DOI] [PubMed] [Google Scholar]
- 19.Koizumi M., Fujino A., Fukushima K., Kamimura T., Takimoto-Kamimura M. Complex of human neutrophil elastase with 1/2SLPI. J. Synchrotron Radiat. 2008;15:308–311. doi: 10.1107/S0909049507060670. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Aikawa N., Kawasaki Y. Clinical utility of the neutrophil elastase inhibitor sivelestat for the treatment of acute respiratory distress syndrome. Ther. Clin. Risk Manag. 2014;10:621–629. doi: 10.2147/TCRM.S65066. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Kawabata K., Suzuki M., Sugitani M., Imaki K., Toda M., Miyamoto T. ONO-5046, a novel inhibitor of human neutrophil elastase. Biochem. Biophys. Res. Commun. 1991;177:814–820. doi: 10.1016/0006-291X(91)91862-7. [DOI] [PubMed] [Google Scholar]
- 22.Fry B.G., Roelants K., Champagne D.E., Scheib H., Tyndall J.D., King G.F., Nevalainen T.J., Norman J.A., Lewis R.J., Norton R.S., et al. The toxicogenomic multiverse: Convergent recruitment of proteins into animal venoms. Annu. Rev. Genomics. Hum. Genet. 2009;10:483–511. doi: 10.1146/annurev.genom.9.081307.164356. [DOI] [PubMed] [Google Scholar]
- 23.Tian M., Kamoun S. A two disulfide bridge Kazal domain from Phytophthora exhibits stable inhibitory activity against serine proteases of the subtilisin family. BMC Biochem. 2005;6:15. doi: 10.1186/1471-2091-6-15. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Cesar P.H.S., Cardoso Trento M.V., Sales T.A., Marques T.R., Braga M.A., Ramalho T.C., Marcussi S. Molecular interactions between p-coumaric acid and snake venom toxins. J. Cell. Biochem. 2019;120:14594–14603. doi: 10.1002/jcb.28721. [DOI] [PubMed] [Google Scholar]
- 25.Guarnieri M.C., de Albuquerque Modesto J.C., Perez C.D., Ottaiano T.F., Ferreira R.D.S., Batista F.P., de Brito M.V., Campos I., Oliva M.L.V. Zoanthid mucus as new source of useful biologically active proteins. Toxicon. 2018;143:96–107. doi: 10.1016/j.toxicon.2018.01.012. [DOI] [PubMed] [Google Scholar]
- 26.Kronmuller C. Review of the subspecies of Scolopendra subspinipes Leach, 1815 with the new description of the South Chinese member of the genus Scolopendra Linnaeus, 1758 named Scolopendra hainanum spec. nov (Myriapoda, Chilopoda, Scolopendridae) Spixiana. 2012;35:19–27. [Google Scholar]
- 27.Luan N., Shen W., Liu J., Wen B., Lin Z., Yang S., Lai R., Liu S., Rong M. A Combinational Strategy upon RNA Sequencing and Peptidomics Unravels a Set of Novel Toxin Peptides in Scorpion Mesobuthus martensii. Toxins. 2016;8:286. doi: 10.3390/toxins8100286. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Kang S., Liu Y., Zeng X., Deng H., Luo Y., Chen K., Chen S. Taxonomy and Identification of the Genus Scolopendra in China Using Integrated Methods of External Morphology and Molecular Phylogenetics. Sci. Rep. 2017;7:16032. doi: 10.1038/s41598-017-15242-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Luan N., Zhou C., Li P., Ombati R., Yan X., Mo G., Rong M., Lai R., Duan Z., Zheng R. Joannsin, a novel Kunitz-type FXa inhibitor from the venom of Prospirobolus joannsi. Thromb. Haemost. 2017;117:1031–1039. doi: 10.1160/TH16-11-0829. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Morais S.B., Figueiredo B.C., Assis N.R.G., Alvarenga D.M., de Magalhaes M.T.Q., Ferreira R.S., Vieira A.T., Menezes G.B., Oliveira S.C. Schistosoma mansoni SmKI-1 serine protease inhibitor binds to elastase and impairs neutrophil function and inflammation. PLoS Pathog. 2018;14:e1006870. doi: 10.1371/journal.ppat.1006870. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Tang X., Chen M., Duan Z., Mwangi J., Li P., Lai R. Isolation and Characterization of Poecistasin, an Anti-Thrombotic Antistasin-Type Serine Protease Inhibitor from Leech Poecilobdella manillensis. Toxins. 2018;10:429. doi: 10.3390/toxins10110429. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.He X., Shen C., Lu Q., Li J., Wei Y., He L., Bai R., Zheng J., Luan N., Zhang Z., et al. Prokineticin 2 Plays a Pivotal Role in Psoriasis. EBioMedicine. 2016;13:248–261. doi: 10.1016/j.ebiom.2016.10.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Hemmi H., Kumazaki T., Yoshizawa-Kumagaye K., Nishiuchi Y., Yoshida T., Ohkubo T., Kobayashi Y. Structural and functional study of an Anemonia elastase inhibitor, a “nonclassical” Kazal-type inhibitor from Anemonia sulcata. Biochemistry. 2005;44:9626–9636. doi: 10.1021/bi0472806. [DOI] [PubMed] [Google Scholar]
- 34.Ebata R., Yasukawa K., Nagai K., Saito Y., Higashi K., Homma J., Takada N., Takechi F., Saito N., Kobayashi H., et al. Sivelestat sodium hydrate treatment for refractory Kawasaki disease. Pediatr. Int. 2019;61:438–443. doi: 10.1111/ped.13851. [DOI] [PubMed] [Google Scholar]
- 35.Iwata K., Doi A., Ohji G., Oka H., Oba Y., Takimoto K., Igarashi W., Gremillion D.H., Shimada T. Effect of neutrophil elastase inhibitor (sivelestat sodium) in the treatment of acute lung injury (ALI) and acute respiratory distress syndrome (ARDS): A systematic review and meta-analysis. Intern. Med. 2010;49:2423–2432. doi: 10.2169/internalmedicine.49.4010. [DOI] [PubMed] [Google Scholar]
- 36.Suda K., Takeuchi H., Hagiwara T., Miyasho T., Okamoto M., Kawasako K., Yamada S., Suganuma K., Wada N., Saikawa Y., et al. Neutrophil elastase inhibitor improves survival of rats with clinically relevant sepsis. Shock. 2010;33:526–531. doi: 10.1097/SHK.0b013e3181cc064b. [DOI] [PubMed] [Google Scholar]
- 37.Schortgen F., Asfar P. Update in sepsis and acute kidney injury 2014. Am. J. Respir. Crit. Care Med. 2015;191:1226–1231. doi: 10.1164/rccm.201502-0307UP. [DOI] [PubMed] [Google Scholar]
- 38.Yan J., Li S., Li S. The role of the liver in sepsis. Int. Rev. Immunol. 2014;33:498–510. doi: 10.3109/08830185.2014.889129. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Drosatos K., Lymperopoulos A., Kennel P.J., Pollak N., Schulze P.C., Goldberg I.J. Pathophysiology of sepsis-related cardiac dysfunction: Driven by inflammation, energy mismanagement, or both? Curr. Heart Fail. Rep. 2015;12:130–140. doi: 10.1007/s11897-014-0247-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Laskowski M., Qasim M.A., Yi Z. Additivity-based prediction of equilibrium constants for some protein–protein associations. Curr. Opin. Struct. Biol. 2003;13:130–139. doi: 10.1016/S0959-440X(03)00013-7. [DOI] [PubMed] [Google Scholar]
- 41.He W., Wu J.J., Ning J., Hou J., Xin H., He Y.Q., Ge G.B., Xu W. Inhibition of human cytochrome P450 enzymes by licochalcone A, a naturally occurring constituent of licorice. Toxicol. In Vitro. 2015;29:1569–1576. doi: 10.1016/j.tiv.2015.06.014. [DOI] [PubMed] [Google Scholar]
- 42.Stevens T., Ekholm K., Granse M., Lindahl M., Kozma V., Jungar C., Ottosson T., Falk-Hakansson H., Churg A., Wright J.L., et al. AZD9668: Pharmacological characterization of a novel oral inhibitor of neutrophil elastase. J. Pharmacol. Exp. Ther. 2011;339:313–320. doi: 10.1124/jpet.111.182139. [DOI] [PubMed] [Google Scholar]
- 43.Kover K.E., Hruby V.J., Uhrin D. Sensitivity- and gradient-enhanced heteronuclear coupled/decoupled HSQC-TOCSY experiments for measuring long-range heteronuclear coupling constants. J. Magn. Reson. 1997;129:125–129. doi: 10.1006/jmre.1997.1265. [DOI] [PubMed] [Google Scholar]
- 44.Delaglio F., Grzesiek S., Vuister G.W., Zhu G., Pfeifer J., Bax A. NMRPipe: A multidimensional spectral processing system based on UNIX pipes. J. Biomol. NMR. 1995;6:277–293. doi: 10.1007/BF00197809. [DOI] [PubMed] [Google Scholar]
- 45.Schwieters C.D., Kuszewski J.J., Tjandra N., Clore G.M. The Xplor-NIH NMR molecular structure determination package. J. Magn. Reson. 2003;160:65–73. doi: 10.1016/S1090-7807(02)00014-9. [DOI] [PubMed] [Google Scholar]
- 46.Williams C.J., Headd J.J., Moriarty N.W., Prisant M.G., Videau L.L., Deis L.N., Verma V., Keedy D.A., Hintze B.J., Chen V.B., et al. MolProbity: More and better reference data for improved all-atom structure validation. Protein Sci. 2018;27:293–315. doi: 10.1002/pro.3330. [DOI] [PMC free article] [PubMed] [Google Scholar]